Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B021105.709ON38938919940.0
ZYRO0B16478g5.709ON39138511221e-152
NCAS0G002005.709ON43838710691e-143
Kwal_55.196615.709ON37135010571e-142
Suva_9.355.709ON39334910521e-141
KLTH0E00880g5.709ON37134410471e-141
Skud_9.155.709ON40235010471e-141
SAKL0E15070g5.709ON38537810371e-139
YIL153W (RRD1)5.709ON39336010311e-138
Kpol_2001.775.709ON41335110301e-138
Smik_9.165.709ON3933259961e-133
NDAI0F002405.709ON4643269941e-132
TPHA0D046505.709ON4213769801e-130
AFR293C5.709ON3653279361e-124
Ecym_40125.709ON3953809351e-124
CAGL0H06655g5.709ON4244019111e-120
KAFR0D021905.709ON4263909081e-119
TBLA0E016905.709ON4883389041e-118
KLLA0A00462g5.709ON3533448511e-111
KNAG0L021705.709ON3963798411e-109
ZYRO0F07326g8.674ON3522194011e-44
Smik_6.3498.674ON3582183993e-44
TPHA0D012408.674ON3592223976e-44
CAGL0M02255g8.674ON3582183977e-44
Skud_16.1308.674ON3582183977e-44
YPL152W (RRD2)8.674ON3582183942e-43
ACR139C8.674ON3592173872e-42
Kwal_26.87838.674ON3552193854e-42
TDEL0A062008.674ON3552223844e-42
KLTH0D11176g8.674ON3532203844e-42
Suva_16.1588.674ON3582183837e-42
KNAG0J016908.674ON3632213802e-41
NCAS0C016908.674ON3592183793e-41
Kpol_1013.48.674ON3582203775e-41
KLLA0F11187g8.674ON3602273751e-40
NDAI0E024108.674ON3592183732e-40
KAFR0H024408.674ON3532303696e-40
SAKL0H06622g8.674ON3552763689e-40
Ecym_23998.674ON3512203671e-39
TBLA0C018608.674ON3562223602e-38
SAKL0H20174g4.39ON146773713.8
KLLA0C15785g3.401ON228759704.4
Suva_7.3973.457ON38966677.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B02110
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   772   0.0  
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   436   e-152
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      416   e-143
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   411   e-142
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   409   e-141
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   407   e-141
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   407   e-141
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   404   e-139
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   401   e-138
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   401   e-138
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   388   e-133
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      387   e-132
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   382   e-130
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   365   e-124
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   364   e-124
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   355   e-120
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   354   e-119
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   352   e-118
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   332   e-111
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   328   e-109
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   159   1e-44
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   158   3e-44
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   157   6e-44
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   157   7e-44
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   157   7e-44
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   156   2e-43
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   153   2e-42
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   152   4e-42
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   152   4e-42
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   152   4e-42
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   152   7e-42
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   150   2e-41
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   150   3e-41
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   149   5e-41
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   149   1e-40
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   148   2e-40
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   146   6e-40
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   146   9e-40
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   145   1e-39
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   143   2e-38
SAKL0H20174g Chr8 (1764879..1769282) [4404 bp, 1467 aa] {ON} wea...    32   3.8  
KLLA0C15785g Chr3 complement(1367880..1374743) [6864 bp, 2287 aa...    32   4.4  
Suva_7.397 Chr7 (688325..689494) [1170 bp, 389 aa] {ON} YGR112W ...    30   7.5  

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/389 (95%), Positives = 372/389 (95%)

Query: 1   MISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPS 60
           MISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPS
Sbjct: 1   MISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPS 60

Query: 61  GIXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYH 120
           GI                 DETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYH
Sbjct: 61  GIEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYH 120

Query: 121 KCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYY 180
           KCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYY
Sbjct: 121 KCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYY 180

Query: 181 KLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDY 240
           KLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDY
Sbjct: 181 KLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDY 240

Query: 241 ADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVV 300
           ADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVV
Sbjct: 241 ADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVV 300

Query: 301 QHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPHGKL 360
           QHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPHGKL
Sbjct: 301 QHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPHGKL 360

Query: 361 SQVHKLPTRGTMQPPTSLPRTFNRSAKKE 389
           SQVHKLPTRGTMQPPTSLPRTFNRSAKKE
Sbjct: 361 SQVHKLPTRGTMQPPTSLPRTFNRSAKKE 389

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  436 bits (1122), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 210/385 (54%), Positives = 267/385 (69%), Gaps = 11/385 (2%)

Query: 11  QTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXXXXXX 70
            T+F +PVK IFDSQ   +FQ SVAI RLKY ++KYA++I+   I   PS I        
Sbjct: 8   NTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVG 67

Query: 71  XXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYL 130
                    D+TPP  GPRRYGNLACRDWH K+D  +  L ++VLP  +H CI EL +YL
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127

Query: 131 GNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLILTY 190
           GNSFGS+TRLDYGTGHELSFLAV+GA+DMLGL+T EF G+D LL+ + YY +VRKLILTY
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 191 TLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAI 250
           TLEPAGSHGVWGLDDHFH+ Y+ GS+QW++    P+ PRD+ N  LVQ+YA  NLYCQ I
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247

Query: 251 DFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGPGFY 310
            FI+ VK GPF EHSSMLYD+A+TV TW+K++SGL+KMY VEVL KFPVVQHFWFG GFY
Sbjct: 248 GFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFY 307

Query: 311 PWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPH------GKLSQVH 364
           PW+ ++ G++L IY+ A+++++   + ++              P+PH         S+  
Sbjct: 308 PWVDNQTGKQLLIYDPADADRR---NTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEAR 364

Query: 365 KLPTRGTMQPPTSLPRTFNRSAKKE 389
             P R  M PPT+  RT N +A  +
Sbjct: 365 APPARTRMGPPTA--RTTNSTAHHD 387

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  416 bits (1069), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/387 (54%), Positives = 256/387 (66%), Gaps = 21/387 (5%)

Query: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHG--QPIVHEPSGIXX 64
           +D+  T+F  P K IFDSQ   DFQ S+A++RL++ L+KY  M+     P     S +  
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 65  XXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVL--------- 115
                          DETPP  GPRRYGNLACRDWH K++A L  LL ++L         
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152

Query: 116 -PQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLL 174
                H CI EL+YY+ N+FGSSTRLD+GTGHELSF+A + A+DMLGLWT    G D+LL
Sbjct: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212

Query: 175 LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNK 234
           LF+TYY LVRKLILTYTLEPAGSHGVWGLDDHFH+ YILGSSQW  +   PM PRDVK+ 
Sbjct: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRN--APMRPRDVKDI 270

Query: 235 VLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVL 294
            LV+ YA +NLYCQ I FIF VKSGPFSEHS +LYDIA++V TWSKVQ GL+KMY  EVL
Sbjct: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330

Query: 295 KKFPVVQHFWFGPGFYPWISDRNGQKLPIYENA--ESEKKQPPSMTTMAP--SNTTMYHL 350
           KKFPVVQHFWFG GFYPWI+   G+ LPIYE++  + E +Q   +   AP       +  
Sbjct: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390

Query: 351 TTRPIPHGKLSQVHKLPTRGTMQPPTS 377
           T +P   G  +      TR  M PP+S
Sbjct: 391 TAKP---GITAMPSVTNTRTNMAPPSS 414

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  411 bits (1057), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 241/350 (68%), Gaps = 3/350 (0%)

Query: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSG 61
           + + +ID+  T F  PVK IFDS+G   FQ SVA+ RLK HL KY  M+ GQ I  E S 
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60

Query: 62  IXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK 121
                             DETP   GPRRYGNLACRDWHDK++  + E LQ+ LP+ Y+ 
Sbjct: 61  -PNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYP 119

Query: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181
            I EL+YYLGN+FGS  RLDYGTGHELSF +V+ ALDMLG+W S F  KD+L LF+ YY 
Sbjct: 120 SIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYS 179

Query: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241
           LVRKLI  Y+LEPAGSHGVWGLDDHFH+IYI G+SQW+       +PR++++K++V +YA
Sbjct: 180 LVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYA 239

Query: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301
            +N YCQAI FIF VKSGPFSEHS MLYDI+ +V TWSKVQ GLLKMY+ EVL KFPVVQ
Sbjct: 240 GSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299

Query: 302 HFWFGPGFYPWISDRNGQKLPIYENAES--EKKQPPSMTTMAPSNTTMYH 349
           HFWFG   +PW S   G  LP YE ++    + Q P MT   PS T + H
Sbjct: 300 HFWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLRH 349

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  409 bits (1052), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/349 (57%), Positives = 241/349 (69%), Gaps = 5/349 (1%)

Query: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIH--GQPIVHE- 58
           +S   +D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  ++     P  H  
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 59  PSGIXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQD 118
            S I                 D+TPP  GPRRYGNLACR+WH KLDA+L + L++VLP  
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 119 YHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDT 178
           YH  +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALD+LGL+     G DV LLF  
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSK 179

Query: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVLV 237
           YY ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PRDV +K LV
Sbjct: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLV 239

Query: 238 QDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKF 297
           ++Y DTN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVL+KF
Sbjct: 240 REYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKF 299

Query: 298 PVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTT 346
           PVVQHFWFG GF+PWI+ +NG  LP++E  E E     + T+  P  T+
Sbjct: 300 PVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTS 348

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  407 bits (1047), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 235/344 (68%), Gaps = 2/344 (0%)

Query: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSG 61
           +S  RID S   F  P K IFDS+G+  FQ SVA+ RLK +L KY   + G  I  E S 
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIP-ETST 59

Query: 62  IXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK 121
                             D TP   GPRRYGNLACR WHDK+D +L  LL + LP+  HK
Sbjct: 60  NHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHK 119

Query: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181
            I EL YYLGN+FGS  RLDYGTGHELSF A + ALDMLG+W ++F   DVL LFD YY 
Sbjct: 120 SIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYA 179

Query: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241
           LVRKL+LTYTLEPAGSHGVWGLDDHFH+IYI G+SQW      P+ PR+V++K++V +Y 
Sbjct: 180 LVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYT 239

Query: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301
            TN YCQAI FIF VKSGPFSEHS ML+DI+ +V TWSKVQ GLLKMY+ EVL KFPVVQ
Sbjct: 240 KTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299

Query: 302 HFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTM-APSN 344
           HFWFG G +PW S  +G  LP YE ++  + Q    TT  AP+N
Sbjct: 300 HFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTN 343

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  407 bits (1047), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 245/350 (70%), Gaps = 5/350 (1%)

Query: 1   MISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHG--QPIVHE 58
           ++S   +D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  ++     P  H 
Sbjct: 9   IMSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHA 68

Query: 59  PSG-IXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQ 117
            S  I                 DETPP  GPRRYGNLACR+WH KLD +L++ LQ++LP 
Sbjct: 69  ASSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPA 128

Query: 118 DYHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFD 177
           +YH  +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALD+LG++     G DV LLF+
Sbjct: 129 EYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFN 187

Query: 178 TYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVL 236
            YY ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PR+V +K L
Sbjct: 188 KYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSL 247

Query: 237 VQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKK 296
           V DY DTN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVLKK
Sbjct: 248 VHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307

Query: 297 FPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTT 346
           FPVVQHFWFG GF+PW++ +NG  LP++E  E E  +  +  +  P++T+
Sbjct: 308 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTS 357

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  404 bits (1037), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 206/378 (54%), Positives = 248/378 (65%), Gaps = 14/378 (3%)

Query: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSG 61
           I+ P+ID+S TKF  PVK IFD+QG  DFQ SV + RL+ +L KY  ++ G   +   S 
Sbjct: 5   ITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLV-GTKNIPSTSN 63

Query: 62  IXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK 121
                             DETPP  GPRR+GN ACR WH K+  +L  LLQ  +P+ YH 
Sbjct: 64  NDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHV 123

Query: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181
           CI E+ YYLGN+FGS  RLDYGTGHELSFLAV+ A+DML LW S  SG+D+L LF+ YY 
Sbjct: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYT 183

Query: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241
           LV+KLI TYTLEPAGSHGVWGLDDHFH+ YILGSSQ +     P+ P D+ ++  V+DYA
Sbjct: 184 LVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYA 243

Query: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301
            TNLY QAI FI  VKSG FSEHS MLYDIA TV TWSKVQ GLLKMY  EVL KFPVVQ
Sbjct: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303

Query: 302 HFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPHGKLS 361
           HFWFG GF+PW++ ++G  LP YE  + E     S+T+++     M   T   +P     
Sbjct: 304 HFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSIS----NMPTATKSVLP----- 354

Query: 362 QVHKLPTRGTMQPPTSLP 379
                 +  TM PPT LP
Sbjct: 355 ----ATSSTTMPPPTILP 368

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  401 bits (1031), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 204/360 (56%), Positives = 247/360 (68%), Gaps = 17/360 (4%)

Query: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIH--GQPIVHE- 58
           +S  R+D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  +I     P  H  
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 59  PSGIXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQD 118
            S I                 DETPP  GPRRYGNLACR+WH KLD  L + LQ++LP +
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 119 YHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDT 178
           YH+ +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALDMLG++     G DV LLF+ 
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNK 179

Query: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVLV 237
           YY ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PR++ +K LV
Sbjct: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLV 239

Query: 238 QDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKF 297
           ++Y DTN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVLKKF
Sbjct: 240 REYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKF 299

Query: 298 PVVQHFWFGPGFYPWISDRNGQKLPIY----------ENAESEKKQPPSMTTMAPSNTTM 347
           PVVQHFWFG GF+PW++ +NG  LP++           NA S  ++  S  T  P++T+M
Sbjct: 300 PVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTS--TRFPTSTSM 357

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 244/351 (69%), Gaps = 12/351 (3%)

Query: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEP-- 59
           + +P ++    +F  PVK I+DSQG S FQ SVAI RLKY + KY +++    I  E   
Sbjct: 3   MKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYV 62

Query: 60  SGIXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDY 119
           S I                 DETPP  GPRR+GNL+CR+WH K+D NL  LL ++L  D 
Sbjct: 63  SEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDK 122

Query: 120 H----KC---IPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDV 172
                KC   + ELSYYLGNSFGSSTRLDYGTGHELSF+AV+  +DMLGLWT    G D+
Sbjct: 123 QNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL 182

Query: 173 LLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVK 232
           L++F+ YYKL++KLILTYTLEPAGSHGVWGLDDHFH  YILGS+QWS     P+ P D+ 
Sbjct: 183 LIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIV 242

Query: 233 NKVLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVE 292
           NK LV +YA+TN+YC AI FI  VKSGPFSEHS MLYDI+ +V  WSKV+SGLLKMY VE
Sbjct: 243 NKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVE 302

Query: 293 VLKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPS 343
           VL KFPVVQHFWFG G +PWI +   + LP+YEN   + K+  S+ T +PS
Sbjct: 303 VLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYEN---DAKKTTSIHTKSPS 350

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 230/325 (70%), Gaps = 11/325 (3%)

Query: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHG------QPIVHEPS 60
           +D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  ++        Q +    S
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVA---S 62

Query: 61  GIXXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYH 120
            I                 DETPP  GPRRYGNLACR+WH KLD  L + L+++LP +YH
Sbjct: 63  SIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYH 122

Query: 121 KCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYY 180
             +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALD+LG++     G DV LLF+ YY
Sbjct: 123 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNKYY 181

Query: 181 KLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVLVQD 239
            ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PR++ +K LV++
Sbjct: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241

Query: 240 YADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPV 299
           Y +TN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVLKKFPV
Sbjct: 242 YKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301

Query: 300 VQHFWFGPGFYPWISDRNGQKLPIY 324
           VQHFWFG GF+PW++ +NG  LP++
Sbjct: 302 VQHFWFGTGFFPWVNIQNGTNLPVF 326

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  387 bits (994), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 182/326 (55%), Positives = 235/326 (72%), Gaps = 8/326 (2%)

Query: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEP----SGI 62
           +D+  T F  PVK IFDSQ   DFQ S+A+ RL++ L++Y  ++    I   P    S I
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 63  XXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQ-DYHK 121
                             +TPP  GPRRYGNLACRDWH K++  L +LL++ +P  D   
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181
            I EL+YY+ NSFGSSTRLDYGTGHELSF+A + ALDMLGL+  + +GKD+L++F+ YY 
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192

Query: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241
           LVR+LILTYTLEPAGSHGVWGLDDHFH+ YILGSSQW ++   P+TP+++ N  LV+DY+
Sbjct: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN--APLTPKEITNSRLVKDYS 250

Query: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301
             NLYCQ I+F+  VKSGPF+EHS +LYDI+++V  W KVQ GL+KMY  EVL KFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 302 HFWFGPGFYPWISDRNGQKLPIYENA 327
           HFWFG GFYPWI+ +  ++LP+YE++
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHS 336

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  382 bits (980), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/376 (51%), Positives = 244/376 (64%), Gaps = 19/376 (5%)

Query: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQ--PIVHEPSGIXX 64
           I+I +  F  P+K I+DSQ    FQ S+AI RLKY+L KY  M+H    P +   S I  
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITI 66

Query: 65  XXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK--- 121
                          D  PPF GPRRYGNLACR+WH  +D+ +  LL++VL    H    
Sbjct: 67  VNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEK 126

Query: 122 --------CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVL 173
                   CI EL+YYL NS GS+TRLDYGTGHELSFLAV+ A+DMLGLWT  F G D+L
Sbjct: 127 GEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLL 186

Query: 174 LLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKN 233
            +F  YY+LV+KLI+TYTLEPAGSHGVWGLDDHFH+ YILGSSQ S +P  P +P D+ N
Sbjct: 187 HMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIIN 246

Query: 234 KVLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEV 293
           K +V +Y   N YC  IDFI+ VKSGPFSEHS +LYDI++TV +W KV SGL+KMY VEV
Sbjct: 247 KKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEV 306

Query: 294 LKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQ--PPSMTTMAPSNTTMYHLT 351
           L KFPVVQHFWFG GFYPW + +  + L +Y N  +++      S ++  P+N      +
Sbjct: 307 LNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAMNKDRS 366

Query: 352 TRPIPHGKLSQVHKLP 367
               P    SQ++++P
Sbjct: 367 VNQNP----SQLNRIP 378

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  365 bits (936), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 229/327 (70%), Gaps = 4/327 (1%)

Query: 9   ISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXXXX 68
           +  T+F  PVK IFD+ G  DFQ+S+ + RL+ HLE+Y +++ GQ I  + S        
Sbjct: 5   VEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIP-KSSQNRAVVRF 63

Query: 69  XXXXXXXXXXXDETPPFSG-PRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELS 127
                      DETPP +G  RR+G+LACRDWHD++   L  LL+ +LP+   +   EL 
Sbjct: 64  VCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELR 123

Query: 128 YYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSE-FSGKDVLLLFDTYYKLVRKL 186
           YYLG++FGS  RLDYGTGHEL+FLAV+ ALDMLGLWT + F+G+D+L ++  YY LV +L
Sbjct: 124 YYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRL 183

Query: 187 ILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLY 246
           ILTY LEPAGSHGVWGLDDH H+ YILG+SQW+ D  VPM P D+ +   V  Y++TNLY
Sbjct: 184 ILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLY 243

Query: 247 CQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           C +I F+  VK+G F++HS ML+DIA TV TWSKV +GL+KMY VEVL KFPVVQHFWFG
Sbjct: 244 CNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303

Query: 307 PGFYPWISDRNGQKLPIYENAESEKKQ 333
            GF+PW+   +G  LP YE A SE  +
Sbjct: 304 TGFFPWVDMAHGMSLPNYE-APSETSE 329

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  364 bits (935), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 241/380 (63%), Gaps = 18/380 (4%)

Query: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXX 66
           +++ +TKF +PVK IFDS G  DFQ+S+ + RL+ HLE+Y  ++H Q +    +      
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 67  XXXXXXXXXXXXXDETPPFSG-PRRYGNLACRDWHDKLDANLTELLQQVLPQD----YHK 121
                        DETPP +  PRR+GN+ACRDWH K+   +  L ++ LP +    Y  
Sbjct: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122

Query: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLW-TSE----FSGKDVLLLF 176
           CI EL YYLGN+FGS  RLDYGTGHELSFLAV+ A+DMLGLW TSE     +G D+L L+
Sbjct: 123 CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182

Query: 177 DTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWS-SDPAVPMTPRDVKNKV 235
           + YY +V KLILTYTLEPAGSHGVWGLDDH H+ YI+G+SQWS  D   P+   D+ +  
Sbjct: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242

Query: 236 LVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLK 295
            +  Y DTNLYC +I F+  VKSGPFS+HS MLYDI+ TV TWSK  SGL+KMY VEVL 
Sbjct: 243 SLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302

Query: 296 KFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPI 355
           KFPVVQHFWFG GF+PW+  + G  LP YE       +  ++   A  ++T    T  P 
Sbjct: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDST----TAVPT 358

Query: 356 PHGKLSQVHKLPTRGTMQPP 375
             G      KL T   M PP
Sbjct: 359 ATGSSG---KLTTSAAMPPP 375

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/401 (46%), Positives = 242/401 (60%), Gaps = 40/401 (9%)

Query: 14  FESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXXXXXXXXX 73
           F  PVK I+DSQGA  FQ S AI RL+  + KY  ++  + +  +               
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVA-DLELSGVVGGVVKVLD 60

Query: 74  XXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDY---HKCIPELSYYL 130
                  ETPP  GPRRYGN+ACRDWH+K++  +  LL+ ++   +    +C+ EL YYL
Sbjct: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120

Query: 131 GNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLILTY 190
            NSFGS+TRLD+GTGHELSFLA + ALDMLG   + F G  VL +FD YY LV +LIL+Y
Sbjct: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVHRLILSY 177

Query: 191 TLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAI 250
           TLEPAGSHGVWGLDDHFH+ YILGSSQW +   + M P D+ + VLV+ Y+ TN++C+ +
Sbjct: 178 TLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTL 237

Query: 251 DFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGPGFY 310
           +F+F VKSG F EHS ML+DI+ +V+TW+KV+ GL KMY  EVL KFPV+QHFWFG GFY
Sbjct: 238 NFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFY 297

Query: 311 PWISDRNGQKLPIYENA----ESEKKQPPSMTTM-----------APSNTTMYHLTTRP- 354
           PW+  +NG+ LP YEN+    E+   +  +   M           +P N T       P 
Sbjct: 298 PWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQ 357

Query: 355 ----------IPHGKLSQVHKLPTR-------GTMQPPTSL 378
                      P  +L  V    TR       G M PPTS+
Sbjct: 358 DSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTSM 398

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  354 bits (908), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/390 (48%), Positives = 246/390 (63%), Gaps = 19/390 (4%)

Query: 4   EPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPI-VHEPSGI 62
           +P +D   +KF  P K IFDSQ    FQ SVA  RLKY   KY  ++ G P+ V     +
Sbjct: 7   QPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITM 66

Query: 63  XXXXXXXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQ----D 118
                            DETPP   PRR+GNL+CR WHDK+++ L   L+ ++      +
Sbjct: 67  TITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIE 126

Query: 119 YHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDT 178
                 EL+YYL NSFGS TRLDYGTGHELSFLA +  +DM+ +   + +  D LL++ +
Sbjct: 127 NENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM-LQDMTADDFLLIWQS 185

Query: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQ 238
           YY L RKLILTYTLEPAGSHGVWGLDDHFH+ YI GSSQ  SD +  + P+D+  K +V 
Sbjct: 186 YYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDIS-HLAPKDILKKDVVA 244

Query: 239 DYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFP 298
           ++ + NLYCQAI+FIF VK GPF+EHS +LYDI+  V++WSKV  GLLKMY  EVL KFP
Sbjct: 245 EHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFP 304

Query: 299 VVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHL-----TTR 353
           VVQHFWFG GF+PW  + +G+ LP++E++E E   P  MT M  S  TM        +  
Sbjct: 305 VVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKS 364

Query: 354 PI--PHGKLSQVHKLPTRGT----MQPPTS 377
           PI  P+ K+S +H+ P+       M+PP++
Sbjct: 365 PIMNPNYKMS-MHRPPSLSKNSREMKPPST 393

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  352 bits (904), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 216/338 (63%), Gaps = 21/338 (6%)

Query: 10  SQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQ--PIVHEPSGIXXXXX 67
           S   F +P K IFDSQG   F +S+A  R++Y + KY ++I  +  P     S       
Sbjct: 11  SNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISG 70

Query: 68  XXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK-----C 122
                       +ETPP  GPRRYGNL+CR WH ++D N+ EL ++ L     K      
Sbjct: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130

Query: 123 IPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKL 182
             EL YY   S GS TRLDYGTGHELSFLA +GALDML L T + SG D+L +F+ YY+L
Sbjct: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLT-DISGTDILFIFNEYYRL 189

Query: 183 VRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWS------SDPAV-------PMTPR 229
           +RKLIL YTLEPAGSHGVWGLDDHFH+IYI GSSQW       ++P++       P+ P 
Sbjct: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249

Query: 230 DVKNKVLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMY 289
           D+ NK L++ +  +N YCQ+I FI  VK+GPF EHS +L+DIA  V  W KV+SGLLKMY
Sbjct: 250 DILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMY 309

Query: 290 YVEVLKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENA 327
            VEVL KFPVVQHFWFG GFYPWI+     KLP YE A
Sbjct: 310 MVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELA 347

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 214/344 (62%), Gaps = 15/344 (4%)

Query: 8   DISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXXX 67
           D    KF  P K IFDSQG  DFQ SVA+ R++YHL+KY  +  GQ I            
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63

Query: 68  XXXXXXXXXXXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELS 127
                       DETPP     RYGNL+ RDW  K    L   L ++LP+ Y+  I ELS
Sbjct: 64  VVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELS 123

Query: 128 YYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLI 187
           YY+ N+FGS  R+DYGTGHELSFLAV+  LDML + T    G  +L  F++YY +++KLI
Sbjct: 124 YYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET--IKGPALLYCFNSYYDVIQKLI 181

Query: 188 LTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYC 247
           LTY LEPAGSHGVWGLDDHFH  YILG++Q   D    + P+D+ N  L++  + +NL+C
Sbjct: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLL-DVNTSLIPKDISNTRLMEQNSSSNLFC 240

Query: 248 QAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGP 307
           ++I FI  VKSGPFS HS +LY+I+ +V TW K+Q GL+KMY VEVL KFPVVQHFWFG 
Sbjct: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300

Query: 308 GFYPWISDRNGQKLPIYENAESE------------KKQPPSMTT 339
            F+PW S  N   LPIY+ AE+              K PP ++T
Sbjct: 301 AFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLST 344

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  328 bits (841), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/379 (48%), Positives = 231/379 (60%), Gaps = 26/379 (6%)

Query: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXX 66
           +D+    F  P K IFDSQ  + FQ+SVA+ R+++H+EKY RM+ G        GI    
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGD----TSGGISASV 71

Query: 67  XXXXXXXXXX-XXXDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPE 125
                         DETPP  GPRRYGNLACRDWHDK+D++L  L  QV          E
Sbjct: 72  ARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIE 131

Query: 126 LSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDML----GLWTSEFSGKDVLLLFDTYYK 181
             YYL NSFGS  RLDYGTGHELSFLA + ALDM+    G+   E S      L+D YY+
Sbjct: 132 AEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELS-----RLWDRYYR 186

Query: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVL-VQDY 240
           LVR+LI+ Y LEPAGSHGVWGLDDHFH+ Y+ G+SQ++++P V + PRDV + V+  +D 
Sbjct: 187 LVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNP-VGVQPRDVLSGVIPGRDD 245

Query: 241 ADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVV 300
           A  N   +AI F+  VK GPF E+S ML DI S V +W K+Q GL +MY  EVL KFPVV
Sbjct: 246 APANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVV 305

Query: 301 QHFWFGPGFYPWISDRNGQKLPIYE-NAESEKKQPPSMTTMAPSNTTMYHLTTRPIPHGK 359
           QHFWFG  F+PW S R+G  LP+YE +A++E++   S     P  TT+  L T       
Sbjct: 306 QHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDT------- 358

Query: 360 LSQVHKLPTRG-TMQPPTS 377
            S +  +P+R   M PP  
Sbjct: 359 -STMASVPSRRPAMGPPAG 376

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 133/219 (60%), Gaps = 5/219 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D L  +  EL+    P      + EL+ YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAVYLYESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWTSEFSGKDVLL-LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+  +  L +  ++  E    D++L +F  Y +++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILETKYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+ Q ++ P   + P+ + N+ +V+ + D  +Y   I FI  VKS      HS M
Sbjct: 199 LPFLFGAHQLATHPH--LRPKSIHNEEVVEMFMDKYIYFGCIAFINSVKSTASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           L DI S V+TW+KV  G++KMY  EVL K P++QHF+FG
Sbjct: 257 LDDI-SGVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFG 294

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  158 bits (399), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/218 (41%), Positives = 133/218 (61%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D++  +  + L+   P    + + +LS YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWT-SEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+ +L  L   G++  S  S   +L +F  Y K++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILETRYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+ Q +S     + P  + N  LV+ +A+  LY   IDFI  VKS      HS M
Sbjct: 199 LPFLFGAFQLTSHKH--LKPISIHNNELVEMFANRYLYFGCIDFINKVKSSASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+TWSKV  G++KMY  EVL K P++QHF+F
Sbjct: 257 LDDI-SGVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF 293

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  157 bits (397), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 131/222 (59%), Gaps = 5/222 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D L +    LL++  P      I +L  Y+  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYVYVDESWGNKQRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWTSEFSGKDVLL-LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+  +  L    ++  E    +++L +F  Y KL+R L L Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLELQYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKSGP-FSEHSSM 267
           + ++ G+ Q S+     + P  + N  L++ +AD  LY   I+FI  VK+      HS M
Sbjct: 199 LPFLFGAYQLSTHKH--LKPSSIHNDDLIEMFADKYLYFGCIEFINSVKTTTTLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGPGF 309
           L DI S V+ WSKV  G+ KMY  EV+KK P++QHF+F   F
Sbjct: 257 LDDI-SGVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFNDMF 297

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  157 bits (397), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 132/218 (60%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D +     +LL    P    + I +LS YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWTSEFSGKD-VLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+  L  L    ++  +   ++ VL+LF  Y K++R++   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVK-SGPFSEHSSM 267
           + ++ G+ Q +  P   + P+ + N+ LV+ +AD  LY   I FI  VK S     HS M
Sbjct: 199 LPFLFGAFQLA--PHKHLKPKSIHNEELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+ WSKV  G++KMY  EVL K P++QHF+F
Sbjct: 257 LDDI-SGVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYF 293

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  157 bits (397), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 91/218 (41%), Positives = 134/218 (61%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D++  N  +LL+   P    + + +LS YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQLSIYLDESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWT-SEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+ +L  L   G++  S+ S   +L +F  Y +++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILETKYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+ Q ++     + P  + N  LV+ +A   LY   I FI  VKS      HS M
Sbjct: 199 LPFLFGAFQLTTHKH--LKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+TWSKV  G++KMY VEVL K P++QHF+F
Sbjct: 257 LDDI-SGVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF 293

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/218 (41%), Positives = 132/218 (60%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D++  N  ++L+   P    + + +LS YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWT-SEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+ +L  L   G++  S  S   VL +F  Y K++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+ Q ++     + P  + N  LV+ +A   LY   I FI  VKS      HS M
Sbjct: 199 LPFLFGAFQLTTHKH--LKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+TWSKV  G++KMY  EVL K P++QHF+F
Sbjct: 257 LDDI-SGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF 293

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  153 bits (387), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 128/217 (58%), Gaps = 4/217 (1%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD+H ++ A    L+ QV P    +   EL+ YLGN++G   R+DYG+GHEL+
Sbjct: 87  RFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELN 146

Query: 150 FLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHI 209
           F+  L  L   G+ +       VL +F  Y  ++R L   Y LEPAGSHGVWGLDD+  +
Sbjct: 147 FVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFL 206

Query: 210 IYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVK-SGPFSEHSSML 268
            ++ G+ Q ++     + P+ + N  +V+ + +  LY   I FI  VK +     HS ML
Sbjct: 207 PFLFGAFQLATHKH--LKPKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPML 264

Query: 269 YDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
            DI S V++W+KV  G++KMY  EVL K P++QHF+F
Sbjct: 265 DDI-SGVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF 300

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  152 bits (385), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/219 (40%), Positives = 126/219 (57%), Gaps = 5/219 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  R ++D L     +L+ +   Q       EL  Y   S+G   R+DYG+GHEL+
Sbjct: 79  RFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAYFVESWGDRERIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWTSEFSGKDVLL-LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+  L  L   GL+      ++++L +F  Y +L+R L  TY LEPAGSHGVWGLDD+  
Sbjct: 139 FICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVLETTYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+SQ +  P   + P+ + N  LV  +A   LY   IDFI  VK+      HS M
Sbjct: 199 LPFLFGASQLA--PHKHLKPKSIHNNELVDMFASRYLYFGCIDFINRVKTTASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           L DI S  ++WSKV  G++KMY  EVL K P++QHF FG
Sbjct: 257 LDDI-SGAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFG 294

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 132/222 (59%), Gaps = 5/222 (2%)

Query: 86  SGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTG 145
           +GP R+G    RD +D +    + L+++       + + +LS Y   S+G  +R+DYG+G
Sbjct: 75  TGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNESWGDKSRIDYGSG 134

Query: 146 HELSFLAVLGALDMLGLWTSEFSGKD-VLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLD 204
           HEL+FL  L  L   G++      ++ VL++F  Y K +R +   Y LEPAGSHGVWGLD
Sbjct: 135 HELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIETVYWLEPAGSHGVWGLD 194

Query: 205 DHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSE 263
           D+  + ++ G+SQ S+     + P+ + N  +V+ +++  LY   IDFI  VK+      
Sbjct: 195 DYHFLPFLFGASQLSTHRH--LKPKSIHNPEVVEMFSEKYLYFGCIDFINSVKTTASLRW 252

Query: 264 HSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           HS ML DI S V+ W+KV  G++KMY  EVL K P++QHF+F
Sbjct: 253 HSPMLDDI-SGVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF 293

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 130/220 (59%), Gaps = 7/220 (3%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQ-DYHKCIPELSYYLGNSFGSSTRLDYGTGHEL 148
           R+G +  R ++D L +    L+Q+     D  +C  ELS Y   S+G  +R+DYG+GHEL
Sbjct: 79  RFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQC-EELSVYFAESWGDRSRIDYGSGHEL 137

Query: 149 SFLAVLGALDMLGLWTSEFSGKDVLL-LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHF 207
           +FL  L  L   G++      ++++L LF  Y  ++R L   Y LEPAGSHGVWGLDD+ 
Sbjct: 138 NFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTLETKYWLEPAGSHGVWGLDDYH 197

Query: 208 HIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSS 266
            + ++ G+ Q S+     + P+ + N  +V+ +    LY   IDFI  VK+      HS 
Sbjct: 198 FLPFLFGAFQLSTHKH--LKPKSIHNSEVVEMFGKRYLYFGCIDFINKVKTTASLRWHSP 255

Query: 267 MLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           ML DI S V+TW+KV  G++KMY  EVL K P++QHF+FG
Sbjct: 256 MLDDI-SGVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFG 294

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  152 bits (383), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 89/218 (40%), Positives = 131/218 (60%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D++  N  +LL+        + + +LS YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYLDESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWT-SEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+ +L  L   G++  S  S   +L +F  Y  ++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETKYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+ Q ++     + P  + N  LV+ ++D  LY   I FI  VKS      HS M
Sbjct: 199 LPFLFGAFQLTTHKH--LKPISIHNSELVEMFSDRYLYFGCIAFINKVKSSASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+TWSKV  G++KMY  EVL K P++QHF+F
Sbjct: 257 LDDI-SGVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF 293

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  150 bits (380), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/221 (40%), Positives = 127/221 (57%), Gaps = 10/221 (4%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D+L A    L+    PQ     + +L  YL  S+G   R+DYG+GHEL+
Sbjct: 83  RFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTYLEESWGDKRRIDYGSGHELN 142

Query: 150 FLAVLGALDMLGLWTSEFSGKD----VLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDD 205
           F+  L  L    ++  +  G D    VL  F  Y K++R L   Y LEPAGSHGVWGLDD
Sbjct: 143 FMCFLYGLTAYKVF--DLGGTDRANLVLKPFIEYLKIMRVLETEYWLEPAGSHGVWGLDD 200

Query: 206 HFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEH 264
           +  + ++ G+ Q S+     + P  + N+ +V+ +AD  LY   I FI  VK+      H
Sbjct: 201 YHFLPFLFGAFQLSTHKH--LKPLSIHNEEVVELFADKYLYFGCIHFINSVKTTATLRWH 258

Query: 265 SSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           S ML DI S V+ WSKV  G++KMY  EVL K P++QHF+F
Sbjct: 259 SPMLDDI-SGVKKWSKVAEGMVKMYQAEVLSKLPIMQHFYF 298

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 129/218 (59%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D+L+   + L++        + + +LS YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSIYLDESWGNKRRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWTSEFSGKD-VLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+  L  L   GL+  E    + VL++F  Y  ++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FICFLFGLYSYGLFDLEKDAINLVLVVFLKYLNIMRVLETKYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKSG-PFSEHSSM 267
           + ++ G+ Q    P   + P  + N+ LV+ + D  LY   I FI  VK+      HS M
Sbjct: 199 LPFLFGAFQLV--PHKHLKPMSIHNEELVELFKDKFLYFGCISFINSVKTTTSLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+ WSKV  G++KMY  EVL K P++QHF+F
Sbjct: 257 LDDI-SGVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYF 293

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  149 bits (377), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 130/220 (59%), Gaps = 7/220 (3%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G +  RD++D+L +    L+    P      + +L  YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYVYLDESWGNKQRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLW--TSEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHF 207
           FL +L  L    ++  + +F+   VL +F  Y +++R L   Y LEPAGSHGVWGLDD+ 
Sbjct: 139 FLCLLYGLHKYKIFDESKDFTNM-VLKIFIEYLRVMRILETKYWLEPAGSHGVWGLDDYH 197

Query: 208 HIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVK-SGPFSEHSS 266
            + ++ G+ Q ++     + P  + N+ LV+ + D  LY   + FI  VK S     HS 
Sbjct: 198 FLPFLFGAFQLATHKH--LKPLSIHNEELVEMFQDKYLYFSCVAFINSVKTSTSLRFHSP 255

Query: 267 MLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           ML DI S V+ WSKV  G++KMY  EVL K P++QHF+FG
Sbjct: 256 MLDDI-SGVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFG 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  149 bits (375), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 133/227 (58%), Gaps = 10/227 (4%)

Query: 86  SGPRRYGNLACRDWHDKLDANLTELLQQVLPQ----DYHKCIPELSYYLGNSFGSSTRLD 141
           +   R+G +  RD++D +  +  EL+ ++       D  K + ++  Y  NS+G  +R+D
Sbjct: 74  ANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGK-LDDICTYFINSWGDRSRID 132

Query: 142 YGTGHELSFLAVLGALDMLGLWTSEFSGKD-VLLLFDTYYKLVRKLILTYTLEPAGSHGV 200
           YG+GHEL+F+  L  L    ++  E    + VL+LF  Y  ++R L L Y LEPAGSHGV
Sbjct: 133 YGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHGV 192

Query: 201 WGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-G 259
           WGLDD+  + ++ G+ Q S+     + P+ + N  +V+ + D  LY   I FI  VK+  
Sbjct: 193 WGLDDYHFLPFLFGAFQLSTHKH--LKPKSIHNPEVVEMFQDRYLYFGCIAFINKVKTTA 250

Query: 260 PFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
               HS ML DI S V+ WSKV  G++KMY  EVL+K P++QHF+FG
Sbjct: 251 SLRWHSPMLDDI-SGVKRWSKVAEGMVKMYKAEVLQKLPIMQHFYFG 296

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  148 bits (373), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 129/218 (59%), Gaps = 5/218 (2%)

Query: 90  RYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELS 149
           R+G    R ++D+++    +L+ +  P   H+ + +L+ YL  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIYLDESWGNKQRIDYGSGHELN 138

Query: 150 FLAVLGALDMLGLWTSEFSGKD-VLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFH 208
           F+  L  L    +   +   ++ VL++F  Y  ++R L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLETKYWLEPAGSHGVWGLDDYHF 198

Query: 209 IIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSEHSSM 267
           + ++ G+ Q ++     + P  + N+ LV+ +A   LY   I FI  VK+      HS M
Sbjct: 199 LPFLFGAYQLATHKH--LKPLSIHNEELVEMFAKKYLYFGCIAFINSVKTTASLRWHSPM 256

Query: 268 LYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           L DI S V+ WSKV  G++KMY  EVL K P++QHF+F
Sbjct: 257 LDDI-SGVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYF 293

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  146 bits (369), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 128/230 (55%), Gaps = 6/230 (2%)

Query: 80  DETPPFSGP-RRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSST 138
           DE P  +    R+G    R ++  + +N   LL +         I +LS Y   S+G+  
Sbjct: 69  DEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLSIYFYESWGNEE 128

Query: 139 RLDYGTGHELSFLAVLGALDMLGLWTSEFSGKD-VLLLFDTYYKLVRKLILTYTLEPAGS 197
           R+DYG+GHEL+F+  L  L    ++  E    + V+L+F  Y K++R+L   Y LEPAGS
Sbjct: 129 RIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRLETLYWLEPAGS 188

Query: 198 HGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVK 257
           HGVWGLDD+  + ++ G+ Q S+     + P+ + N  +V  + D  LY   I FI  VK
Sbjct: 189 HGVWGLDDYHFLPFLFGAFQLSNHKH--LKPKSIHNDEIVDMFKDKYLYFGCIAFINSVK 246

Query: 258 S-GPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           +      HS ML DI S V+ WSKV  G++KMY  EVL K PV+QHF+F 
Sbjct: 247 TTASLRWHSPMLDDI-SGVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYFS 295

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  146 bits (368), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 146/276 (52%), Gaps = 32/276 (11%)

Query: 33  SVAIDRLKYHLEKYARMIHGQPIVHEPSGIXXXXXXXXXXXXXXXXXDETPPFSGPRRYG 92
           S +ID L   L+K  +++   P++ +                           +   R+G
Sbjct: 49  SSSIDELCSLLDKVNKVVSSHPVIQD---------------------------ANTSRFG 81

Query: 93  NLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLA 152
            +  RD++D L +  +E++  +  +     + EL+ Y   S+G+ TR+DYG+GHEL+F+ 
Sbjct: 82  KVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDELAAYFRKSWGNRTRIDYGSGHELNFIC 141

Query: 153 VLGALDMLGLWTSEFSGKDVLL-LFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIY 211
            L  L+    +  E    +V+L +F  Y  ++R L   Y LEPAGSHGVWGLDD+  + +
Sbjct: 142 FLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMRTLETKYWLEPAGSHGVWGLDDYHFLPF 201

Query: 212 ILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKSG-PFSEHSSMLYD 270
           + G+ Q ++     + P+ + NK  V+ +    LY   I FI  VK+      HS ML D
Sbjct: 202 LFGAFQLATHKH--LKPKSIHNKEFVEMFEKRYLYFGCIGFINSVKTSISLRWHSPMLDD 259

Query: 271 IASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306
           I S V+TWSKV  G++KMY  EVL K P++QHF+FG
Sbjct: 260 I-SGVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFG 294

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  145 bits (367), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 126/220 (57%), Gaps = 4/220 (1%)

Query: 87  GPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTGH 146
           G  R+G +  RD++D++     EL+  +  +   + + EL+ Y   S+G   R+DYG+GH
Sbjct: 76  GTSRFGKVEFRDFYDEVRETTKELISSLSSELTDEQVEELAVYFTESWGDRKRIDYGSGH 135

Query: 147 ELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDH 206
           EL+F+  L  L    + +       VL +F  Y  ++R L   Y LEPAGSHGVWGLDD+
Sbjct: 136 ELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDVMRLLETKYWLEPAGSHGVWGLDDY 195

Query: 207 FHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVK-SGPFSEHS 265
             + ++ G+ Q ++     + P+ + N  +V+ +    +Y + + FI  VK +     HS
Sbjct: 196 HFLPFLFGAFQLTTHKH--LKPKSIHNPEIVEVFEKRYMYFECVAFINKVKTTASLRWHS 253

Query: 266 SMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
            ML DI S V+TWSKV  G++KMY  EVL K P++QHF+F
Sbjct: 254 PMLDDI-SGVRTWSKVAEGMVKMYKAEVLGKLPIMQHFFF 292

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  143 bits (360), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 127/222 (57%), Gaps = 5/222 (2%)

Query: 86  SGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYLGNSFGSSTRLDYGTG 145
           S   R+G +  + ++D ++ N  +L++          I ELS YL  S+G+  R+DYG+G
Sbjct: 76  STKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELSIYLVESWGNRQRIDYGSG 135

Query: 146 HELSFLAVLGALDMLGLWTS-EFSGKDVLLLFDTYYKLVRKLILTYTLEPAGSHGVWGLD 204
           HEL+F+  L  L    ++   E S   VL +F  Y  ++R +   Y LEPAGSHGVWGLD
Sbjct: 136 HELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRIIETKYWLEPAGSHGVWGLD 195

Query: 205 DHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAIDFIFHVKS-GPFSE 263
           D+  + ++ G+ Q S      + P  + N+ +V+ + D  +Y   IDFI  +K+      
Sbjct: 196 DYHFLPFLFGAFQLSKHKH--LKPISIHNEEMVEMFKDKYMYFGCIDFINSIKTTATLRW 253

Query: 264 HSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWF 305
           HS ML DI S V+ WSKV  G++KMY  EVL K P++QHF+F
Sbjct: 254 HSPMLDDI-SGVKKWSKVSEGMIKMYSAEVLGKLPIMQHFYF 294

>SAKL0H20174g Chr8 (1764879..1769282) [4404 bp, 1467 aa] {ON} weakly
           similar to uniprot|P23201 Saccharomyces cerevisiae
           YLL021W SPA2 Component of the polarisome which functions
           in actin cytoskeletal organization during polarized
           growth acts as a scaffold for Mkk1p and Mpk1p cell wall
           integrity signaling components potential Cdc28p
           substrate
          Length = 1467

 Score = 32.0 bits (71), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 40/73 (54%)

Query: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQ 238
           YY + R+L+   T++ A +   +   D   ++YI   ++ +S+  VPMTP +  ++ ++ 
Sbjct: 660 YYAIYRQLLPKITVQSAIAEISFSACDLVSLVYIKNDAKSTSELTVPMTPVNPSSERVLN 719

Query: 239 DYADTNLYCQAID 251
            ++  + +  A+D
Sbjct: 720 IWSSNSNFESALD 732

>KLLA0C15785g Chr3 complement(1367880..1374743) [6864 bp, 2287 aa]
            {ON} similar to uniprot|P38111 Saccharomyces cerevisiae
            YBR136W MEC1 Central regulator of the Mec1p/Tel1p
            signaling network; required for mitotic growth, DNA
            repair and mitotic recombination, regulates
            phosphorylation of Rad53p, required for dmc1 arrest and
            meiotic recombination; similar to phosphatidylinositol
            (PI)3- kinases required for DNA damage induced checkpoint
            responses in G1, S/M, intra S, and G2/M in mitosis
          Length = 2287

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 3/59 (5%)

Query: 263  EHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGPGF---YPWISDRNG 318
            E   + Y + S  + W  + S     ++ + LKKFP V + WF   F     W + RNG
Sbjct: 2066 ESMKIKYSLKSLQEKWQSIPSDQKLAFHKDCLKKFPPVLYQWFLDNFPDPITWYNARNG 2124

>Suva_7.397 Chr7 (688325..689494) [1170 bp, 389 aa] {ON} YGR112W
           (REAL)
          Length = 389

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 309 FYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPHGKLSQVHKLP- 367
           F P+I D  G+KL I     SE+K       +AP +  ++HL+     H KL  + + P 
Sbjct: 161 FTPFIMDDTGEKLLIERGWISEEK-------VAPESRNLHHLSLPQGEHLKLVCLVRPPK 213

Query: 368 TRGTMQ 373
           TRG++Q
Sbjct: 214 TRGSLQ 219

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,111,817
Number of extensions: 1878241
Number of successful extensions: 4359
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4372
Number of HSP's successfully gapped: 46
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)