Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B006808.829ON38338318650.0
YMR272C (SCS7)8.829ON38438514710.0
Skud_13.4448.829ON38438514680.0
Smik_13.4858.829ON38438514620.0
SAKL0D01760g8.829ON38138013940.0
ZYRO0G13948g8.829ON38438213930.0
Suva_13.4608.829ON38438513910.0
KLLA0D01639g8.829ON38138013860.0
Kwal_27.103328.829ON37837913390.0
KLTH0C04114g8.829ON37837913290.0
NCAS0C004708.829ON42638413340.0
AAL183W8.829ON37737613100.0
NDAI0K004708.829ON38638712671e-174
KNAG0J003208.829ON37338012661e-174
Ecym_27128.829ON38138112481e-171
Kpol_541.98.829ON37438212251e-168
CAGL0F03399g8.829ON38038711981e-164
KAFR0B038508.829ON37737911791e-161
TBLA0D031808.829ON40037911741e-160
TPHA0C047108.829ON37738211101e-150
Kpol_1069.48.829ON2772567711e-101
TDEL0F012102.166ON1261001925e-17
Kpol_505.142.166ON123721783e-15
KLTH0D09284g2.166ON123731751e-14
NCAS0G025702.166ON121711713e-14
Skud_14.2212.166ON120731695e-14
ZYRO0B09812g2.166ON1831021745e-14
CAGL0L03828g2.166ON121721671e-13
NDAI0F027302.166ON121721624e-13
Kwal_26.84612.166ON123731616e-13
AFL223W2.166ON165721648e-13
Suva_14.2282.166ON120721591e-12
TBLA0B013102.166ON123721573e-12
SAKL0E10626g2.166ON123721563e-12
KNAG0I020402.166ON119721547e-12
Smik_14.2162.166ON120721538e-12
KLLA0F23672g2.166ON123721539e-12
KAFR0B045502.166ON126721512e-11
YNL111C (CYB5)2.166ON120721502e-11
TPHA0F017902.166ON182721533e-11
KLLA0B14795gna 1ON556911533e-10
KLLA0F27577gna 2ON172691401e-09
Kwal_47.18167na 2ON227561431e-09
TDEL0H02180na 2ON203571402e-09
Ecym_54202.166ON145701362e-09
KLTH0A04026gna 2ON233561403e-09
ZYRO0C18524gsingletonON554811443e-09
KLTH0C11858gsingletonON555951418e-09
Kwal_23.2823na 1ON5601051401e-08
Suva_13.1054.304ON591521401e-08
Skud_13.924.304ON591521391e-08
Kpol_1014.54.304ON596631382e-08
NDAI0D04700na 3ON625631373e-08
SAKL0F16610gsingletonON564891373e-08
SAKL0F08316gna 2ON178541294e-08
TPHA0B018204.304ON576571354e-08
Ecym_4346na 2ON209501305e-08
TDEL0D00190singletonON552851356e-08
ADL085Cna 2ON273531316e-08
KNAG0E038604.304ON604541331e-07
NCAS0A02770na 3ON609581321e-07
SAKL0G16852g4.304ON580491311e-07
KAFR0I005204.304ON586601311e-07
KLTH0C11770gsingletonON618491302e-07
NDAI0D047104.304ON616531302e-07
YML054C (CYB2)4.304ON591521284e-07
Smik_13.924.304ON591521284e-07
TDEL0D011404.304ON584491266e-07
ZYRO0B13728g4.304ON598521258e-07
KLLA0D02640g4.304ON589481259e-07
Kwal_14.807singletonON578591232e-06
KLTH0D06930g2.536ON204521182e-06
CAGL0K10736g4.304ON593521222e-06
NCAS0A027804.304ON602631213e-06
TBLA0I015302.536ON221531112e-05
CAGL0K03069g2.536ON194471074e-05
KAFR0A047406.106ON483571096e-05
Kwal_26.80462.536ON198811049e-05
TPHA0G035502.536ON218521041e-04
NDAI0I016206.106ON441661052e-04
ZYRO0B02090g2.536ON194511013e-04
ZYRO0D16654gna 2ON190551003e-04
CAGL0I00418g6.106ON490721017e-04
NDAI0H013702.536ON22456970.001
KNAG0F032506.106ON48970990.001
KLTH0G06358gna 4ON513106990.001
TBLA0C06220singletonON49446980.001
NCAS0D032506.106ON49774970.002
Kpol_348.122.536ON21754940.002
Ecym_30806.106ON47972950.003
NCAS0F008702.536ON18946920.003
KLTH0H06798g6.106ON48872930.006
Kwal_23.5693na 4ON51381930.007
AAR153C6.106ON47872920.008
KLLA0C05566g6.106ON47772910.011
SAKL0A07326g6.106ON48046910.012
Skud_7.2266.106ON50974910.012
Kpol_478.176.106ON48474900.015
TDEL0A031102.536ON20053870.017
TPHA0B027006.106ON48892890.018
Smik_7.2256.106ON51048890.019
YGL055W (OLE1)6.106ON51053890.019
KLLA0E18459g2.536ON14871840.023
SAKL0G10274gna 4ON522106880.027
Kwal_14.18456.106ON28872870.028
ZYRO0C05016g6.106ON48375870.033
SAKL0A09570g2.536ON21151830.052
AAL078Wna 4ON59246850.055
KLLA0C10692gna 4ON52091850.056
TDEL0G036506.106ON48346850.061
Suva_13.2502.536ON20148810.11
TDEL0E03250na 4ON53675830.11
YMR073C (IRC21)2.536ON20148800.15
Ecym_3180na 4ON62146810.18
ZYRO0G16742gna 4ON54346800.25
Skud_13.2292.536ON20148780.25
Ecym_72512.536ON19550770.28
Smik_13.2522.536ON20148750.53
Kpol_483.114.238ON254687760.88
KAFR0A018902.536ON16151711.5
Suva_7.2166.106ON47040712.5
KNAG0C057802.536ON18064693.3
ZYRO0D17050g1.155ON49752685.7
TPHA0I015808.599ON124651696.1
KAFR0E025005.481ON67099679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00680
         (383 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   723   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   571   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   570   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   567   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   541   0.0  
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   541   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   540   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   538   0.0  
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   520   0.0  
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   516   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      518   0.0  
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   509   0.0  
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   492   e-174
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   492   e-174
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   485   e-171
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   476   e-168
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   466   e-164
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   458   e-161
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   456   e-160
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   432   e-150
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   301   e-101
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    79   5e-17
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    73   3e-15
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    72   1e-14
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    70   3e-14
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    70   5e-14
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    72   5e-14
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    69   1e-13
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      67   4e-13
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    67   6e-13
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    68   8e-13
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    66   1e-12
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    65   3e-12
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    65   3e-12
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    64   7e-12
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    64   8e-12
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    64   9e-12
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    63   2e-11
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    62   2e-11
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    64   3e-11
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    64   3e-10
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    59   1e-09
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    60   1e-09
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                59   2e-09
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    57   2e-09
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    59   3e-09
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    60   3e-09
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    59   8e-09
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    59   1e-08
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    59   1e-08
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    58   1e-08
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    58   2e-08
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             57   3e-08
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    57   3e-08
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    54   4e-08
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    57   4e-08
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    55   5e-08
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 57   6e-08
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    55   6e-08
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    56   1e-07
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               55   1e-07
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    55   1e-07
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    55   1e-07
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    55   2e-07
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    55   2e-07
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    54   4e-07
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    54   4e-07
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    53   6e-07
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    53   8e-07
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    53   9e-07
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    52   2e-06
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    50   2e-06
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    52   2e-06
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     51   3e-06
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    47   2e-05
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    46   4e-05
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    47   6e-05
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    45   9e-05
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    45   1e-04
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    45   2e-04
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    44   3e-04
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    43   3e-04
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    44   7e-04
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      42   0.001
KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {O...    43   0.001
KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {...    43   0.001
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             42   0.001
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     42   0.002
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    41   0.002
Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar t...    41   0.003
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    40   0.003
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    40   0.006
Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL05...    40   0.007
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    40   0.008
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    40   0.011
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    40   0.012
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    40   0.012
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    39   0.015
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    38   0.017
TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.1...    39   0.018
Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W ...    39   0.019
YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(...    39   0.019
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    37   0.023
SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {...    39   0.027
Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W ...    38   0.028
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    38   0.033
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    37   0.052
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    37   0.055
KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {...    37   0.056
TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.1...    37   0.061
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    36   0.11 
TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {O...    37   0.11 
YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}  ...    35   0.15 
Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar t...    36   0.18 
ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weak...    35   0.25 
Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {O...    35   0.25 
Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to...    34   0.28 
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    33   0.53 
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    34   0.88 
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    32   1.5  
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    32   2.5  
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    31   3.3  
ZYRO0D17050g Chr4 complement(1409558..1411051) [1494 bp, 497 aa]...    31   5.7  
TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {...    31   6.1  
KAFR0E02500 Chr5 (511386..513398) [2013 bp, 670 aa] {ON} Anc_5.4...    30   9.0  

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/383 (92%), Positives = 355/383 (92%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI
Sbjct: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTT 120
           TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTT
Sbjct: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTT 120

Query: 121 FVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKG 180
           FVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKG
Sbjct: 121 FVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKG 180

Query: 181 SAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEY 240
           SAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEY
Sbjct: 181 SAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEY 240

Query: 241 GLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFG 300
           GLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFG
Sbjct: 241 GLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFG 300

Query: 301 LLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTS 360
           LLP                CYDLTHYFLHHSKLPSFMR            NYQLGFGVTS
Sbjct: 301 LLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTS 360

Query: 361 WFWDKVFGTYLSPTSPISQMKYD 383
           WFWDKVFGTYLSPTSPISQMKYD
Sbjct: 361 WFWDKVFGTYLSPTSPISQMKYD 383

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/385 (70%), Positives = 308/385 (80%), Gaps = 3/385 (0%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MS + SKTLELFS+K V EHN ANDCWVT  NRKIYDVT+FL EHPGG + ILDYAGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLAT--LDFDS 118
           TE++KDS +HEHS+SAYEILED  YL+GY+AT+ E   LLTN +HKVEV+L+    +FDS
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDE-YLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDS 119

Query: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178
           TTFVK+LP EEKLSIATDYS DYK+H FLDL +PLL Q++   F KDFYVDQIHRPRHYG
Sbjct: 120 TTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179

Query: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238
           KGSAPLFGNFLEPL+KT+W+V+P+ WLPVV+YH+GVA KNMN +F  F FC+G FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298
           EYGLHRFLFHFDDWLPESN+ F  HFLLHG HHYLPMDKYRLVMPPTLFVILC PFYKLV
Sbjct: 240 EYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 299 FGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGV 358
           F LLP                CYD  H+FLHHSKLP FMR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 359 TSWFWDKVFGTYLSPTSPISQMKYD 383
           TSWFWD+VFGTYL P +P+S+MKY+
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/385 (71%), Positives = 307/385 (79%), Gaps = 3/385 (0%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MS + SKTLELFSRK V EHN A DCWVT  NRKIYDVTKFL EHPGG + ILDYAGKD+
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLAT--LDFDS 118
           TE++KDS +HEHS+SAYEILED  YL+GY+AT+ E   LLTN SHKVEV+L+    +FDS
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDE-YLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDS 119

Query: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178
           TTFVK+LPTEEKLSIATDY  DYK+H FLDL +PLL Q++   F KDFYVDQIHRPRHYG
Sbjct: 120 TTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179

Query: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238
           KGSAPLFGNFLEPL+KT+W+V+P+ WLPVV+YH+GVA KNMN +F  F FC+G FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298
           EYGLHRFLFHFDDWLPESNV F  HFLLHG HHYLPMDKYRLVMPPTLFVILC PFYKLV
Sbjct: 240 EYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 299 FGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGV 358
           F LLP                CYD  H+FLHHSKLP FMR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 359 TSWFWDKVFGTYLSPTSPISQMKYD 383
           TSWFWD+VFGTYL P +P+S+MKY+
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/385 (70%), Positives = 306/385 (79%), Gaps = 3/385 (0%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MS + SKTLELFS+K V +HN A DCWVT  NRKIYDVTKFL EHPGG + ILDYAGKDI
Sbjct: 1   MSANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDI 60

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLAT--LDFDS 118
           TEV+KD+ +HEHS+SAYEILED  YL+GY+AT+ E   LLTN +HKVEV+L++   +FDS
Sbjct: 61  TEVMKDTDVHEHSDSAYEILEDE-YLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDS 119

Query: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178
           TTFVKDLP EEKLSIATDY  DYK+H FLDL +PLL Q++   F KDFYVDQIHRPRHYG
Sbjct: 120 TTFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYG 179

Query: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238
           KGSAPLFGNFLEPL+KT+W+V+P  WLPVV+YH+GVA KNMN +F  F FC+G FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298
           EYGLHRFLFHFDDWLPESN+ F  HFLLHG HHYLPMDKYRLVMPPTLFVILC PFYKLV
Sbjct: 240 EYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 299 FGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGV 358
           F LLP                CYD  H+FLHHSKLP FMR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 359 TSWFWDKVFGTYLSPTSPISQMKYD 383
           TSWFWD+VFGTYL P +P+S+MKY+
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/380 (68%), Positives = 299/380 (78%), Gaps = 2/380 (0%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64
           +SKTL L S+ Q+S+HN   DCWV++ NRK+Y+VT FL+EHPGG QYILD+AG+DITE++
Sbjct: 3   ESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIM 62

Query: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL-ATLDFDSTTFVK 123
           KD  +HEHSESAYEI+ D  YLVGY+A E EEK+LLTN  H VEVKL  +  FDSTTFVK
Sbjct: 63  KDKLVHEHSESAYEIMNDM-YLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTTFVK 121

Query: 124 DLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAP 183
           +LPTE+KLSIATDYS DYK+H FLDL KPLL QV+FG FTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 122 ELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAP 181

Query: 184 LFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLH 243
           LFGNFLEPLSKT WY IP+ WLPVV YH+ VA  NMN  F +F F LG FVWTLIEY LH
Sbjct: 182 LFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLH 241

Query: 244 RFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLP 303
           RFLFH D +LPE  + F LHFLLHGVHHYLPMD+YRLVMPPTLFV+LCTPFYKLVF LLP
Sbjct: 242 RFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLP 301

Query: 304 XXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFW 363
                           CYDLTHYFLHH+KLP +MR            NY+LGFGVTSWFW
Sbjct: 302 YYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFW 361

Query: 364 DKVFGTYLSPTSPISQMKYD 383
           DKVFGTYL   +P+S+MKY+
Sbjct: 362 DKVFGTYLGSDAPLSKMKYE 381

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 300/382 (78%), Gaps = 4/382 (1%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64
           +S TL+LFS++Q+S+HNN  DCWV+V  RKIY+VT+FLDEHPGG +YIL YAG+DITEVL
Sbjct: 4   KSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEVL 63

Query: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLA---TLDFDSTTF 121
           KD  +HEHSESAYEIL+D+ YLVGY+AT+ E  +LLTN  H+VEV L      DFDSTTF
Sbjct: 64  KDRDVHEHSESAYEILDDN-YLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTTF 122

Query: 122 VKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGS 181
           V +LP EEKL+IATDY RDYK+H FLDL + LLPQVMFG F+KDFY+DQ+HRPRHYGKGS
Sbjct: 123 VPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGS 182

Query: 182 APLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYG 241
           APLFGNFLEP+SKT W+ IP++W+PVV +H  V F NMN +F+ F FCLG FVWTLIEY 
Sbjct: 183 APLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYC 242

Query: 242 LHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGL 301
           LHRFLFH D+WLP++N   TLHFLLHGVHHYLPMD+YRLVMPPTL ++L  P YK VFGL
Sbjct: 243 LHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGL 302

Query: 302 LPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSW 361
           LP                CYDLTHYFLHH+KLPS+MR            NYQLGFGVTSW
Sbjct: 303 LPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTSW 362

Query: 362 FWDKVFGTYLSPTSPISQMKYD 383
           FWD VFGTYL P +P++ MKYD
Sbjct: 363 FWDNVFGTYLGPDAPLAHMKYD 384

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/385 (70%), Positives = 305/385 (79%), Gaps = 3/385 (0%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MS + SKTLELFS+K V EHN A DCWVT  NRKIYDVTKFL EHPGG + ILDYAGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDI 60

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLAT--LDFDS 118
           TEV+KDS +HEHSESAYEILED  YLVGY+AT+ E   LLTN +HKVEV+L+    +FDS
Sbjct: 61  TEVMKDSDVHEHSESAYEILEDE-YLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDS 119

Query: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178
           TTFVKDLPTEEKLSIATDY  DYK+H FLDL KPLL Q++   FT+DFYVDQIHRPRHYG
Sbjct: 120 TTFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYG 179

Query: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238
           KGSAPLFGNFLEPL+KT+W+V+P+ W+PVV+YH+GVA KNMNP+F  F F +G FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLI 239

Query: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298
           EY LHRFLFHFDDWLPESN+ F  HFLLHG HHYLPMD YRLVMPP+LFVILC PFYKLV
Sbjct: 240 EYSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLV 299

Query: 299 FGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGV 358
           F LLP                CYD  HYF+HHSKLP FMR            NYQLGFGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 359 TSWFWDKVFGTYLSPTSPISQMKYD 383
           TSWFWD VFGTYL P +P+S+MKY+
Sbjct: 360 TSWFWDDVFGTYLGPDAPLSKMKYE 384

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 297/380 (78%), Gaps = 2/380 (0%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64
            S+ L L+S+  + +HN+ NDCWV++  RKIY+VT+FLDEHPGG +YILDYAG DIT+V+
Sbjct: 3   SSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVM 62

Query: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL-ATLDFDSTTFVK 123
           KD   HEHSESAYEI+ D SYLVGY+ATE EEK+LLTN  H VEV L    +FDST FVK
Sbjct: 63  KDVLTHEHSESAYEIM-DESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFVK 121

Query: 124 DLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAP 183
           +LPTE+KLSIATDY  DYK+H FLDL KPLL QV+FGKFTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 122 ELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAP 181

Query: 184 LFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLH 243
           LFGNFLEPLSKT W+++P+VWLPVV YH+  A  NMN  F IF F +G FVWTLIEYGLH
Sbjct: 182 LFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLH 241

Query: 244 RFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLP 303
           RFLFH DD LPE    FTLHFLLHGVHHYLPMD++RLVMPPTLFV+LCTPFYKLVF LLP
Sbjct: 242 RFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLP 301

Query: 304 XXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFW 363
                           CYDLTHYFLHHS+LP +MR            NY+LGFGVTSWFW
Sbjct: 302 YYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFW 361

Query: 364 DKVFGTYLSPTSPISQMKYD 383
           DKVFGTYL   +P+S MKYD
Sbjct: 362 DKVFGTYLGENAPLSNMKYD 381

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/379 (64%), Positives = 296/379 (78%), Gaps = 2/379 (0%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64
           ++KTL L+S  QV EHN+A+DCWVT+ NRKIYDVTKFL++HPGG   I++YAGKDITEV+
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61

Query: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFVKD 124
           KD  +H HS  AYE+L D  Y VGY+AT  EE++LL NS HKVEVKL   ++DST FV +
Sbjct: 62  KDGPLHSHSFVAYEVL-DEEYHVGYLATAEEEQKLLGNSKHKVEVKLED-EYDSTVFVPE 119

Query: 125 LPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPL 184
           +P EEKLSI TDY+RDY RH FLDL +PLL Q++   FTK+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 185 FGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244
           FGNFLEPLSKTSWYVIP+VWLPVV YH+  A +NMN +F +F F +G FVWTLIEYG+HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPX 304
           FLFH D +LP + V +T+HFLLHGVHHYLPMD+YRLVMPPTLF++LCTPFYKLVF LLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 305 XXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 364
                          CYDLTHYFLHH+KLP  ++            NY+LGFGVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 365 KVFGTYLSPTSPISQMKYD 383
           KVFGTYL+  +P+SQMK+D
Sbjct: 360 KVFGTYLAENAPLSQMKFD 378

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/379 (64%), Positives = 294/379 (77%), Gaps = 2/379 (0%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64
           ++KTL L+S+ Q+ +HN  +DCWV++ +RKIY+VT FLDEHPGG + I +YAGKD+TE++
Sbjct: 2   ETKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIM 61

Query: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFVKD 124
           KD   HEHS  AYE+L D  Y VGY+AT  EEK+LL N  H VEVKL   D+DST FV +
Sbjct: 62  KDGPTHEHSYVAYEVL-DEEYHVGYLATPEEEKKLLGNPEHPVEVKLEE-DYDSTVFVPE 119

Query: 125 LPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPL 184
           +P EEKLSI TDY++DY RH FLDL +PLL Q++   F+K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 185 FGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244
           FGNFLEPLSKT+WYVIP+VW PVV+YH+  A +NMN +  +F FCLG FVWTLIEYGLHR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPX 304
           FLFH D +LP + V +T+HFLLHGVHHYLPMD+YRLVMPPTLFV+LCTPFYKLVF LLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 305 XXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 364
                          CYDLTHYFLHH+KLPS+MR            NY+LGFGVTSWFWD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 365 KVFGTYLSPTSPISQMKYD 383
           KVFGTYL   +P+SQMK+D
Sbjct: 360 KVFGTYLGDNAPLSQMKFD 378

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/384 (64%), Positives = 294/384 (76%), Gaps = 7/384 (1%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MS + SKTLELFS+ QV++HN   DCWVTV +RKIYDV+KFL +HP G + IL +AGKDI
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL--ATLDFDS 118
           TE+LKD  I + ++     L D  YL+GYMAT+ EE++LLTN  HKVEVKL  +T  FDS
Sbjct: 107 TELLKDEKIDQQTD-----LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDS 161

Query: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178
           TTFVKDLPTE+KLSIATDY +D K+H+FLDL KPLL Q++FG FTKDFY+DQIHRPRHYG
Sbjct: 162 TTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG 221

Query: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238
           + SAPLFGNFLEP +KT+WY++P+ WLPVV YH+ +AFKN+N +F I  FC+G +VWT I
Sbjct: 222 QESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFI 281

Query: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298
           EY +HRFLFHFD+ LPE N  + +HFLLHG HHYLPMDKYRLV+PP LF+ LC PFYKLV
Sbjct: 282 EYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLV 341

Query: 299 FGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGV 358
           F LLP                CYDL HYFLHHSKLP FMR            NYQLG+GV
Sbjct: 342 FALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGV 401

Query: 359 TSWFWDKVFGTYLSPTSPISQMKY 382
           TSW+WDK FGTYLSP SP+S+MKY
Sbjct: 402 TSWYWDKKFGTYLSPDSPLSKMKY 425

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  509 bits (1310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/376 (65%), Positives = 286/376 (76%), Gaps = 3/376 (0%)

Query: 6   SKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLK 65
           SKTL L+S+  + +H +   CWV+V NRKIYDV++FLDEHPGG QYILDYAGKDIT VLK
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62

Query: 66  DSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFVKDL 125
           D  IHEH+E+AYEIL D SYLVGY+ATE EE +LLTN  H +EV    LD  +TTFVK+L
Sbjct: 63  DKLIHEHTEAAYEIL-DESYLVGYLATEEEEIKLLTNEKHVMEVTPENLD--TTTFVKEL 119

Query: 126 PTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLF 185
           P EE LS+ATD+  DY +HHFLDL KPLL QV+ G FT+DFY+DQIHRPRHYGKGSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 186 GNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHRF 245
           GNFLEPLSKT W+V+PMVW PVVLY++  A +NM     +  F  G FVWTLIEY LHRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 246 LFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPXX 305
           LFHFDD +PESN+ FT+HFLLHGVHHYLPMDKYRLVMPP LFV+LC PFY+LVF + P  
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 306 XXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFWDK 365
                         CYD+THYFLHH KLP FMR            NY+LGFGVTSW+WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 366 VFGTYLSPTSPISQMK 381
           VFGTYL+  SP+S+ K
Sbjct: 360 VFGTYLASNSPVSRPK 375

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  492 bits (1267), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 239/387 (61%), Positives = 291/387 (75%), Gaps = 5/387 (1%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHP--GGPQYILDYAGK 58
           MS + SKTLELFS+ +V+ HN ++DCW+T  +RKIYDVTKFL+++P       +L++AGK
Sbjct: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60

Query: 59  DITEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL--ATLDF 116
           DIT+ LKD  I      ++ IL+   YL+GY+AT+ EEK LLTN  HKVEV+L  AT  F
Sbjct: 61  DITDELKDK-IDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGF 119

Query: 117 DSTTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRH 176
           DSTTFVKDLPTE+KLSIATD  +D ++H FLDL KPLL Q++FG FTKDFY+DQIHRPRH
Sbjct: 120 DSTTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRH 179

Query: 177 YGKGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWT 236
           YG  SAPLFGN LEPL+KTSWY++P+ WLPVV YH+ VA  NMNPIF I  F +G +VWT
Sbjct: 180 YGDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWT 239

Query: 237 LIEYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYK 296
           LIEY +HRFLFHFD+ LPE N+ + +HFLLHG HHYLPMDKYRLV+PPTLF+ LC PFYK
Sbjct: 240 LIEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYK 299

Query: 297 LVFGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGF 356
           +VF LLP                CYDL HYFLHHSK+P  +R            NYQLG+
Sbjct: 300 VVFKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGY 359

Query: 357 GVTSWFWDKVFGTYLSPTSPISQMKYD 383
           GVTSW+WDK+FGTYLSP SP+S+MKY+
Sbjct: 360 GVTSWYWDKIFGTYLSPDSPMSKMKYE 386

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  492 bits (1266), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/380 (63%), Positives = 282/380 (74%), Gaps = 11/380 (2%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64
            S+TLEL S+  V+ HN  ND WV V  RK+ D++ ++ E P   + +L  AGKDIT+  
Sbjct: 4   NSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD-- 61

Query: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLD-FDSTTFVK 123
                HE     +  L    +LVGY+AT+LEEKELL+N  HKVEVKL   + FDS+TFVK
Sbjct: 62  ---RSHE-----FPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVK 113

Query: 124 DLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAP 183
           DLPTE+KLSIATD  RDY++HHFLDL+KPL+PQV+FG FTKDFYVDQIHRPRHYGKGSAP
Sbjct: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173

Query: 184 LFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLH 243
           LFGNFLEP+SKT+WYV+P+VW PVVLY +G + K ++PIF +  F LG FVWTLIEY +H
Sbjct: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233

Query: 244 RFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLP 303
           RFLFHFDDWLPE+NV FT+HFLLHGVHHYLPMD YRLV+PP LFV+LCTPFYKLVF LLP
Sbjct: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293

Query: 304 XXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFW 363
                           CYDL HYFLHHSK+P FMR            NYQLGFGV++WFW
Sbjct: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353

Query: 364 DKVFGTYLSPTSPISQMKYD 383
           DKVF TYL   +PIS MKYD
Sbjct: 354 DKVFDTYLGKDAPISPMKYD 373

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  485 bits (1248), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/381 (60%), Positives = 287/381 (75%), Gaps = 1/381 (0%)

Query: 3   QDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITE 62
               KTL L+S+ +  +H   N CWV++  RKIY+V+KFLDE+P G QY+LD+AG+D+T+
Sbjct: 2   SSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQ 61

Query: 63  VLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFV 122
           +LKD    E ++ A+++L D+ YL+GY+AT  EE++LLTN++H VEVK A  +   + FV
Sbjct: 62  LLKDMQTDEPTDLAHQLLSDA-YLIGYLATSEEERKLLTNANHVVEVKPANGNRVDSGFV 120

Query: 123 KDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSA 182
           K LPTEEKL+IATD+  DY++HHFLDL KPL  QV+FG FTK+FY+DQ+HRPRHYGK SA
Sbjct: 121 KKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESA 180

Query: 183 PLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGL 242
           PLFGNFLEPLSKTSW+VIP+VW P V+Y++  A  N++    +F F +G FVWTLIEYGL
Sbjct: 181 PLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGL 240

Query: 243 HRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLL 302
           HRFLFHFDD +PESN+ FTLHFLLHG+HHYLPMDKYRLVMPP LF+ LC PFYKLVF +L
Sbjct: 241 HRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSIL 300

Query: 303 PXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWF 362
           P                 YD+THYFLHH KLP FMR            NY+LGFGVTSW+
Sbjct: 301 PYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWY 360

Query: 363 WDKVFGTYLSPTSPISQMKYD 383
           WDKVF TYLSPT+P+S+ KYD
Sbjct: 361 WDKVFNTYLSPTAPLSRAKYD 381

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  476 bits (1225), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/382 (59%), Positives = 276/382 (72%), Gaps = 9/382 (2%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           MS   SKTLELF++ +  EHN   DCWV+V  R IYDV+ +L ++      IL++AGKDI
Sbjct: 1   MSAKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDI 60

Query: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTT 120
           T++ K           ++ + D  YLVGY+ATE EE  LLTN  HKVEV L    +DST 
Sbjct: 61  TKLTK--------TREFKFISDE-YLVGYLATEEEEVRLLTNKDHKVEVNLQDGTYDSTV 111

Query: 121 FVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKG 180
           FVK+LP EEK ++ATD  +D++ HHFLDL KP+L QV+FG FT+DFY+DQ+HRPRHYGKG
Sbjct: 112 FVKELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKG 171

Query: 181 SAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEY 240
           SAPLFGNFLEP+S T W++IP++W PVV+YH+ VA  NMN IF  F FCLG FVWTLIEY
Sbjct: 172 SAPLFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEY 231

Query: 241 GLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFG 300
            LHRFLFH DDW+P+ N+ +TLHFLLHGVHHYLPMD+YRLV+PP LF++LCTP YKLVFG
Sbjct: 232 CLHRFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFG 291

Query: 301 LLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTS 360
           LLP                CYDLTHYF+HH KLP FMR            NYQLGFGV++
Sbjct: 292 LLPLYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSN 351

Query: 361 WFWDKVFGTYLSPTSPISQMKY 382
           +FWDKVFGTYL P SP S M+Y
Sbjct: 352 YFWDKVFGTYLGPDSPASIMRY 373

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  466 bits (1198), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 235/387 (60%), Positives = 277/387 (71%), Gaps = 13/387 (3%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYI---LDYAG 57
           ++ D SKTLELF +  +++HN+ +DCWV+   RKIYDV+K+L +HP     +   LD  G
Sbjct: 3   VAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALD--G 60

Query: 58  KDITEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL-ATLDF 116
           K  T+      I +   +  + + D  YLVGY+AT  EEK+LLTN SHKVEVKL A   F
Sbjct: 61  KHGTD------ISQMELTTLKFVTDD-YLVGYLATSDEEKKLLTNKSHKVEVKLNADNTF 113

Query: 117 DSTTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRH 176
           DSTTFVKDLPTE+KLSI TDY RDYK+H FLDL KPLL Q++FG FTKDFY+DQIHRPRH
Sbjct: 114 DSTTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRH 173

Query: 177 YGKGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWT 236
           YGKGSAPLFGNFLE  +KT+W+V+P VW PVVLY +  A  NMN    +F F LG FVWT
Sbjct: 174 YGKGSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWT 233

Query: 237 LIEYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYK 296
           LIEY LHRFLFHFD+WLPE ++ F +HFLLHG HHYLPMD YRLV+PP LFV+LC P YK
Sbjct: 234 LIEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYK 293

Query: 297 LVFGLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGF 356
           LVF  LP                CYDL HYFLHHSK+P FMR            NYQLGF
Sbjct: 294 LVFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGF 353

Query: 357 GVTSWFWDKVFGTYLSPTSPISQMKYD 383
           GVTSWFWDKVFGTYL P +P+S+MKY+
Sbjct: 354 GVTSWFWDKVFGTYLGPDAPLSKMKYE 380

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  458 bits (1179), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 227/379 (59%), Positives = 275/379 (72%), Gaps = 6/379 (1%)

Query: 6   SKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLK 65
           +KTLELFS+K+V+ H    DCWVT+ +RKIYDVTKFLDE+      +LDYAG DIT+ L 
Sbjct: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELV 63

Query: 66  DSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFVKDL 125
           +  + E     Y+ L++ +YLVGY+AT  EE++LLTN  HKVEV L   DFD  T V +L
Sbjct: 64  NGKLDE----KYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQ-DFDLATLVVEL 118

Query: 126 PTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLF 185
           P EEKL+IAT+Y RD+K+H FLDL KPLLPQ++ GKFT++FYVDQI+RPRHYG+ SAPLF
Sbjct: 119 PPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLF 178

Query: 186 GN-FLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244
           GN FLEP SKT+W+V+P  WLPVV +   VA KNMN    +F FC+G FVWTL+EY LHR
Sbjct: 179 GNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHR 238

Query: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPX 304
           FLFHFD++LPE+N+ F LHFLLHG HHYLPMD YRLV+PP LF+ILC P YK VF LLP 
Sbjct: 239 FLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPY 298

Query: 305 XXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 364
                           YD+ HY LHHSKLP FMR            NY+LG+G+TSWFWD
Sbjct: 299 YWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWD 358

Query: 365 KVFGTYLSPTSPISQMKYD 383
           KVFGTYLS  +P S MK+D
Sbjct: 359 KVFGTYLSKDAPASVMKFD 377

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  456 bits (1174), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 219/379 (57%), Positives = 270/379 (71%), Gaps = 3/379 (0%)

Query: 8   TLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDS 67
           T ELFS + V +HN   DCWV   NRKIYDV+++L ++P G   I+D+AGKDIT   K+ 
Sbjct: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81

Query: 68  TIHEHSESAYEILE-DSSYLVGYMATELEEKELLTNSSHKVEVKLATL--DFDSTTFVKD 124
             + H    Y+ +  +  YLVGY+A E E  +LL+N SHKVEVKL      +DSTTFVK+
Sbjct: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141

Query: 125 LPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPL 184
           LP+E+   IATDY +D+  HHFLDL+KPL+PQ+   KF + FY+DQIHRPRH+G  SAPL
Sbjct: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201

Query: 185 FGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244
           FGNFLEPL+KT+W+VIP+VWLPVV YH+ VAF NMN IF  F FC+G FVWTLIEY LHR
Sbjct: 202 FGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261

Query: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPX 304
           FLFH D+ +P+  + + LHF +HG HHYLPMD YRLVMPPTLF+ILCTPFYKLVF +LP 
Sbjct: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPL 321

Query: 305 XXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFWD 364
                          CYD  HY+LHHS++P FMR            NYQL FGV+++FWD
Sbjct: 322 YWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSNYFWD 381

Query: 365 KVFGTYLSPTSPISQMKYD 383
           KVFGTYL P SP+S MKY+
Sbjct: 382 KVFGTYLYPDSPLSPMKYE 400

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 210/382 (54%), Positives = 264/382 (69%), Gaps = 11/382 (2%)

Query: 2   SQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGP--QYILDYAGKD 59
             + SKTLELFS ++   HN  +DCWV+V +R IYDV+KF+ E+   P    +L  AGKD
Sbjct: 3   ESNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKD 62

Query: 60  ITEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDST 119
           I+++L+  +             D  YLVGY+A   EE  LLTN  HKVEV L    +DST
Sbjct: 63  ISDLLETKSFK---------FVDDKYLVGYLANSTEEARLLTNKDHKVEVNLKDGTYDST 113

Query: 120 TFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGK 179
            FVK+LP+EE  +I+TDY +D+  HHFLDL+KPLL Q++ G FT++FY+DQIHRPRHYGK
Sbjct: 114 VFVKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGK 173

Query: 180 GSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIE 239
           GSA LFGN+LEP+S T W++IP++W PVV+YH  V  ++M+P+  +FF+ LG FVWT IE
Sbjct: 174 GSAKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIE 233

Query: 240 YGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVF 299
           Y LHRFLFH DDW+P+ N  +T+HFLLHGVHHYLPMD+YRLV+PP LFV+LCTPFYK VF
Sbjct: 234 YCLHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVF 293

Query: 300 GLLPXXXXXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVT 359
            LLP                 YDLTHYF+HH KLP   R            NYQLGFGV+
Sbjct: 294 ALLPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVS 353

Query: 360 SWFWDKVFGTYLSPTSPISQMK 381
           ++FWD VFGTYL P SP S M+
Sbjct: 354 NYFWDLVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  301 bits (771), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 180/256 (70%), Gaps = 1/256 (0%)

Query: 127 TEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLFG 186
           TEEKL + TDY++D+  + FL L +PL  Q++   FT+DFY+DQ+H+PRHYG  SAP+FG
Sbjct: 19  TEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFG 78

Query: 187 NFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHRFL 246
           NFLEP +KT W+++P++W PVVLY+  V+ + ++ I  I  F +G FVWTLIEY +HR+L
Sbjct: 79  NFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYL 138

Query: 247 FHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPXXX 306
           FH DD +PE+ + F LHFLLHG+HHYLPMDKYRLVMPP LF ILC PFY L F + P   
Sbjct: 139 FHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYW 198

Query: 307 XXXXXXXXXXXXXCYDLTHYFLHHSKLPSFMRXXXXXXXXXXXXNYQLGFGVTSWFWDKV 366
                        CYD+THYFLHH K+PSFMR            N+QLGFGVTS FWD+V
Sbjct: 199 AHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRV 258

Query: 367 FGTYLSP-TSPISQMK 381
           FGTYL P T P ++ K
Sbjct: 259 FGTYLDPKTIPYARSK 274

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
           Anc_2.166 YNL111C
          Length = 126

 Score = 78.6 bits (192), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 11/100 (11%)

Query: 11  LFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIH 70
           ++S +Q++EHN+A D W+ V   K+YDVTKF+DEHPGG + ILD AG+D +E  +D    
Sbjct: 4   VYSYQQIAEHNSAEDIWIVVDG-KVYDVTKFMDEHPGGDEIILDLAGQDASEPFRDIG-- 60

Query: 71  EHSESAYEILEDSSYLVGYM-----ATELEEKELLTNSSH 105
            HSE A +IL  ++  VG +       E+E  E  +  +H
Sbjct: 61  -HSEEALKIL--NTLCVGRVDINSKPVEVETPETSSQGTH 97

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 73.2 bits (178), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          ++++ ++++EHN    CW+ +   K+YD TKFLDEHPGG + ILD AG+D TE  +D   
Sbjct: 3  KVYTYQEIAEHNTTESCWIVIDG-KVYDTTKFLDEHPGGDEIILDLAGQDATESFEDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A +IL+
Sbjct: 61 --HSDEALKILK 70

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 72.0 bits (175), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 4/73 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +L+S K+++EHN  ND W+ +   K+YD TKF+DEHPGG + +LD  G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTENDLWMIIDG-KVYDCTKFMDEHPGGEEVLLDLGGQDATGPFADIG- 60

Query: 70 HEHSESAYEILED 82
            HS+ A ++LED
Sbjct: 61 --HSDDAVKMLED 71

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +++S +Q++EHN  +D W+ +   K+YDV+KFLDEHPGG + I + AG+D TE   D   
Sbjct: 3  QVYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIG- 60

Query: 70 HEHSESAYEIL 80
            HS+ A +IL
Sbjct: 61 --HSDDALQIL 69

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 69.7 bits (169), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +++S ++V+EHN   +CW+ + + K+YDV++F DEHPGG + I+D  G+D TE   D   
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70 HEHSESAYEILED 82
            HS+ A  +L+D
Sbjct: 61 --HSDEALRLLKD 71

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 63/102 (61%), Gaps = 8/102 (7%)

Query: 10  ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
           ++++ +QV+EHN   D W+ V + K+YDVTKF+++HPGG + ILD AG+D TE   D   
Sbjct: 59  KVYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFNDIG- 116

Query: 70  HEHSESAYEILEDSSYLVGYM--ATELEEKELLTNSSHKVEV 109
             HSE A  +L+D  ++VG +  A+   + E + N +    V
Sbjct: 117 --HSEDAVNMLKD--FIVGSLDPASRPAKSEKVANVAQTSGV 154

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          ++++ KQVSEHN   DCW+ +    +YDV+KFLDEHPGG + I ++ G D T    D   
Sbjct: 3  KVYTYKQVSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A +IL+
Sbjct: 61 --HSDDALKILK 70

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 67.0 bits (162), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 50/72 (69%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          ++++ +++++HN+ +D W+ +   K+YDV+KFLDEHPGG + I + AG D TE  +D   
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVIEG-KVYDVSKFLDEHPGGEEIIFELAGTDATENFEDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A +IL+
Sbjct: 61 --HSDDALKILK 70

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 66.6 bits (161), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +L+S K+++EHN   D W+ +   K+YD TKF+DEHPGG + ++D  G+D T    D   
Sbjct: 3  KLYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 70 HEHSESAYEILED 82
            HS+ A ++L D
Sbjct: 61 --HSDDAVKMLAD 71

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 50/72 (69%), Gaps = 4/72 (5%)

Query: 10  ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
           +L++ ++++EHN+ ND W+ + N K+YD TKF +EHPGG + ++D AG+D TE   D   
Sbjct: 42  KLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIG- 99

Query: 70  HEHSESAYEILE 81
             HS+ A ++LE
Sbjct: 100 --HSDDAVKMLE 109

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 49/72 (68%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +++S ++V+EHN   +CW+ + + K+YDV++F DEHPGG + I+D  G+D T+   D   
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A ++L+
Sbjct: 61 --HSDEALKLLK 70

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +L+S ++++ HN     W+ + + K+YDVTKFLD HPGG + IL+ AG+D T+  +D   
Sbjct: 3  KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDATQDFEDIG- 60

Query: 70 HEHSESAYEILE 81
            HS  A E L+
Sbjct: 61 --HSNDALEFLD 70

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +LF+ ++++EHN   D W+ +   K+YD TKF+DEHPGG + ++D  G+D T    D   
Sbjct: 3  KLFTYQEIAEHNTEGDLWMIIDG-KVYDCTKFIDEHPGGEEVLVDLGGQDATGPFADIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A ++LE
Sbjct: 61 --HSDDAIKLLE 70

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 48/72 (66%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          ++++ + V++H+ + D W+ + NR +Y+VTKFLDEHPGG + +L+ AG D T    D   
Sbjct: 3  KIYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A +IL+
Sbjct: 61 --HSDDAMKILK 70

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 63.5 bits (153), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +++S ++V+EHN   + W+ + + K+YDV+KF DEHPGG + I+D  G+D TE   D   
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSKFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A  +L+
Sbjct: 61 --HSDEALRLLK 70

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 63.5 bits (153), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +L + K+VSEH   +D W+ +   K+YD TKF+DEHPGG + ++D  G+D T   +D   
Sbjct: 3  KLLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A ++LE
Sbjct: 61 --HSDDAIKLLE 70

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          ++++   V+EH   +DCW+ +   K+Y+V+KFLDEHPGG + I + AG D TE   D   
Sbjct: 3  QVYTYADVAEHVLPDDCWIAIDG-KVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A +IL+
Sbjct: 61 --HSDDALKILK 70

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 10 ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
          +++S ++V+EHN   + W+ + + K+YDV++F DEHPGG + I+D  G+D TE   D   
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIG- 60

Query: 70 HEHSESAYEILE 81
            HS+ A  +L+
Sbjct: 61 --HSDEALRLLK 70

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 10  ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
           ++++ ++++EHN     W+ +   K+Y+VTKFLDEHPGG + I D AG D TE  +D   
Sbjct: 61  KIYTYEEIAEHNTTESSWIVIEG-KVYNVTKFLDEHPGGDEIIFDLAGTDATENFEDIG- 118

Query: 70  HEHSESAYEILE 81
             HS+ A ++L+
Sbjct: 119 --HSDQALKVLK 128

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 9/91 (9%)

Query: 13  SRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEH 72
           S K+V  HN  +DCW+ + N ++YD+TKFL +HPGG   ++++AG+D TE         H
Sbjct: 82  SVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATERF----YQMH 136

Query: 73  SESAYEILEDS----SYLVGYMATELEEKEL 99
           S +  E +++       L G    EL E+E+
Sbjct: 137 SSATLEKMKEHLVYIGKLKGAFDKELSEEEI 167

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 11 LFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIH 70
          L +  +V+ H++ +DCW TV + K+YD+T FL +HPGG Q +L YAGKD T    D   H
Sbjct: 5  LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIG-H 62

Query: 71 EHSESAYEI 79
               AY++
Sbjct: 63 SMESLAYDL 71

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 1/56 (1%)

Query: 6  SKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDIT 61
          S  L   S  +V+ H +A+DCW+++ + K+YDV+ +L +HPGG Q +L  AGKD T
Sbjct: 28 SSQLPFISSDEVATHTDADDCWISI-HGKVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 5  QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDIT 61
          + + L      +V EHN A+DCW+ +  R +YDVT  L +HPGG Q +L YAG D T
Sbjct: 18 EDRNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDAT 73

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 12 FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHE 71
          F+ +++++HN+  D W+ + N K+YD +KF DEHPGG + +LD  G+D T    D     
Sbjct: 5  FTYQEIADHNSEQDLWLII-NGKVYDCSKFADEHPGGDEVLLDLGGQDATIPFLDIG--- 60

Query: 72 HSESAYEILE 81
          H++ A ++L+
Sbjct: 61 HTDDAVKLLD 70

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 11 LFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKD 66
          + SR++++ H +A DCW+ +    +YDV+++L +HPGG Q +L  AGKD T    D
Sbjct: 33 VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDD 87

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 5/81 (6%)

Query: 15  KQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSE 74
           K+V  HNN NDCW+ V N +IYDVT F+ +HPGG   +L+ AG+D T       +  HS+
Sbjct: 79  KEVMLHNNVNDCWI-VLNGEIYDVTSFIGKHPGGAARLLEVAGRDATAKF----LQVHSQ 133

Query: 75  SAYEILEDSSYLVGYMATELE 95
              + +++    +G +    E
Sbjct: 134 EVLDRMKNHLIYIGKLKGRFE 154

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 16  QVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITE----VLKDSTIHE 71
           +V +HN  +DCW+ V N ++YDVT FL  HPGG   I++ AG D T     +  DST+ +
Sbjct: 80  EVMQHNKPDDCWI-VLNGEVYDVTSFLQMHPGGAARIMEVAGNDATRKFYSIHSDSTLEK 138

Query: 72  HSESAYEILEDSSYLVGYMATELEEKELLTNSSHK 106
             E    I      L G  A  + E++L    S K
Sbjct: 139 MKEQLVYI----GKLKGKFAETISEEDLRIRESRK 169

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 8/105 (7%)

Query: 20  HNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEI 79
           HN  NDCW+ V N ++YDVT F+  HPGG Q IL+ AG D TE         HSE     
Sbjct: 89  HNKLNDCWI-VLNDEVYDVTSFIAAHPGGVQRILEVAGSDATEKF----YQIHSEDVLNK 143

Query: 80  LEDSSYLVGYMA---TELEEKELLTNSSHKVEVKLATLDFDSTTF 121
           +++    VG +    +++  +E L     ++++   ++ F+ST F
Sbjct: 144 MKEKLVYVGKLKGKFSKIVTEEELRIQDQRLKMPPLSMIFNSTDF 188

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 1/52 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
            S  +V++HN+A+DCWV + N  +YD+T+F+  HPGGP  I   AG+D+T +
Sbjct: 91  ISPAEVAKHNSADDCWVVI-NGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAI 141

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
            S  +V++HN A+DCWV + N  +YD+T+F+  HPGGP  I   AG+D+T +
Sbjct: 91  ISPAEVAKHNKADDCWVVI-NGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAI 141

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 43/63 (68%), Gaps = 1/63 (1%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           + Q   K+L++ + ++V +HN+ +DCWV + N  +YD+T F+ +HPGG   I+  AGKD+
Sbjct: 80  IEQLSKKSLKIITPQEVIKHNSKDDCWVVI-NDIVYDLTFFIKKHPGGQDVIVGNAGKDV 138

Query: 61  TEV 63
           + +
Sbjct: 139 SNI 141

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           M  D  K+    +  ++ +HN   DCWV ++N+ +YD+T F+  HPGGP  I   AGKD+
Sbjct: 94  MELDPVKSKTPITPNELMKHNTPEDCWVVINNQ-VYDLTTFIQVHPGGPNIIRSNAGKDV 152

Query: 61  TEV 63
           T +
Sbjct: 153 TAI 155

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 11/89 (12%)

Query: 16  QVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHE-HSE 74
           +V  HNN +DCW+ V N  +YD+T+F+  HPGG   +++ AG+D TE       H  HS+
Sbjct: 92  EVKLHNNIDDCWI-VLNGDVYDITEFIKIHPGGAARLMEVAGRDATE-----KFHMIHSD 145

Query: 75  SAYEILEDSSYLVGYM----ATELEEKEL 99
              E +++   LVG +    + E+ E+EL
Sbjct: 146 EVLEKMKEYITLVGKLEGEFSNEVSEEEL 174

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 9  LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITE 62
          + + S  +V +HN  +DCW+ +   K+Y++T FL +HPGG   IL Y G+D T+
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATK 53

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 7   KTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           K  ++ + ++V+ HN  +DCWV + N  +Y++T F+D HPGG   I+  +GKD+T++
Sbjct: 68  KNSKVITPEEVARHNKRDDCWVVI-NDSVYNLTDFIDSHPGGKNVIVANSGKDVTKL 123

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 12 FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDIT 61
           S  +V  H +A+DCW  + N K+YD+T  L  HPGG + +L YAG+D T
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 5/85 (5%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHE 71
            S  ++ +HN  +DCW+ + N ++YDVT FL  HPGG   +++ AG D TE         
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATEKF----YQI 129

Query: 72  HSESAYEILEDSSYLVGYMATELEE 96
           HS+S +E ++++   +G +   +++
Sbjct: 130 HSDSVFEKMKNNFIYIGKLKGSIDK 154

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDIT 61
           L   S ++VS+H + +DCW  +  R +YD+T  L+ HPGG + +L YAG+D T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLK 65
            S  +V++HN  +DCWV +    +Y++T+F+  HPGGP  I   AGKD+T + K
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 6   SKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           S T    S  +V++HN+ NDCW+ + N ++YD+T F+  HPGG   I   AGKD++ +
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAI 145

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 15  KQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           + V++HN+  DCWV +    +YD+T+F+  HPGGP  I + AGKD+T +
Sbjct: 84  QDVAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 4   DQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           +++ T  L   ++V++H   +DCWV + N  +YD+T F+  HPGGP  +   AGKD+T +
Sbjct: 75  NEAITTRLILPEEVAKHKTPDDCWVVI-NGYVYDITSFIMSHPGGPDVLETNAGKDVTAI 133

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 13  SRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDIT 61
           S  +V  HN  +DCWV +    +YDVT F+D+HPGG   I   AGKD++
Sbjct: 120 SATEVIRHNKEDDCWVVIDG-YVYDVTAFIDQHPGGSAVIRGNAGKDVS 167

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 11  LFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           L S  +V++H+   DCWV + + K+YD+T F+  HPGGP  I   AGKD+T +
Sbjct: 95  LISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTNI 146

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
            S  +V++HN  +DCWV + N  +YD+T+FL  HPGG   I   AGKD+T +
Sbjct: 91  ISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
            S  +V++HN  +DCWV + N  +YD+T+FL  HPGG   I   AGKD+T +
Sbjct: 91  ISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 15  KQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           K+V +HN  +DCWV +    +YD++ F+  HPGGP  I   AGKD++ +
Sbjct: 81  KEVEKHNAPDDCWVVIDGY-VYDLSDFIPSHPGGPAVIRANAGKDVSAI 128

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
            S  +V++HN+ +DCWV +    +YD+T+F   HPGGP  I   AGKD++ +
Sbjct: 84  ISPDEVAKHNSPDDCWVVIDGY-VYDLTEFAPVHPGGPTVIKSNAGKDVSAI 134

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 34/48 (70%), Gaps = 1/48 (2%)

Query: 16  QVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           +V++H++  DCWV +    +Y++T F+  HPGGP  I + AGKD+T++
Sbjct: 94  EVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
           Q    E    ++V++H+  +DCWV + N  +YD++ F+  HPGGP  I   AGKD++ +
Sbjct: 72  QVSAKESIRPQEVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 13  SRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILD-YAGKDITEV 63
           ++ Q+ +HN A DCW  V N+++Y V+ +LD HPGG + +L   AGKD T +
Sbjct: 130 TKAQLQKHNTAEDCWC-VLNQRVYCVSSYLDFHPGGAEILLRTAAGKDATAL 180

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEV 63
            S  +V +HN   DCWV +    +YD+T F+  HPGGP  I   AGKD+T +
Sbjct: 90  ISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 3   QDQSKTL--ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           Q++SK     +    +V+ HN   DCW+ + N  +YD+T F+  HPGG   I   AGKD+
Sbjct: 78  QNESKLAPKRVIDPSEVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDV 136

Query: 61  TEV 63
           T +
Sbjct: 137 TAI 139

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYA-GKDITEV 63
            ++K +SEH   +DCW  +  R +Y +++++D HPGG Q +++   GKD++ +
Sbjct: 144 INQKILSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNL 195

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 32/47 (68%), Gaps = 2/47 (4%)

Query: 16  QVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILD-YAGKDIT 61
           +++ HN A DCW TV N K+Y ++ +L  HPGG + ++D  +G+D T
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 24  NDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           N+  +T+    ++DVT F++EHPGG   I +  GKD T V     ++ HS +AY IL
Sbjct: 396 NERKLTIIGGVVHDVTDFINEHPGGEPLIKEALGKDATRVFSGG-VYSHSNAAYNIL 451

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYIL-DYAGKDITEVLKDSTIH 70
            ++ Q+++H    DCW  + N+K+Y ++ +LD HPGG   ++   AGKD T +       
Sbjct: 123 INKAQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN----K 177

Query: 71  EHSESAYEILEDSSYLVGYMA 91
            H    YE + ++S +  Y+A
Sbjct: 178 YHRWVNYEKVLETSLVGTYVA 198

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDY-AGKDITE 62
            S K V+EHN  +DCW  +   K+Y +T + + HPGG + + ++ +G D TE
Sbjct: 143 ISEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPGGDKILKNFCSGVDATE 193

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 17  VSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESA 76
           ++E N+ N+  + + +  I+DVT +  EHPGG + +    GKD T   +   ++ HS SA
Sbjct: 347 MNEVNSNNNRKLVIISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQGG-VYRHSNSA 405

Query: 77  YEILED 82
           + +L D
Sbjct: 406 HNVLAD 411

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 17  VSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDY-AGKDITEVLKD 66
           +  HN  +DCW  +   K+Y +T + D HPGG   +L Y AGKD T++  +
Sbjct: 124 LRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGVDILLRYCAGKDATKMFNE 173

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 7  KTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDIT 61
          + L   S  ++ +H    DCW+ +  R +Y+V   L  HPGG Q +L Y G+D T
Sbjct: 25 EDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L  +++++  E N  ND  V V    ++DV+ ++ EHPGG + + +  GKD T+      
Sbjct: 386 LPAWTKEEFLEKNRENDGLVIVGG-IVHDVSGYITEHPGGEKLLKNALGKDATKAFSGG- 443

Query: 69  IHEHSESAYEIL 80
           ++ HS +A+  L
Sbjct: 444 VYRHSNAAHNTL 455

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYIL-DYAGKDITEVLKD 66
           F+ K + +H + +DCW TV N K+Y +T +L  HPGG   +L + AGKD T +  +
Sbjct: 147 FNHKILQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCTRLFNE 201

>KNAG0F03250 Chr6 complement(607667..609136) [1470 bp, 489 aa] {ON}
           Anc_6.106 YGL055W
          Length = 489

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 19  EHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYE 78
           E N + +  + V    I+DVT F++EHPGG   + D  GKD T       ++ HS +A+ 
Sbjct: 398 ERNLSQNPNLVVIGGIIHDVTGFVEEHPGGAPLLNDALGKDATTAFTGG-VYRHSNAAHN 456

Query: 79  ILEDSSYLVG 88
           +L +    V 
Sbjct: 457 VLANMRVAVA 466

>KLTH0G06358g Chr7 complement(503325..504866) [1542 bp, 513 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 513

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 7/106 (6%)

Query: 10  ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
           E+F R    E        V +    ++DVT F+ +HPGG   +    GKD T+   +  +
Sbjct: 386 EVFVRMAKQEFQEHRRALVAIEG-VVHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAV 443

Query: 70  HEHSESAYEILEDSSYLV---GYMATE--LEEKELLTNSSHKVEVK 110
           + HS++A  +L      V   G+M  E  + EK +L +S+ K + K
Sbjct: 444 YLHSQAARNLLATMRIAVIGSGHMGIESTVWEKHILESSNWKNDTK 489

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           ++D+T ++D HPGG + I +  GKD T V  +  ++ HS +A  +L
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVF-NGGVYNHSNAANNVL 459

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++ +K+  E    N   V +S   I+D++ ++ EHPGG   I    GKD T   +   
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVISG-IIHDISNYIPEHPGGESLIKQALGKDATRAFQGG- 453

Query: 69  IHEHSESAYEILED 82
           ++ HS +A  +L +
Sbjct: 454 VYRHSTAAQNVLSE 467

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 11  LFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDY-AGKDITEV 63
           + ++K V++H + +DCW  +   K+Y ++ +   HPGG + +++  +G+D T+ 
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPGGDKILINQCSGRDCTKA 194

>Ecym_3080 Chr3 (149461..150900) [1440 bp, 479 aa] {ON} similar to
           Ashbya gossypii AAR153C
          Length = 479

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++ + +  +   AN   V +S   ++DVT ++ EHPGG   I    GKD T+   +  
Sbjct: 379 LPVWDKAEFMKETKANPGLVVISG-IVHDVTGYITEHPGGETLIRASLGKDATKAF-NGG 436

Query: 69  IHEHSESAYEIL 80
           ++ HS +A+ IL
Sbjct: 437 VYLHSNAAHNIL 448

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 17  VSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYIL-DYAGKDIT 61
           +  H +  DCW T+   K+Y V+ +L+ HPGGP  I  + AGKD T
Sbjct: 118 LQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDST 162

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++ ++Q  E+   N   V +S   ++DV+ ++ EHPGG   I    GKD T+   +  
Sbjct: 387 LPVWDKQQFMENIKTNPGLVIISG-IVHDVSNYITEHPGGETLIQAALGKDATKAF-NGG 444

Query: 69  IHEHSESAYEIL 80
           ++ HS +A+ +L
Sbjct: 445 VYLHSNAAHNVL 456

>Kwal_23.5693 s23 (1277807..1279348) [1542 bp, 513 aa] {ON} YGL055W
           (OLE1) - delta-9-fatty acid desaturase [contig 11] FULL
          Length = 513

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILEDSSYLV-GYMATE 93
           ++DVT F+ +HPGG   +    GKD T+   +  ++ HS++A  +L      V G     
Sbjct: 410 VHDVTPFIHDHPGGVALVETSIGKDATQAF-NGAVYSHSQAARNLLATMRIAVLGSSQMG 468

Query: 94  LE----EKELLTNSSHKVEVK 110
           LE    EK++L +++ K + K
Sbjct: 469 LEPTIWEKQMLESNNFKNDSK 489

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++ R +    +  N   V +S   ++DV+ ++ EHPGG   I    GKD T    +  
Sbjct: 378 LPVWDRSEFVRASRENSGLVVISG-IVHDVSGYITEHPGGETLIQAALGKDATRAF-NGG 435

Query: 69  IHEHSESAYEIL 80
           ++ HS +A+ IL
Sbjct: 436 VYMHSNAAHNIL 447

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++ + +  E   +N+  V +S   ++DV+ ++ EHPGG   I    GKD T+   +  
Sbjct: 379 LPVWDKDEFMEKLKSNNGLVVISG-IVHDVSGYITEHPGGETLIQASLGKDATKAF-NGG 436

Query: 69  IHEHSESAYEIL 80
           ++ HS +A+ IL
Sbjct: 437 VYLHSNAAHNIL 448

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           ++DV+ ++ EHPGG   I   AGKD T+   +  ++ HS +A+ +L
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVL 448

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L L+ ++     +  N   V +S   ++DV+ ++ EHPGG   I    GKD T+      
Sbjct: 408 LPLWDKQTFLAKSKENKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDATKAFSGG- 465

Query: 69  IHEHSESAYEILED 82
           ++ HS +A  +L D
Sbjct: 466 VYRHSNAAQNVLAD 479

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++S+ Q  E N  +D  + V +  +++V  ++++HPGG   I    GKD T    +  
Sbjct: 382 LPVWSKDQFLE-NLKSDPELVVISGVVHNVKNYINDHPGGKTLIKSALGKDATSAF-NGG 439

Query: 69  IHEHSESAYEILED 82
           ++ HS +A  +L D
Sbjct: 440 VYRHSNAAQNVLAD 453

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILD-YAGKDITEV 63
             R+ + +H   +DCW  +  R +Y +T + D HPGG   +    AGKD TE+
Sbjct: 125 IDRELLQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEM 176

>TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.106
           YGL055W
          Length = 488

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 5/92 (5%)

Query: 8   TLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDS 67
            L  + + Q  E +  N   + +S   ++DV  ++ EHPGG   I    GKD T    + 
Sbjct: 385 NLPKWDKAQFIEESKTNGNLIVISG-IVHDVKGYITEHPGGQLLIKSALGKDATSAF-NG 442

Query: 68  TIHEHSESAYEILEDSSYLVGYMATELEEKEL 99
            ++ HS +A  +L +    V     E EE  L
Sbjct: 443 GVYRHSNAATNVLANLRVAV---IVESEESAL 471

>Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W
           (REAL)
          Length = 510

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILED 82
           ++DV+ ++ EHPGG   I    GKD T+      ++ HS +A  +L D
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHSNAAQNVLAD 480

>YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(9)
           fatty acid desaturase, required for monounsaturated
           fatty acid synthesis and for normal distribution of
           mitochondria
          Length = 510

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILEDSSYLV 87
           ++DV+ ++ EHPGG   I    GKD T+      ++ HS +A  +L D    V
Sbjct: 434 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHSNAAQNVLADMRVAV 485

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 5/71 (7%)

Query: 22  NANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILE 81
           N ++ W  + NRK+Y +  +L  HPGG   +   AGKD+T +        H    YE L 
Sbjct: 80  NKDNFWCVI-NRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNKY----HRWVNYERLL 134

Query: 82  DSSYLVGYMAT 92
           ++ ++  Y+ +
Sbjct: 135 ETCFIGMYVGS 145

>SAKL0G10274g Chr7 complement(874738..876306) [1569 bp, 522 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 522

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 7/106 (6%)

Query: 10  ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTI 69
           E F++   SE+       V +    ++DVT F+ +HPGG   +    GKD T    +  +
Sbjct: 395 ENFAKLAQSEYRTNKRALVAIEG-IVHDVTPFIYDHPGGVTLVETSIGKDATAAF-NGAV 452

Query: 70  HEHSESAYEILEDSSYLV---GYMATE--LEEKELLTNSSHKVEVK 110
           + HS +A  +L      V   G M  +  + EK LL +++ K + K
Sbjct: 453 YSHSRAARNLLATMRIAVLRRGPMEVQQTVWEKHLLESNNFKSDSK 498

>Kwal_14.1845 s14 (491597..492463) [867 bp, 288 aa] {ON} YGL055W
           (OLE1) - 1:1 [contig 236] PARTIAL
          Length = 288

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 9   LELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDST 68
           L ++ ++Q  E+   N   V +S   ++DV+ ++ EHPGG   I     KD T+   +  
Sbjct: 187 LPVWDKQQFMENIKTNPGLVIISG-IVHDVSNYITEHPGGETLIKAALNKDATKAF-NGG 244

Query: 69  IHEHSESAYEIL 80
           ++ HS +A+ +L
Sbjct: 245 VYLHSNAAHNVL 256

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILEDSSYLVGYMATEL 94
           ++DV+ +L EHPGG   +    GKD T+   +  ++ HS +A+ +L      V     + 
Sbjct: 407 VHDVSGYLTEHPGGETLLKAALGKDATKAF-NGGVYRHSNAAHNVLATMRVAV----VKE 461

Query: 95  EEKELLTNSSHKVEV 109
            E++ +  ++ + EV
Sbjct: 462 GEQQAIRFAARRGEV 476

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILD-YAGKDIT 61
             + ++ +H   +DCW  +   K+Y ++ + D HPGG + +L+  AG+D T
Sbjct: 136 IDKDELIKHKTVDDCWCVLKG-KVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           I+DVT F+ +HPGG   ++   GKD T    +  ++ HS +A  +L
Sbjct: 496 IHDVTPFMHDHPGGMALVVASVGKDATPAF-NGAVYAHSTAARNLL 540

>KLLA0C10692g Chr3 complement(916718..918280) [1563 bp, 520 aa] {ON}
           weakly similar to uniprot|P21147 Saccharomyces
           cerevisiae YGL055W OLE1 Fatty acid desaturase required
           for monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 520

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 16/91 (17%)

Query: 30  VSNRKIY--------DVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILE 81
           + NRK Y        DVT F+ +HPGG   +    GKD T+   +  ++ HS +A  +L 
Sbjct: 404 IKNRKAYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAF-NGAVYRHSNAARNLLA 462

Query: 82  DSSYLV------GYMATELEEKELLTNSSHK 106
                V          T  EE   + N++H+
Sbjct: 463 TMRVAVITDQSSNIQRTTWEENS-IANATHR 492

>TDEL0G03650 Chr7 (673347..674798) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           ++DV+ ++ EHPGG   +    GKD T+   +  ++ HS +A+ +L
Sbjct: 407 VHDVSGYITEHPGGETLLQAALGKDATKAF-NGGVYRHSNAAHNVL 451

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKD 59
            +R+ V +H    D +  V N K+YD++ +L  HPGG + +L +   D
Sbjct: 125 INREIVKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSD 172

>TDEL0E03250 Chr5 complement(612008..613618) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 6   SKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLK 65
           S T + F+     ++ N     V +    ++DVT F+  HPGG   +    GKD T+   
Sbjct: 413 SMTPQQFTELAKQQYANNKRALVVIEG-IVHDVTPFIHSHPGGTALVKISIGKDATQAF- 470

Query: 66  DSTIHEHSESAYEIL 80
           +  ++ HS++A  +L
Sbjct: 471 NGAVYLHSQAARNLL 485

>YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}
           IRC21Putative protein of unknown function; may be
           involved in resistance to carboplatin and cisplatin;
           null mutant displays increase in spontaneous Rad52p
           foci; contains a lipid-binding domain and binds
           cardiolipin in a large-scale study
          Length = 201

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKD 59
            +RK V +H    D    V N K+YD++ +L  HPGG   ++ +   D
Sbjct: 125 INRKIVKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>Ecym_3180 Chr3 (344929..346794) [1866 bp, 621 aa] {ON} similar to
           Ashbya gossypii AAL078W
          Length = 621

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           ++DVT F+ +HPGG   ++   GKD T    +  ++ HS +A  +L
Sbjct: 524 VHDVTPFIHDHPGGVALVVCAIGKDATPAF-NGAVYAHSTAARNLL 568

>ZYRO0G16742g Chr7 (1373818..1375449) [1632 bp, 543 aa] {ON} weakly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 543

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEIL 80
           ++DVT F+ +HPGG   +    GKD T    +  ++ HS++A  +L
Sbjct: 448 VHDVTPFIHDHPGGTALVQLSVGKDATHAF-NGAVYFHSKAARNLL 492

>Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKD 59
            +++ V  H    D    V N K+YD++ +L  HPGG + +L   G +
Sbjct: 125 INKEIVKRHCKGEDELWCVINSKVYDISSYLKFHPGGTKILLKNCGSE 172

>Ecym_7251 Chr7 (530372..530959) [588 bp, 195 aa] {ON} similar to
           Saccharomyces cerevisiae YMR073C
          Length = 195

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 15  KQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYIL-DYAGKDITEV 63
           K V E    ND W  +  R +Y +T +LD HPGG Q ++ +  GKD T +
Sbjct: 124 KMVLESTKEND-WCVLKGR-VYCITDYLDFHPGGVQILVKNCRGKDATRL 171

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 12  FSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKD 59
            +R  V +H    D    V N K+YD++ +L  HPGG   +L +   D
Sbjct: 125 INRAIVKKHCKDEDELWCVINNKVYDISSYLKFHPGGTDILLRHRNSD 172

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 33.9 bits (76), Expect = 0.88,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 58   KDITEVLKD--STIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLD 115
            KD  + L D  ST+  +SE+    LE+   +V  + ++L+EKE         +V+   LD
Sbjct: 1999 KDEIQKLSDKISTLQNNSENTELTLEEKEKMVDELNSKLQEKE--------AQVETLELD 2050

Query: 116  FD--STTFVKDLPTEEKLSIATDYSRD 140
             +    T  K+L +  +L IA D  RD
Sbjct: 2051 LNKLKETLDKELESSSELQIAHDNLRD 2077

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 10  ELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60
           ++  R Q+S+     D W  V   K+Y ++++L+ HPGG + IL+   K++
Sbjct: 87  KILQRHQISKE----DFW-GVYKGKVYSLSRYLEYHPGGIEIILNNCKKNV 132

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 35  IYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSE 74
           ++DV+ ++ EHPGG   I    GKD T+      ++ HS 
Sbjct: 430 VHDVSGYISEHPGGETLIKTALGKDATKAFSGG-VYRHSN 468

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 25  DCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDSTIHEHSESAYEILEDSS 84
           D W  V   K+Y ++ +LD HPGG + I+D+A +D  ++      +    SA ++LE  +
Sbjct: 115 DFWA-VYKGKVYCLSYYLDFHPGGIEIIIDHATRDPPDIRGAFDRYHRWVSAEKLLE--T 171

Query: 85  YLVG 88
            LVG
Sbjct: 172 CLVG 175

>ZYRO0D17050g Chr4 complement(1409558..1411051) [1494 bp, 497 aa]
           {ON} similar to uniprot|P25621 Saccharomyces cerevisiae
           YCR028C FEN2 Plasma membrane H -pantothenate symporter
           confers sensitivity to the antifungal agent
           fenpropimorph
          Length = 497

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 241 GLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCT 292
           G+   L   DD L  +N CFT+ +++      LP +   LV+PP +++  CT
Sbjct: 63  GMQEALQLKDDDLNVTNTCFTVGYIIG----MLPNNLLLLVIPPRIWLSFCT 110

>TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1246

 Score = 31.2 bits (69), Expect = 6.1,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 9/51 (17%)

Query: 237 LIEYGLHRFLFHFDDWLPESNVCFTLHFLLHG---VHHYLPMDKYRLVMPP 284
           LIEYG H ++F    W P          +LHG   +  YL +D Y  +M P
Sbjct: 593 LIEYGAHVYVFDESGWTPLEQA------VLHGNLELADYLKLDGYDNIMKP 637

>KAFR0E02500 Chr5 (511386..513398) [2013 bp, 670 aa] {ON} Anc_5.481
           YOR144C
          Length = 670

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 55/99 (55%), Gaps = 5/99 (5%)

Query: 69  IHEHSESAYEILEDSSYLVGYMA-TELEEKELLTNSSHKVEVKLATLDFDSTTFVKDLPT 127
           I+E++E     L + S+LV  M+ +++  +    NS  K E+    +  +S   +K   T
Sbjct: 488 IYENNEVTS--LREYSHLVDIMSYSDIINETSSRNSLVKQEIDTTLMTSESIEVLKQT-T 544

Query: 128 EEKLSIATDYSRDYKRHHFLDLQKPLLP-QVMFGKFTKD 165
           +++L +  DY  DY+ +   D+Q+P+LP ++  G++ ++
Sbjct: 545 DDQLRLKKDYMIDYQYYLVDDVQRPILPFEINIGEYLQE 583

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,198,796
Number of extensions: 1904165
Number of successful extensions: 6548
Number of sequences better than 10.0: 148
Number of HSP's gapped: 6643
Number of HSP's successfully gapped: 149
Length of query: 383
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 272
Effective length of database: 40,753,473
Effective search space: 11084944656
Effective search space used: 11084944656
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)