Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B006608.831ON95995948950.0
NCAS0B011108.831ON993107713311e-167
SAKL0D01716g8.831ON94297912811e-160
KNAG0G033708.831ON1076111312701e-157
YML109W (ZDS2)8.831ON942102312211e-152
Smik_13.258.831ON94998612131e-150
Skud_13.328.831ON94899611971e-148
KAFR0A027708.831ON88484311551e-143
KLTH0C04048g8.831ON93599611361e-139
TPHA0I002008.831ON1049111011111e-134
Suva_13.358.831ON98292010511e-126
AAL185W8.831ON1018105110261e-122
Kwal_27.103188.831ON92510089921e-119
CAGL0F03421g8.831ON8179859481e-113
ZYRO0G13992g8.831ON12115729321e-108
Smik_13.4868.831ON9236737239e-81
Suva_13.4618.831ON9316836753e-74
Kpol_541.108.831ON10567406486e-70
NDAI0E003508.831ON11634975814e-61
Kpol_1069.28.831ON10014625768e-61
Skud_13.4458.831ON8982255144e-53
CAGL0J06688g8.831ON8283204957e-51
YMR273C (ZDS1)8.831ON9152154913e-50
Ecym_27108.831ON8961064692e-47
TBLA0B032008.831ON10861084444e-44
KAFR0B038608.831ON8431124371e-43
TBLA0D031908.831ON16821184357e-43
TPHA0C047208.831ON10722264104e-40
KLLA0D01683g8.831ON9442344051e-39
TPHA0O002401.517ON352108810.54
Skud_14.8singletonON7487682.3
TPHA0L005907.100ON55894743.9
Suva_15.2855.393ON641313735.8
CAGL0B02057g8.297ON26752708.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00660
         (959 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...  1890   0.0  
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   517   e-167
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   498   e-160
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   493   e-157
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   474   e-152
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   471   e-150
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   465   e-148
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   449   e-143
KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...   442   e-139
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   432   e-134
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   409   e-126
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   399   e-122
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   386   e-119
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   369   e-113
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   363   e-108
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   283   9e-81
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   264   3e-74
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   254   6e-70
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   228   4e-61
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   226   8e-61
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   202   4e-53
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   195   7e-51
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   193   3e-50
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   185   2e-47
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   175   4e-44
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   172   1e-43
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   172   7e-43
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   162   4e-40
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   160   1e-39
TPHA0O00240 Chr15 complement(32729..33787) [1059 bp, 352 aa] {ON...    36   0.54 
Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [2...    31   2.3  
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    33   3.9  
Suva_15.285 Chr15 complement(487395..489320) [1926 bp, 641 aa] {...    33   5.8  
CAGL0B02057g Chr2 complement(190333..191136) [804 bp, 267 aa] {O...    32   8.3  

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score = 1890 bits (4895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 924/959 (96%), Positives = 924/959 (96%)

Query: 1   METLDGRSDANLEEQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGS 60
           METLDGRSDANLEEQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGS
Sbjct: 1   METLDGRSDANLEEQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGS 60

Query: 61  IDLLMDPELEYRVNVNSPNTRKXXXXXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSF 120
           IDLLMDPELEYRVNVNSPNTRK            HDVAPCYDKGEDEGEASVSDGADDSF
Sbjct: 61  IDLLMDPELEYRVNVNSPNTRKSWSSNSSSSEEEHDVAPCYDKGEDEGEASVSDGADDSF 120

Query: 121 DTTGADYLQTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXX 180
           DTTGADYLQTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKL     
Sbjct: 121 DTTGADYLQTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLSSASD 180

Query: 181 XXXXXXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESN 240
                      ITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESN
Sbjct: 181 NGSEDGSNSSSITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESN 240

Query: 241 KENAKAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFER 300
           KENAKAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFER
Sbjct: 241 KENAKAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFER 300

Query: 301 SSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDY 360
           SSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDY
Sbjct: 301 SSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDY 360

Query: 361 DTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGS 420
           DTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGS
Sbjct: 361 DTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGS 420

Query: 421 TSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDI 480
           TSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDI
Sbjct: 421 TSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDI 480

Query: 481 YDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDM 540
           YDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDM
Sbjct: 481 YDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDM 540

Query: 541 EQASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEK 600
           EQASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEK
Sbjct: 541 EQASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEK 600

Query: 601 TSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNLTRQMF 660
           TSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGR       NLTRQMF
Sbjct: 601 TSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRSSSSDSSNLTRQMF 660

Query: 661 EKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEE 720
           EKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEE
Sbjct: 661 EKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEE 720

Query: 721 HLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVK 780
           HLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVK
Sbjct: 721 HLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVK 780

Query: 781 ELDGDDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFD 840
           ELDGDDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFD
Sbjct: 781 ELDGDDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFD 840

Query: 841 DVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRE 900
           DVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRE
Sbjct: 841 DVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRE 900

Query: 901 LRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFKTEHNSANGSICIPDM 959
           LRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFKTEHNSANGSICIPDM
Sbjct: 901 LRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFKTEHNSANGSICIPDM 959

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  517 bits (1331), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 414/1077 (38%), Positives = 551/1077 (51%), Gaps = 228/1077 (21%)

Query: 18  VRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNS 77
           +R+ +   ++QR+KRKSEVLIAAQS+DNEVQ+VK+LKR+SIGS+DLL+DPELE+RVN + 
Sbjct: 10  LRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNNDK 69

Query: 78  PNTRKXXXXXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTNHSSAN 137
            N                 +    D   DE   S+    DDS + T  +YL    H ++ 
Sbjct: 70  SNQSTPIGSYERSNENLEQINEPEDNENDESSVSI----DDSIELTQTEYL----HDASV 121

Query: 138 HQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXX------ 191
            Q+   V P  P     R+++G GSL+R G +I  RKL                      
Sbjct: 122 PQTNRTVTPEEPS---HRSMSGAGSLKRNGSSISKRKLPFISTGMSAAPTSHLSPSSTST 178

Query: 192 -----------------ITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDN 234
                            +TK LLWVPA QHP+VKPEN+LELVQDTL NI L+E   +  +
Sbjct: 179 SSSSSSSSNSASSSPDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQH 238

Query: 235 ------------DNDESNKENAKAYDRLP-------IDITRKRDSLVRRPSRLRKSYTEF 275
                       D  +SN    +  DR P       ++IT +  SLVRRPSRLR SYTEF
Sbjct: 239 ENEKSNNNKENIDISKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEF 298

Query: 276 EEYDETESLEGSVAVGKESRNSFE--------RSSIAPCSSGRSSRTVSLKDITEELNKI 327
           EE D + S E      +   +S E        R+ +    +  S R+VSLKDITEEL  I
Sbjct: 299 EEDDYSNSEESEAKTNESQLSSREEKPFLFNDRNGLNQLRNF-SQRSVSLKDITEELTNI 357

Query: 328 SNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNEF 387
           SN AGLT SDAITLARTLSMA SF+   VN            L    +QNE N+E  +EF
Sbjct: 358 SNKAGLTDSDAITLARTLSMASSFSDGNVN------------LGKSKLQNESNEE--SEF 403

Query: 388 ASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLDDEHHESETKRKLSSGLENVT-A 446
           ASNM MK+G+ IP RSSLRRSKFNTYR+RS+ S++S         T+ K S  L++ + A
Sbjct: 404 ASNMFMKNGLTIPERSSLRRSKFNTYRIRSTSSSTS---------TREKTSPLLQSSSFA 454

Query: 447 ESSASQQDIYHSPSIKGN-----GSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTES 501
              A   D+  SP    N      +  SSP SI+D   +YDHY+        E K+G ++
Sbjct: 455 RQEADTDDLQRSPVSFTNRDSYLATTTSSPGSISD---LYDHYQD-----NAESKQGNDN 506

Query: 502 DDSNKGNQLDF-ETSKEIASSKLSDLSQGNA--------KSSI-------EAQDMEQASS 545
           D  N+  Q D    S    SS LS+ S  ++        KS I       +  D +Q + 
Sbjct: 507 D--NEARQGDLSHASISQESSFLSNESSNDSILVKPLGSKSMIHENLDNGQDHDDDQPAY 564

Query: 546 TVVREM----------KGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHID 595
             V ++          K KR+GWSW         N+E++       +            D
Sbjct: 565 QKVSKLNPTIPDTSRSKHKRNGWSW----SGNRANSEEDATVLVNSQ------------D 608

Query: 596 EDFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNL 655
           ED     T  T +      SK+RH PI      ++ +D         K+ +       + 
Sbjct: 609 ED----QTGYTDQ-----KSKSRHRPIL-----ARSRD-------HLKINKEAELPKESH 647

Query: 656 TRQMFEKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAK----TSKTPVK 711
            R+  EK+   LFRRKG     D G  +     +  S   S    + +K    T++ P +
Sbjct: 648 KRETIEKRFVKLFRRKGH----DNGNKQQVLKKKSSSSTLSKFQKQISKKNQVTTEEPKE 703

Query: 712 LRSESR-VEEHLRNS-----------VSKDVVPD---------TAIVAGEVIPSKSKAED 750
           +  E +  EE L ++           +S  ++P          T I  G+   S    +D
Sbjct: 704 ITVEVQEPEEILEDTNQGTNRQDPLRLSTPIIPQPVHSIISDTTPIADGDHALSNKDTDD 763

Query: 751 -----LPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSMDQNAQTSIDISTE 805
                LP+LQPAVSVTSTK+ H+   S+ ++E+V+EL  DDSQD+S       S ++   
Sbjct: 764 EAIEALPSLQPAVSVTSTKNVHL---SASIVETVRELGEDDSQDIS---GGDLSTEVDNS 817

Query: 806 TLSMKE-------QTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSA 858
            L+ +        Q+ E  +D     +   H  +P RKLTF DVKR ++ NAP++FTDSA
Sbjct: 818 MLAERNVMNSSDLQSIENSSDDINTGNTIEHV-LPARKLTFADVKRPDRPNAPIQFTDSA 876

Query: 859 FGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLV 918
           FGFPLPMLTVSTVIMFDHRL INVERAIYRLSHLKLSD KRELRQQV+LSNFMYAYLNLV
Sbjct: 877 FGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLV 936

Query: 919 NHTLYMEQVAQE---------------NDLTTETSGGTA-FKTEHNSANGSICIPDM 959
           NHTLYMEQVAQ+               +D+   +S GT  + TE N+ANG+I IP++
Sbjct: 937 NHTLYMEQVAQQETMEDVAITGTDVIDSDIHESSSYGTGVYTTEQNNANGTILIPEI 993

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  498 bits (1281), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 385/979 (39%), Positives = 516/979 (52%), Gaps = 117/979 (11%)

Query: 29  REKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKXXXXXX 88
           +EKRKSEVLIAAQS+DNE+QNVK+LKR+SIGS+DLLMDPE+E+R+N +  ++        
Sbjct: 33  KEKRKSEVLIAAQSLDNELQNVKNLKRLSIGSMDLLMDPEMEFRINSSLSSSPTKSLSSE 92

Query: 89  XXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTN------HSSANHQSTP 142
                    A  YD      E        DS D T  +YL   +      ++  N   + 
Sbjct: 93  EEENDKEGYAEEYDDDYSYSE--------DSMDITKTEYLHDNSNDDYGEYNRGNRTGSV 144

Query: 143 NVK----PTSPQI----SVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITK 194
            V      T+ +I    S +R L+G GS+RRGGV     +L                +T+
Sbjct: 145 GVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSRLSGGKLNDPNDEEA---LTQ 201

Query: 195 QLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENA--------KA 246
            LLWVPA QHPSVKPEN+LELVQDTL N+QL+      +   DESNKEN           
Sbjct: 202 NLLWVPANQHPSVKPENYLELVQDTLQNLQLE------NGVRDESNKENTVKLIHGLNSN 255

Query: 247 YDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPC 306
             +LPI   + ++SLVRRPSRLRKSYTEFE+ +E                    +S +  
Sbjct: 256 VSQLPIQ--QGKNSLVRRPSRLRKSYTEFEDTEEYNL-------------PISGNSSSLP 300

Query: 307 SSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRN 366
           SS  + R+VSL++IT+EL K+SNNAGLT SDAITLARTLSMA +F      E  ++ K N
Sbjct: 301 SSVPTPRSVSLREITDELTKVSNNAGLTDSDAITLARTLSMASTFY-----EGSNSEKEN 355

Query: 367 GIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLDD 426
                    Q+   K +++EFASNML ++ + IPARSSLRRSKFNTYR+R+   +S+   
Sbjct: 356 ---------QSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSST--- 403

Query: 427 EHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQ 486
            +  +++  K+SS  EN   E   + ++    P +     I++SPS+IND QDIYDHY  
Sbjct: 404 -NEFAQSNLKVSSTEENPQPEIEVAVEETL--PRVLEE-HILNSPSTINDMQDIYDHYDT 459

Query: 487 PSVDWEKELKKGTESDDSNKGNQLDFE-----------TSKEIASSKLSDLSQGNAKSSI 535
            SV+     +    S     G+ L              T+  I  SK S +       SI
Sbjct: 460 SSVEESLPPQNSNYSSAQQDGDNLQDSPDSSDFSTDSSTANAILKSKQSIVQ--TKSDSI 517

Query: 536 EAQDMEQASSTVVREMK--GKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSH 593
           + + +   + +   ++K   K+ GWSW N    KE   E N+K + +     HR+ SD  
Sbjct: 518 QKEFLSPVTESTTADVKRQKKKGGWSWFNKKSKKEPE-EDNLKQSEQH---THRDSSDFF 573

Query: 594 IDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXX 653
                   ++       R NHS+NRH  + PA+        T       K+ +       
Sbjct: 574 NVLSPSNGTSKHNLPSNRINHSRNRHHSVVPASNDGSTSTATPTDMEMEKLPQKKQKLEK 633

Query: 654 NLTRQMFEKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLR 713
              +   +K ++   + K  +      T       ELK+K S  +LSK    S      +
Sbjct: 634 KFIKLFKKKHVSPDRKEKDNEISVRPETHSSKPVKELKNKASISSLSKICIGSN-----K 688

Query: 714 SESRVEEHLRNSVSKDVVPDTAIVAG---EVIPSKSKAEDLPALQPAVSVTSTKSAHVPL 770
            +  V+   ++ +   V P T  V     E   S    E+LP LQPAVSVTSTK +   +
Sbjct: 689 VDENVDLTAKDRLKPRVSPGTKDVTNFQNESFESDG-LEELPTLQPAVSVTSTKQSDGAI 747

Query: 771 ASSVVIESV-KELDGDDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSH 829
              +  ++V KE + +    V   Q          +    ++Q  + Q  +K PA  P++
Sbjct: 748 PGVLENKTVSKEYEQNQYNHV---QQTLDQQQQQQQKQQKQQQQQQQQQSLKPPA-SPTN 803

Query: 830 QP--VPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIY 887
            P  +PPRKL F+DVKR E  NAPMKFTDSAFGFPLP LTVSTVIMFDHRLPINVERAIY
Sbjct: 804 DPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVERAIY 863

Query: 888 RLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQEN------DLTTETSGGT 941
           RLSHLKLSDPKRELRQQV+LSNFMYAYLNLVNH+LY++QV +EN      D   E S GT
Sbjct: 864 RLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIVGDDSMNEYSVGT 923

Query: 942 -AFKTEHNSANGSICIPDM 959
            A     N  NG I IP++
Sbjct: 924 PATDPIQNDNNGIINIPEI 942

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  493 bits (1270), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 411/1113 (36%), Positives = 553/1113 (49%), Gaps = 235/1113 (21%)

Query: 25   TESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPN----- 79
            TE  R KRKSEVLIAAQS+D EVQNVK LKR+SIGS+DLL+DPELE+RVN ++P      
Sbjct: 20   TEMDRNKRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRVN-STPELDDTD 78

Query: 80   ----------TRKXXXXXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGAD--- 126
                       R+             D A    +G  E E S     D S DT+G D   
Sbjct: 79   ARQQEKIKQINRRSWSAGKSIEALSQDFAQL--RGTQENEPS----PDASMDTSGEDDAS 132

Query: 127  YLQTTNHSSANHQST--------PNVKP-----------------------TSPQISVK- 154
             ++ T+    +H+          P VK                        T  QI V+ 
Sbjct: 133  SMEVTHSEYLSHEPVFADLQGRNPLVKTISSSSSSSSSHRVTDTKDRIDDETHTQIPVRD 192

Query: 155  ----------RTLTGVGSLRRG--GVNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAA 202
                      R L+G G LRRG   V+   RKL                +   LLWVPA 
Sbjct: 193  VSSTSASANGRKLSGAGFLRRGSSAVSQTARKLSGTAD-----------LKSNLLWVPAN 241

Query: 203  QHPSVKPENFLELVQDTL-------------HNIQLDEKKETTDNDNDESNKENAKAYDR 249
            QHP+VKPEN+LELV DTL             H I       T  +  DES+KEN     R
Sbjct: 242  QHPNVKPENYLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAADSVDESDKENNNT--R 299

Query: 250  LPIDITR-KRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSS 308
            L +     K  SLVRRPSRLR+SY E +E +++ +    +   +E   S +     P  +
Sbjct: 300  LRVRYRNGKASSLVRRPSRLRRSYIETDEDEDSNTSNAKIDDIEEGGRSLDERK--PTRT 357

Query: 309  GRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGI 368
                ++VSL+DITEEL K+SN+ GLT  DA+TLARTL+M  ++  ++ +E  D  + +  
Sbjct: 358  NGDRKSVSLRDITEELTKMSNSVGLTDDDAVTLARTLNMTCTYTDTD-SEGLDNLRTDSK 416

Query: 369  -HLDADDVQNEYNKE------DDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGST 421
              L A++ +N           D+N+FASNM MK+G+ IP RSSLRRSKFNTYR+R++ + 
Sbjct: 417  EQLRAEESENPPGTTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTYRIRTTSAP 476

Query: 422  SSLDDEHHESETKRKLSSGL-----ENVTAESSASQQDIYHSPSIKGN-GSIMSSPSSIN 475
            + L ++   + ++    S +     E  + ES A+ Q    SP++  +   ++ SP SI+
Sbjct: 477  TPLVEKPKRNNSRHARLSFVHLDDEEFASHESPAALQ----SPTVNNDEAGVIESPGSIS 532

Query: 476  DFQDIYDHYR-------QPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQ 528
            D   +YDHY         P V  +KELK+    + S   N  DF T+    SS LS+ S 
Sbjct: 533  D---LYDHYTGTASEPGSPDVSEDKELKEDMSREYSTDDN--DFSTNTSHDSSFLSNESS 587

Query: 529  GNAK---------------SSIEAQDMEQASSTVVREMKGKRSG------WSWLNGMGSK 567
             ++                 ++E +D E  S+ V    K   +       WSWL   G+ 
Sbjct: 588  NDSVLYRPTNIKPMISENFDAVEQEDEETISTAVAEPTKNDNNNNTNSMPWSWLAKDGTD 647

Query: 568  ETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANE 627
              +   ++K    QE       +++H ++     + P    I R NHSKNRH+PIF  N 
Sbjct: 648  IDDQPMDLKGEIVQE-----GEANTHTNDFVSVNAAPSKHPIDRGNHSKNRHMPIFTLNS 702

Query: 628  SSKRKDTT--------EEPAVSTKMGRXXXXXXXNLTRQMFEKKIANLFRRK---GKKKL 676
            +S  +D T        +EP VS K             ++  E+K   LF+RK      K 
Sbjct: 703  ASTNQDDTPQMEQKEKKEPYVSKK------EPSAGPKKKTLEEKFVKLFKRKHHSANAKS 756

Query: 677  P-DYGTSRDHTGAELKSKRSSDNLSKF-AKTSKTPV------KLRSESRVEEHLRNSVSK 728
            P +    +     ELK K     +SKF +KT+K PV      +   E+R  E+ RNS  K
Sbjct: 757  PVNKNEHKLQHQDELKKK-----ISKFRSKTAKAPVSSTRNVQQTRETRSTEN-RNSAKK 810

Query: 729  --DVVPDTAIVAGEVIPSKS---------------KAEDLPALQPAVSVTSTKSAHVPLA 771
              DV  +  +   E    +S               + ++LP LQPAVSVTS K+      
Sbjct: 811  EQDVPKEGKLTTEEKYRDRSDETQTIGFSDGTVTLEKDELPGLQPAVSVTSAKNTR---D 867

Query: 772  SSVVIESVKELDGDDSQDVSMD--QNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSH 829
            +  V+E+V+ELDGDDSQD+S    Q     ID   +        ++  T     A     
Sbjct: 868  NGDVVETVRELDGDDSQDISGGDIQYQMQPIDEPVDGEVATVDDTQTVTAAAASALPAVI 927

Query: 830  QPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRL 889
              +PPRKLT+ DVKR E+ NAP++FTDSAFGFPLPMLTVSTVIMFDHRL INVERAIYRL
Sbjct: 928  STLPPRKLTYADVKRPEKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRL 987

Query: 890  SHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETS------GG--- 940
            SHLKLSD KRELRQQV+LSNFMYAYLNLVNHTLYMEQV+     +TET+      GG   
Sbjct: 988  SHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVS-----STETAPKDSVPGGNGV 1042

Query: 941  --------------TAFKTEHNSANGSICIPDM 959
                          +AF T  N ++G+I IPD+
Sbjct: 1043 QNGSCNNVDQMSSNSAFATNQNKSDGTILIPDI 1075

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  474 bits (1221), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 383/1023 (37%), Positives = 527/1023 (51%), Gaps = 160/1023 (15%)

Query: 1   METLDGRSDANLEEQNQVRQRTSMTESQR-EKRKSEVLIAAQSIDNEVQNVKSLKRISIG 59
           +E   G +D+N   Q +  ++T +++ +  EKRKS+VLIAA+S+D E+QNVK+LKR+SIG
Sbjct: 16  VENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIG 75

Query: 60  SIDLLMDPELEYRVNVNSPNTRKXXXXXXXXXXXXHDVAPCYDKGE---------DEGEA 110
           S+DL++DPELE++VN  +  +               ++     K E         +EG+A
Sbjct: 76  SMDLVIDPELEFKVNSRNSYSSDSSKESLQESLHEENIIRSEQKEEQGSEDNDAYEEGDA 135

Query: 111 SVSDGADDSFDTTGADYL---QTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGG 167
           +     DDS D T  +YL   +T         ++ +   ++   S  R L+GV +L    
Sbjct: 136 T---NVDDSIDITQTEYLHDEETLEKEKIIRNASSSTSSSARVTSRNRRLSGVKTLAHDV 192

Query: 168 VNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDE 227
           V                       +T+ LLWVPA QHP+VKPEN+LEL+QDTL NIQ+  
Sbjct: 193 V----------LDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI-- 240

Query: 228 KKETTDNDNDESNKENAKAYDRLPIDITRKR-DSLVRRPSRLRKSYTEFEE----YDETE 282
              +T+ D DE+  E    +    +   RKR  S+VRRPSRL+ SYT+F++     D+ +
Sbjct: 241 ---STNQDIDENKLELGNNH----VISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQ 293

Query: 283 SLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLA 342
             EG + V K              S  ++ R+VSLK+ITEEL KISNNAGLT SDA+TLA
Sbjct: 294 --EGEIQVDKR----------ISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLA 341

Query: 343 RTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPAR 402
           R+LSM+GSF     NE         +HL+ +  +N      DNEFASNM  + G+ IP R
Sbjct: 342 RSLSMSGSFT----NE--------SLHLNGNHTEN------DNEFASNMFNETGLTIPER 383

Query: 403 SSLRRSKFNTYRVRSSGSTSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIK 462
           SSLRRSKFNTY++R  GS+              KL+S +   T ++  S      SP+  
Sbjct: 384 SSLRRSKFNTYKIRLEGSSLP---------QAVKLNSLMNIQTNDNRRSAS----SPA-- 428

Query: 463 GNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSK 522
               +    +S+NDF +I+DHYR+ S DW  E +K  +S +     +     S    SS 
Sbjct: 429 SYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHASISQESSL 488

Query: 523 LSDLSQGNA-------KSSIEAQDMEQASSTVVREMKGK---RSGWSWLNGM-GSKETN- 570
           LS  S  N+         S+ ++ ++Q  S+  +          GWSWLN   GS   N 
Sbjct: 489 LSTDSSNNSVLIKPHNTGSMISEKLDQHVSSSEKSNTNNSEANHGWSWLNSSNGSLNANE 548

Query: 571 -TEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIF------ 623
            T + + D    E  +  E +D  ++    + +       +R NHSKNRH PIF      
Sbjct: 549 QTYQQLTDDEDDEECVDNEKAD-FVNLSVSRRAKSTKRASERINHSKNRHSPIFQIHSEE 607

Query: 624 -----------PANESSKRKDTTEEPAV-STKMGRXXXXXXXNLTRQMFEKKIANLFRRK 671
                       ++ES   K T   PAV   K+            +   EK++A LF+RK
Sbjct: 608 AKSVVITPSVVSSSESQPSKPTA--PAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRK 665

Query: 672 ---GKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEEHLRNSVSK 728
              G  K  D    +     ELK K S  +LSKF K+   P K   E+ VE   R S   
Sbjct: 666 QHNGTCK-SDVKVIKKSVKKELKKKASHSSLSKFRKS---PKKKPQEAEVE---RPSSPT 718

Query: 729 DVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQ 788
             +    I    VI  + ++ +   L P         +H   +S  V+E++ ELDGDDS 
Sbjct: 719 KTITTEDIDTASVIEPEVRSSNASTLLP--------DSHTSHSSEFVVETISELDGDDSF 770

Query: 789 DVS-----MDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVK 843
           D+S      D    +SI   T T  ++E     + D   P   P    +PPRKLTF+DV 
Sbjct: 771 DISGGDVNYDVEVHSSISRDT-TAGLEEDIGAEREDNTSPT-APQISTLPPRKLTFEDVV 828

Query: 844 RSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQ 903
           + + SNAP+KFTDSAFGFPLPM+T STVIMFDHRL INVERAIYRLSHLKLSDP RELRQ
Sbjct: 829 KPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQ 888

Query: 904 QVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFK-------TEHNSANGSICI 956
           QV+LSNFMY+YLNLVNHTLYMEQV          +G  AF         + N ++G+I I
Sbjct: 889 QVLLSNFMYSYLNLVNHTLYMEQVG---------TGDIAFNGDSALGMMDKNDSDGTILI 939

Query: 957 PDM 959
           PD+
Sbjct: 940 PDI 942

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  471 bits (1213), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 362/986 (36%), Positives = 504/986 (51%), Gaps = 139/986 (14%)

Query: 30  EKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKXXXXXXX 89
           EKRKS+V IAA+S+D E+QNVK+LKR+SIGS+DL++DPELE++VN  +  +         
Sbjct: 47  EKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 106

Query: 90  XXXXXHDVA-PCYD---KGED-----EGEASVSDGADDSFDTTGADYL--QTTNHSSANH 138
                 DV  P  +   +GED     EGEA+    ADDS D T  +YL  + T       
Sbjct: 107 ESLCEEDVIQPKQEEEKRGEDNDAYEEGEAT---NADDSIDITQTEYLHDEETLEKEKIF 163

Query: 139 QSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLW 198
            + P+   ++      R L+GV +L    V                        T+ LLW
Sbjct: 164 YNAPSSTSSARVTCRNRRLSGVKALAHDAV----------LEAMDDHESKTVDFTQNLLW 213

Query: 199 VPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPIDITRKR 258
           VPA QHP+VKPEN+LEL+QDTL NIQ+     +TD D+ ES  E    +    + + RK 
Sbjct: 214 VPANQHPNVKPENYLELIQDTLQNIQI-----STDEDSGESTLEVGNNH----VILNRKS 264

Query: 259 D-SLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSL 317
             S+VRRPSRL+ SYT+F   D+  S+     VG+E  N        P S  R+ R+VSL
Sbjct: 265 SGSIVRRPSRLKTSYTKF---DDEISVADKPEVGQEQVNKR-----IPSSEVRTIRSVSL 316

Query: 318 KDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQN 377
           K+ITEEL KISNNAGLT S+A+TLAR+LSM+GSF     NE+        + L ++D +N
Sbjct: 317 KEITEELTKISNNAGLTGSNAVTLARSLSMSGSFT----NEN--------LLLKSNDAEN 364

Query: 378 EYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLDDEHHESETKRKL 437
                 D+EFASNM  + G  IP RSSLRRSKFNTY++R  GS                 
Sbjct: 365 ------DSEFASNMFNESGRTIPERSSLRRSKFNTYKIRLEGS-------------GLPQ 405

Query: 438 SSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKK 497
           ++ L+N+    ++  +    SP+      +     S+NDFQ+I+DHYR+ S DW  +   
Sbjct: 406 AANLKNLMNMRTSDDRRSTSSPACYAR--LPQEQGSLNDFQEIFDHYRRTSTDWSTDWST 463

Query: 498 GTESDDSNKGNQLDFETSKEIASSKLSD------------LSQGNAKSSI-EAQDMEQAS 544
                D +     D E     + S+ S             +   NA S I E  D +  S
Sbjct: 464 ENAKYDDSPNYHSDEEDLTHASISQDSSLLSTDSSNNSVLVKPHNAGSMISERLDQQHVS 523

Query: 545 STVVRE-----MKGKRSGWSWLNGMGSKETN---TEKNVKDTARQEVPLHREPSDSHIDE 596
           S   RE     +     GWSWLN       N   T +   D    +  +  E +D  ++ 
Sbjct: 524 S---REDENNNISEPSHGWSWLNYSNENLNNNDNTHEQFIDDQDDDGCVENEKAD-FVNL 579

Query: 597 DFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNLT 656
              + +       +R NHSKNRH PIF       +      P +S+   +       ++T
Sbjct: 580 SVSRRTKSTKRASERINHSKNRHSPIFQVRSDESKSPIITPPVLSSSSSQSSDPTVLSVT 639

Query: 657 ----------------RQMFEKKIANLFRRK---GKKKLPDYGTSRDHTGAELKSKRSSD 697
                           ++  EK++A LF+R+   G  K  D    +     ELK K S  
Sbjct: 640 EKKLESPNDDKTNTHKKKSLEKRLAGLFKRRQQSGPSK-SDVKVIKKSVRKELKKKASHS 698

Query: 698 NLSKFAKTSKTPVKLRSESRVEEHLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPA 757
            LSKF K+ K   K   E++V +           P   +         +++     +Q  
Sbjct: 699 GLSKFRKSPKKKFK---EAKVNQE---------CPSPPVETDSTGDVDTESTIQSTIQNP 746

Query: 758 VSVTSTKSAHVPLASSVVIESVKELDGDDSQDVS---MDQNAQTSIDISTETLSMKEQTS 814
            + T     ++  +S  V+E++ ELDGDDS D+S   ++ N +   +I  +T +  + + 
Sbjct: 747 NTSTILSDRNISHSSEFVVETISELDGDDSFDISGNDINYNVEVHSNIDRDTAAGSDDSI 806

Query: 815 EVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMF 874
           E Q +   P+       + PRKLTF DV + +  NAP+KFTDSAFGFPLPM+T STVIMF
Sbjct: 807 EQQEESIIPSPETQTPNLIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMF 866

Query: 875 DHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLT 934
           DHRL INVERAIYRLSHLKLSDP RELRQQV+LSNFMY+YLNLVNHTLYMEQ+  E+ + 
Sbjct: 867 DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMGSEDVV- 925

Query: 935 TETSGGTAF-KTEHNSANGSICIPDM 959
              +G +A    + N ++G+I IPD+
Sbjct: 926 --FNGDSALGMVDKNDSDGTILIPDI 949

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  465 bits (1197), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 367/996 (36%), Positives = 516/996 (51%), Gaps = 132/996 (13%)

Query: 14  EQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73
           +Q ++R+     +   EKRKS+VLIAA+S+D E+QNVK+LKR+SIGS+DL+ DPELE+++
Sbjct: 35  QQGRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKL 94

Query: 74  NVNSPNTRKXXXXXXXXXXXXHDVAPCYDKGEDEG------EASVSDGADDSFDTTGADY 127
           +  +  +               ++     + E+ G      E   +  ADDS D T  +Y
Sbjct: 95  SSRNSYSSDSSKESLQESLHGEEIKQLEQEIEERGQDDDVYEEDDATNADDSIDITQTEY 154

Query: 128 L---QTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXX 184
           L   +T      + +++    P     S  R L+GV S     V                
Sbjct: 155 LHDEETLEKERISRKASSTSFPAR-VTSRNRRLSGVKSFPHDEV----------LDVVDS 203

Query: 185 XXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKE-- 242
                   T+ LLWVPA QHP+VKPEN+LEL+QDTL NIQ+     + D + DES  E  
Sbjct: 204 HDSNAVNFTQNLLWVPANQHPNVKPENYLELIQDTLQNIQI-----SVDQEFDESKLELG 258

Query: 243 NAKAYDRLPIDITRKRD-SLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERS 301
           N  A+        R+R  S+VR PSRL+ SY++F++       E S+A G+  +   +  
Sbjct: 259 NNHAFP------NRQRSGSIVRNPSRLKTSYSKFDD-------EPSLA-GQPQQEQEQVE 304

Query: 302 SIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYD 361
              P S  +S R+VSLK+ITEEL KISNNAGLT SDA+TLAR+LSM+GSF S        
Sbjct: 305 RRIPSSEFKSMRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTSG------- 357

Query: 362 TSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGST 421
                 +HL  +      N E+DNEFASNM  + G  IP RSSLRRSKFNTY++R  GS 
Sbjct: 358 -----NLHLSNN------NAENDNEFASNMFNEIGGGIPERSSLRRSKFNTYKIRLEGSG 406

Query: 422 SSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIY 481
            S       S    ++S G  + +  +S +Q      P  +G         S+NDFQ+I+
Sbjct: 407 LS-QASRPNSLMSIQISEGRRSASLPASYAQL-----PQQQG---------SLNDFQEIF 451

Query: 482 DHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIA--SSKLSDLSQGNA-------K 532
           DHYR+ S +W  E  K    D++N  +  +  T   I+  SS LS  S  N+        
Sbjct: 452 DHYRKTSTEWGTENTKYV--DNTNYYSDEEDLTHASISQDSSFLSTDSSNNSVLMKPHNS 509

Query: 533 SSIEAQDMEQASSTVVREMKG---KRSGWSWLNGMGSKETNTE---KNVKDTARQEVPLH 586
            S+ ++ ++Q + +   E  G      GWSWLN      +N +   + + D    E  L 
Sbjct: 510 GSMISERLDQDTISNENENTGISEPNHGWSWLNSGNENSSNNDHIYEPLMDEQDAEDCLE 569

Query: 587 REPSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIF----------------PANESSK 630
            E ++  ++    + +       +R NHSKNRH PI                 P++   +
Sbjct: 570 NEEAN-FVNLSVSRRAKSTKRVSERINHSKNRHSPILQMPSDGSKSVVITSSVPSSPPLQ 628

Query: 631 RKDTTEEPAVSTKMGRXXXXXXXNLTRQMFEKKIANLFRRK----GKKKLPDYGTSRDHT 686
             + T   A   +          +  +Q  EK++A LF+RK    G K   D    + + 
Sbjct: 629 SSEATIPAAAEKEQNCPDDNRPLSHKKQSLEKRLARLFKRKQHCDGSKS--DAKVLKKNV 686

Query: 687 GAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEEHLRNSVSKDVVPDTAIVAGEVIPSKS 746
             ELK K S  +LSKF    K+P K R E   EE + +  S  V      +  E   + S
Sbjct: 687 KNELKKKASHSSLSKF---RKSPKKKREE---EEVVHDRPSSPV----ETITTEDFDTSS 736

Query: 747 KAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSM---DQNAQTSIDIS 803
             E  PA++   +      ++   +S  V+E++ ELDGDDS D+S    D N     DI+
Sbjct: 737 DIE--PAVESPNACNILPDSNTNHSSEFVVETINELDGDDSFDISGGENDCNIDVRSDIA 794

Query: 804 TETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPL 863
            +T +   ++   + +   P+  P    + PRKL F+DV + E  NAP+KFTDSAFGFPL
Sbjct: 795 RDTTAGPNESMGEEEESMVPSPAPQISTLLPRKLIFEDVIKPEYPNAPIKFTDSAFGFPL 854

Query: 864 PMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLY 923
           PM+  STVIMFDHRL INVERAIYRLSHLKLSDP RELRQQV+LSNFMY+YLNLVNHTLY
Sbjct: 855 PMIANSTVIMFDHRLNINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLY 914

Query: 924 MEQVAQENDLTTETSGGTAFKTEHNSANGSICIPDM 959
           MEQ+  E+ +    S      T+ N ++G+I IPD+
Sbjct: 915 MEQMGSEDAVF--NSDPALGMTDKNDSDGAIVIPDI 948

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  449 bits (1155), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 342/843 (40%), Positives = 452/843 (53%), Gaps = 158/843 (18%)

Query: 155 RTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAAQHPSVKPENFLE 214
           R L+G+ S R+      +RKL                +   LLWVPA++HP+VKP+N++E
Sbjct: 162 RNLSGINSSRQS-----SRKLSNDRTDNEDK------LKNNLLWVPASKHPNVKPQNYIE 210

Query: 215 LVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPIDITRKRDSLVRRPSRLRKSYTE 274
           LVQDTL +I +D+ K    NDND  NKEN           + K  SLVRRPSRLRKSYTE
Sbjct: 211 LVQDTLQHIHIDDSKS---NDNDNINKENDAH--------SSKNGSLVRRPSRLRKSYTE 259

Query: 275 FEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLT 334
           +EE +  +         + + N  E  +I    S    R+VSLKDITEEL KISN AGLT
Sbjct: 260 YEEENYQDDY------NRNNSNDEENPNIGNFRSSNKGRSVSLKDITEELTKISNKAGLT 313

Query: 335 SSDAITLARTLSMAGSFASS----EVNEDYDTSKRNGIHLDADDVQNEYNKEDDNEFASN 390
            SDAITLARTLSM GSF++     E+  +Y   + N  + D       YNK DD EFASN
Sbjct: 314 DSDAITLARTLSMTGSFSNGTDDMELLSNYSDQQDNNFNNDE-----HYNKNDD-EFASN 367

Query: 391 MLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLDDEHHESETKR----KLSSGLENVTA 446
           MLMK+G+ IP RSSLRRSKFNTYRVRSS + S++  +   S  K     K     +    
Sbjct: 368 MLMKNGLTIPQRSSLRRSKFNTYRVRSSSAPSNIHSKPINSNIKEPKTFKYPYNSKTSIK 427

Query: 447 ESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTESDDSNK 506
           +S  ++ + Y  P       +  SP SI    D+YDHY   SVD  +E    T   +++ 
Sbjct: 428 KSPVNRSNNYTEP-------VTESPGSI---SDLYDHYAYSSVD--EETSNATNLQETSN 475

Query: 507 GNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDMEQASSTVVREMKGKRSGWSWLNGMGS 566
              +D   S E  SS  S L + +   S+  ++ +  +S  V +      GWS +N   +
Sbjct: 476 DGSID---SNE--SSNDSVLVKPSHSESMIHENFDALASDTVTD------GWSNVNNENA 524

Query: 567 KETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEIQ--RSNHSKNRHLPIFP 624
                             L R  ++  ++++        +T     RSNHSKNRH P+F 
Sbjct: 525 HF----------------LQRNNNNGRLNDELVSKGNQESTHYNKTRSNHSKNRHKPLFT 568

Query: 625 ANESSKRKDTTEEPAVSTKMGRXXXXXXXNLTRQMFEKKIANLFRRKGKKKLPDYGTSRD 684
           +  +     T +   VS K             +Q  E+KI  LF+RK             
Sbjct: 569 STNTPM---TAKTKNVSKK-------------KQTLEEKIVKLFKRK------------- 599

Query: 685 HTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEEHL--RNSVSKDVVPDTAIVAGEVI 742
              A  ++  SS+N   F    + P+K   E  + E+   R + + D +   +I + E  
Sbjct: 600 ---AHRRTSSSSEN-QIFG---QEPLK---EDVLFEYTTERENSAGDNLEGHSIHSHESF 649

Query: 743 P---SKSKAEDLPALQPAVSVTSTK-------------SAHVPLASSVVIESVKELDGDD 786
               S++  ++LP+LQPAVSV STK             S+ +  +SS VI++V EL+GD+
Sbjct: 650 KSSDSETSDKELPSLQPAVSVVSTKKESNASAPPSSASSSSLSSSSSTVIQTV-ELEGDE 708

Query: 787 SQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSE 846
           SQDVS +  A    D     LS  E T+E + ++K          +PPRKLTFDDVKR E
Sbjct: 709 SQDVSYE--ALKGEDFRNPELSSSETTAEQEKELKSAISS-----LPPRKLTFDDVKRPE 761

Query: 847 QSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVV 906
           + NAP+ F+DSAFGFPLPMLT STVIMFDHRL INVERAIYRLSHLKLSDPKRELRQQV+
Sbjct: 762 KPNAPIHFSDSAFGFPLPMLTTSTVIMFDHRLGINVERAIYRLSHLKLSDPKRELRQQVL 821

Query: 907 LSNFMYAYLNLVNHTLYMEQVA---QENDL-------TTETSGGTAFKTEHNSANGSICI 956
           LSNFMYAYLNLVNHTLYMEQ A    E+D          ET G   + T HN+++G+I I
Sbjct: 822 LSNFMYAYLNLVNHTLYMEQAAVSSNESDYEEDLEEVEQETGGVGRYTTAHNASDGTIVI 881

Query: 957 PDM 959
           PDM
Sbjct: 882 PDM 884

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score =  442 bits (1136), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 359/996 (36%), Positives = 492/996 (49%), Gaps = 188/996 (18%)

Query: 30  EKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKXXXXXXX 89
           EKRKSEVLIAAQS+D+E+Q+VK+LKRISIGS+D+L+DPE+E+RV   SP+  +       
Sbjct: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRV---SPSPSQPAPTTDT 90

Query: 90  XXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTNHSSANHQSTPNVKPTSP 149
                HD    Y+   D          +DS D T  +YLQ +  +      +     ++ 
Sbjct: 91  S----HDQQ-LYNSHSDHDSDDDLSYVNDSIDITSTEYLQESEGTGFESLGSS----SND 141

Query: 150 QISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAAQHPSVKP 209
               KRTL+GV   RRGG++  TR                  +T  LLWVPA QHP++KP
Sbjct: 142 ADCGKRTLSGV---RRGGLSGKTR------MNNNLSAKDEESVTHNLLWVPANQHPNIKP 192

Query: 210 ENFLELVQDTLHNIQLDEKKE-TTDNDNDES-NKENAKAYDRLPI--DITRKRDSLVRRP 265
           EN+LELVQDTLH ++++   E + +  NDE      A A   LP    +    +SLVRRP
Sbjct: 193 ENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHAPAAASANLPPSNQLRSGLNSLVRRP 252

Query: 266 SRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGR-SSRTVSLKDITEEL 324
           S LRKS+TE E+    E+ + S   G +       +   P    R  SR+ SLKDITEEL
Sbjct: 253 SGLRKSFTELEDLLLQEAQDTS---GGDENAELPSADKMPSVRPRIGSRSSSLKDITEEL 309

Query: 325 NKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDD 384
            +ISN AG T  DA++LARTLSMA S+ + E  E   + +                K+ +
Sbjct: 310 TRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPE----------------KKPE 353

Query: 385 NEFASNMLMKHGVVIPARSSLRRSKFNTYRVR--SSGSTSSLDDEHHESETKRKLSSGLE 442
            E+AS+ML K+G+ IPARSSLRRSKFNTYR+R  S GST+                S L 
Sbjct: 354 KEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAP---------------SNLR 398

Query: 443 NVTAESSASQQDIYHSP-SIKGNGSIMSSPSSINDFQDIYDHYRQPSVD-----WEKELK 496
           + +AE      ++  SP  +    + + SP+S+NDF +IYDHYRQ S D     +  E +
Sbjct: 399 SPSAE----HNELDRSPIRVDQKNAQLQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQ 454

Query: 497 KGTESDDSNKGNQ-------LDFETS-----KEIASSKLSDLSQGNAKSSIEA------Q 538
               S+  +  ++       LD E+S     K   +  L D  Q + +  +EA       
Sbjct: 455 NAHTSNFHSIASKRPKDDTLLDSESSLHDLHKGSLNKALDDEQQASFRGHVEATNNDEKD 514

Query: 539 DMEQASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDF 598
           D + ASS   R    K+SGWSW     SK+           ++  P H +     +  DF
Sbjct: 515 DHKHASSQAPR----KKSGWSWFGKKSSKD-----------QESSPEHTQ----RVSSDF 555

Query: 599 EKTST---PVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNL 655
              S+   P     ++ NHS++RH  I          D T   +  +             
Sbjct: 556 LGVSSSAKPTNVPTEKINHSRHRHYSI----------DDTANSSTESTTSNTVSSSQSPT 605

Query: 656 TRQMFEKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRS- 714
            +Q  EKK   LF+R   +     G  +D  G  +  K  S N  K  KT  +   LR  
Sbjct: 606 KKQRKEKKFIQLFKRN--RTTSTNGREKD-DGPSISEKLQSSNAVKVLKTRTSSTNLRKN 662

Query: 715 -----ESRVE-EHLRNSVSKDV--VPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSA 766
                ++R+  +  R SV +D     D  +V       + + E L  LQP+VS+T    +
Sbjct: 663 RLSPKKTRLSGDGRRESVKEDFGSTQDYKVV-------REEKEPLAKLQPSVSLT--PKS 713

Query: 767 HVPL-----------------------ASSVV-IESVKELDGDDSQDVSMDQ------NA 796
             PL                       A SV+  +S  EL+ D+      D        +
Sbjct: 714 RPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEAGPRTDAIHEGITES 773

Query: 797 QTSIDISTETLSMKEQTSEVQTD-------------VKQPADGPSHQPVPPRKLTFDDVK 843
            T  +  T T    E+T+    D             ++ PA G     +PPRKL F DV 
Sbjct: 774 NTQAEADTVTAYAPEETAAASADDSFTKSQEPNAPELQAPAAG--GYVLPPRKLAFSDVI 831

Query: 844 RSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQ 903
           + E+ NAPMKF+DS+FGFPLP LTVSTV+M DHRLPINVERAIYRLSHLKL DPKRELRQ
Sbjct: 832 KPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQ 891

Query: 904 QVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSG 939
           QV+LSNFMYAYLNLVNH+LY++Q+ +E     + +G
Sbjct: 892 QVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAG 927

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1049

 Score =  432 bits (1111), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 382/1110 (34%), Positives = 533/1110 (48%), Gaps = 257/1110 (23%)

Query: 30   EKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNT--------- 80
            EKRKS VLIAAQS+D EVQNVK LKR+S+GS+DLL+DPE EY +   + +          
Sbjct: 15   EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEYTMGSTNDSNSNTNTNTNT 74

Query: 81   ----RKXXXXXXXXXXXXHDVAPCYD------KGEDEGEASVSDGADD-SFDTTGADYLQ 129
                RK             +V+  YD         D   A+VSD A+D SFD TG +YL 
Sbjct: 75   KKNLRKSRLFDNDNSLMECEVSENYDDIANLDSTSDLTSANVSDLANDNSFDKTGIEYLH 134

Query: 130  TTN----HSSANHQST----PNVKPTSPQI-----SVKRTLTGVGSLRRGGVNIPTRKLX 176
              +    H++ N+  T    PN+  +  Q       ++R L+GV SL RG       K+ 
Sbjct: 135  NEDFEHVHTNENNNYTLGEEPNINESLFQSHKNNSQLRRGLSGVHSLNRGNSKQLKPKIQ 194

Query: 177  XXXXXXXXXXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDN 236
                           IT+ LLWVPA +HP VKPEN++EL+QDTL NI L+   ET +N  
Sbjct: 195  NKQTETEDQ------ITQNLLWVPANKHPGVKPENYVELLQDTLQNINLN-LNETQNNVE 247

Query: 237  DESNKENAK-AYDRLPI-------DITRKRDSLVRRPSRLRKSYTE-FEEYDETESLEGS 287
            D SNK + K   DR  I       D+ R   SLVRRP+ LR SY+E  EE+ +    E S
Sbjct: 248  DTSNKTSDKMVMDREVIRRRRISQDLNRNHSSLVRRPTGLRISYSESVEEFHDALESENS 307

Query: 288  VAVGKESRNSFERSSIAPCSSGRSSRT--------VSLKDITEELNKISNNAGLTSSDAI 339
            +   KE   S  ++SI+  +    +++         SLKDITEEL KISN AGL++SDAI
Sbjct: 308  LNSDKEREPSLSQNSISMITIDLQNKSTYQMGKNYASLKDITEELTKISNKAGLSNSDAI 367

Query: 340  TLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNE----------FAS 389
            +LAR+LS+AGS + ++          N +   +D++Q+     DDN+          +AS
Sbjct: 368  SLARSLSIAGSVSKTD----------NSV---SDNLQSATQGNDDNKPRSSEVSEAGYAS 414

Query: 390  NMLMKHGVVIPARSSLRRSKFNTYRVRS-SGSTSSLDDEHHESETKRKLSSGLENVTAES 448
            N+L+++G+ +P RS LRRSKFNTY++R+ SG+         E     K      NVT  S
Sbjct: 415  NILVRNGITMPTRS-LRRSKFNTYKIRNPSGNI-------LEQSRISKSEPSSRNVTGSS 466

Query: 449  S-ASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQ-PSVDWEKELKKGTESDDSNK 506
            + AS  DI H+  +    + ++       F+ I +   Q  S+D    L K  +  D   
Sbjct: 467  NRASSFDIEHTQDVLRESAPLT-------FETISEEQVQDKSLDAIDILDKSLDISD--- 516

Query: 507  GNQLDFETSKEIASSKLSDLSQGNAKSSIEAQD-----MEQASSTVVRE-MKGKRSGWSW 560
                     K+  SS LS  SQGN   S ++ +         S ++++E +   R G   
Sbjct: 517  ---------KDFDSSHLS-FSQGNITQSSDSSNDSVLVRPAYSHSIIQEKLDTDRGGDLE 566

Query: 561  LNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEIQR-----SNHS 615
             +     ET               L  + SD   D DF   S P  T+ QR     SNHS
Sbjct: 567  FSSNKFSET---------------LFAKESDIQDDPDFVNLSIPERTKSQRVRAEKSNHS 611

Query: 616  KNRHLPIFPANESS----KRKDTTEEPAV----------------------STKMGRXXX 649
            K+RH PI   +E +      K    +P +                      S K      
Sbjct: 612  KHRHSPIITISEETPFKINNKKQLSQPLLNESEINKGDHGSIIPENLKHKASVKEASSKE 671

Query: 650  XXXXNLTRQMFEKKIANLFRRKGKK-----------------------KLPDYGTSRDHT 686
                   +Q F+KKI ++F+RK  K                             T +D +
Sbjct: 672  KEPSTNKKQRFDKKIVSIFKRKSSKTSNNEIKNEKKTVLSQEDKRIMSSSSSKSTKQDIS 731

Query: 687  GAELKSKRSSDNLSKFAKT----------SKTPVKLRSES-----------RVEEHLRNS 725
             AEL+S    D+L    +              PV  +S S             E+ L +S
Sbjct: 732  AAELQSDHLDDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSS 791

Query: 726  VSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKEL-DG 784
              ++   D+     E + +++      +LQPAV +TS +      A  VV E+V EL DG
Sbjct: 792  YDENA-EDSFSYLEESLETQN------SLQPAVCITSNR------ADVVVTETVDELSDG 838

Query: 785  DDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKR 844
            DDSQD++  +    +  ++T   S +   +  +  V+Q A+      +P RKLTF DV +
Sbjct: 839  DDSQDITGGEFYTDNTQVNTINTSYETSYNSTRI-VEQEANTLPESSLPARKLTFKDVVK 897

Query: 845  SEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQ 904
             E+ N PM+FTDSAFGFPLP LT STVIMFDHRLP+NVERAIYRLSHLKLSDPKRELR+Q
Sbjct: 898  PERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQ 957

Query: 905  VVLSNFMYAYLNLVNHTLYMEQV---AQENDLTT---------------------ETSGG 940
            ++LSNFMYAYL+LVNH+LY+EQ    A+E+++ T                     +T   
Sbjct: 958  ILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNN 1017

Query: 941  TA-----------FKTEHNSANGSICIPDM 959
            T            + TE N+A+GSICIPD+
Sbjct: 1018 TGSDYLNNDVTNDYHTERNAADGSICIPDL 1047

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  409 bits (1051), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 337/920 (36%), Positives = 467/920 (50%), Gaps = 161/920 (17%)

Query: 104 GEDEGEASVSDG----ADDSFDTTGADYL---QTTNHSSANHQSTPNVKPTSPQISVKRT 156
           G+++ +    DG     DDS D T  +YL   +T     ++  ++ +   ++   S  R 
Sbjct: 160 GQEDEDYEYEDGNATNVDDSIDITQTEYLHDEETLEKEKSSRNASSSTSSSARVTSSNRR 219

Query: 157 LTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAAQHPSVKPENFLELV 216
           L+GV S     V                       +T+ LLWVPA+QHP+VKPEN+LELV
Sbjct: 220 LSGVNSFAHDEV----------LDVAEDHSSNTANLTQNLLWVPASQHPNVKPENYLELV 269

Query: 217 QDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPIDITRKRD-SLVRRPSRLRKSYTEF 275
           QDTL NIQ+     TTD D DE N + +  +    +   R+R  S+VRRPS L+ SYT+F
Sbjct: 270 QDTLQNIQI-----TTDQDPDEKNSDLSNNH----VFSNRQRSGSIVRRPSHLKTSYTKF 320

Query: 276 EEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTS 335
           +  DE  S      V ++ +   +          +S R VSLK+ITEEL KIS+NAGLT 
Sbjct: 321 D--DEPSS------VDRQRQGHGQAEKRISSLETKSIRCVSLKEITEELTKISDNAGLTD 372

Query: 336 SDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDVQNEYNKED-DNEFASNMLMK 394
           SDAITLAR+LSM+GSF +              +HL +       NK D DNEFASNM  K
Sbjct: 373 SDAITLARSLSMSGSFTNE------------SLHLSS-------NKTDSDNEFASNMFNK 413

Query: 395 HGVVIPARSSLRRSKFNTYRVR-------SSGSTSSLDDEHHESETKRKLSSGLENVTAE 447
            G+ IP RS LRRSKFNTY++R        +G  +SL +     + +R          A 
Sbjct: 414 SGLTIPERS-LRRSKFNTYKIRLENNDLLPTGRPNSLMNVQTNDDRRR----------AS 462

Query: 448 SSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTESDDSNKG 507
           S AS    Y  P            + +NDFQ+I++HYR+ S DW  E  K    D++N  
Sbjct: 463 SPAS----YTQPP--------QDQTPLNDFQEIFEHYRRTSTDWGTENTKYV--DNTNYY 508

Query: 508 NQLDFETSKEIA--SSKLSDLSQGNA-------KSSIEAQDMEQASSTVVRE---MKGKR 555
           +  +  T   I+  SS LS  S  N+         S+ ++ ++Q  ++   E   +    
Sbjct: 509 SDEEDLTHASISQDSSFLSTDSSNNSVLVKPHNAGSMISERLDQDIASNENEDIDINEPN 568

Query: 556 SGWSWLNGMGSKETNTEKNVKDTARQEVPLHREP-SDSHIDEDFEKTSTPVTTEI----- 609
            GWSWLN      TN      D A ++V    E   D   DE  +  +  V+        
Sbjct: 569 HGWSWLNSANENLTNY-----DGAYEQVIDDEEDIGDCVEDEKADFVNLSVSRRAKSTKR 623

Query: 610 --QRSNHSKNRHLPIFP--ANES--------------SKRKDTTEEPAVSTKMGRXXXXX 651
             +R NHSKNRH PIF   ++ES              S+  ++     V  + G      
Sbjct: 624 ASERINHSKNRHSPIFQMQSDESKSVVVTSSVTSLSPSQSTESAAPAVVEKEQGSPNDNK 683

Query: 652 XXNLTRQMFEKKIANLFRRK--GKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTP 709
                +   EK++A LF+RK        D    + +   ELK K S  +LSKF K+ K  
Sbjct: 684 PPAHKKHSLEKRLARLFKRKQHNNNSKSDAKVIKKNVKQELKKKTSHSSLSKFRKSPKKK 743

Query: 710 ------VKLRSESRVEEHLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTST 763
                 V+ RS S VE     +VS  ++ DT I            E  P ++   +    
Sbjct: 744 SQQVEVVQDRSSSPVE-----TVSTRIL-DTPI------------EIEPIVENPTNSNIF 785

Query: 764 KSAHVPLASSVVIESVKELDGDDSQDVS---MDQNAQTSIDISTETLSMKEQTSEVQTDV 820
              +   +S +V+E++ ELDGDDS D+S   ++ N + + ++ T+T +   +    + + 
Sbjct: 786 SGGNTNHSSELVVETINELDGDDSFDISGGDINYNVEVTANMDTDTTAEPNERVGEEDED 845

Query: 821 KQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPI 880
             P   P    + P+KLTF+DV   E  NAP+KFTDSAFGFPLPM+T STVIMFDHRL I
Sbjct: 846 TVPTLTPQLSILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGI 905

Query: 881 NVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGG 940
           NVERAIYRLSHLKLSDP RELRQQV+LSNFMY+YLNLVNHTLYMEQ+  EN +    +G 
Sbjct: 906 NVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIGSENAV---FNGD 962

Query: 941 TAFK-TEHNSANGSICIPDM 959
           +A   T+ N ++G+I IPD+
Sbjct: 963 SALAMTDKNDSDGTILIPDI 982

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 43/44 (97%)

Query: 30 EKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73
          EKRKS+VLIAA+S+D E+Q+VK+LKR+SIGS+DL++DPELE++V
Sbjct: 51 EKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFKV 94

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
            (ZDS1)
          Length = 1018

 Score =  399 bits (1026), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 372/1051 (35%), Positives = 505/1051 (48%), Gaps = 181/1051 (17%)

Query: 7    RSDANLEEQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMD 66
            +S A   E  Q R   + T   +EKRKSEVLIAAQS+D E+QNVK+LKRISIGS+DLLMD
Sbjct: 48   KSCAGPLEGVQERVLRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMD 107

Query: 67   PELEYRVN--VNSPNTRKXXXXXXXXXXXXHDVAPCYDKGEDEGEASVSDG---ADDSFD 121
            PE+E+R+N    SP+                  A     GE    A   D    A  S D
Sbjct: 108  PEMEFRMNGAAVSPSASPRNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHSSAGGSSD 167

Query: 122  TTGADYLQTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXX 181
            T   D L T+  S    +      P SP  + K++       + G  +  T         
Sbjct: 168  T-ARDELLTSASSVVPSEELSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDT--------- 217

Query: 182  XXXXXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNK 241
                       +  LLWV A QHP+VKPEN+LELV DTL+N+++  +    D+   +SN 
Sbjct: 218  THTKQATGEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNT 277

Query: 242  ENAKAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDE---TESLEGSVAVGKESRNSF 298
              A          T    SLVR+ SRLRKS+TE E  +E   T+S+   + VGK  R S 
Sbjct: 278  PVANGESS-----TASARSLVRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGKRMRVS- 331

Query: 299  ERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNE 358
                             SLK+ITEEL +ISNNAGLT SDAITLARTL + GS ++ E   
Sbjct: 332  -----------------SLKEITEELTRISNNAGLTDSDAITLARTLGI-GSQSADE--- 370

Query: 359  DYDTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSS 418
                      H    +       E+ NE+AS++L K+G+ IPARSSLRRSKF TYR+RS+
Sbjct: 371  ----------HATFSECVPSAEAEE-NEYASSILAKNGLAIPARSSLRRSKFTTYRIRSA 419

Query: 419  GSTSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHS--PSIKGNGSIMSSPSSIND 476
            GS SS  +  ++S +   L++  E   + S   Q+  +    P + G  + ++ P S N 
Sbjct: 420  GSDSSPPE--NKSTSSSSLAAAYER-NSRSPKMQKAAFKGSHPRLSGENTSLA-PQSPNS 475

Query: 477  FQDIYDHYRQPSVD-WEKELKKGTESDDSNKGNQLDFETSKEIASS--------KLSDLS 527
              DIYDHY     D    EL+    +  S+      F +S  IAS         K+S +S
Sbjct: 476  INDIYDHYNTSDTDDGSPELQGSPVTHTSDA----SFTSSPNIASGEHCARNAHKISPIS 531

Query: 528  ---------------QGNAKSSIEAQDMEQASS----TVVREMKG------KRSGWSWLN 562
                              +  S ++   +Q S     T+    KG      K+ GWSW  
Sbjct: 532  VSQLSATSSSSTSPGSSKSAESTKSWTFDQKSPLRSITLNSSTKGHKISAEKKKGWSWF- 590

Query: 563  GMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEI-QRSNHSKNRHLP 621
            G   + ++    +  T  +  P+         +   +   +PV+ E  +R NHS+NRH  
Sbjct: 591  GNSRRPSSESVLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDETPRRGNHSRNRHQT 650

Query: 622  IFPANESSKRKDTTEEPAVSTKMGRXXXXXXXN--LTRQMFEKKIANLFRRKGKKKL--- 676
              P        +T+    ++T  G            T++  EKK   +F+++    L   
Sbjct: 651  SSPEELEIGWTETS----LTTLDGDTEQDGKPQHPKTKEKLEKKFMKIFKKRSGTGLSQD 706

Query: 677  -PDYG-------TSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEEHLRNSVSK 728
             P+ G       TSR     E  SKR +D  S    TS   V L + +   + +  S+S+
Sbjct: 707  TPNQGEESSLKATSRIRRSRE--SKRQTDEPSASLTTS---VSLNNHNNGRKSV--SISR 759

Query: 729  DVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHV-----PLASSVVIESVKELD 783
               P            K K   + +LQPAVSVTS++ +H      P   S+V +    +D
Sbjct: 760  ---PTWQRTESSYNGDKGKG-SITSLQPAVSVTSSRDSHEQTRQDPQPQSLVTK----MD 811

Query: 784  GDDSQDVSMD-QNA-----------------QTSIDI-------------STE---TLSM 809
            G  S  V++  Q A                  TS DI             STE   TLS 
Sbjct: 812  GSSSNGVTVSSQRAGFSKKGRSKTSHSRSKLSTSHDIAPVDNRPSDVDQKSTEANNTLSS 871

Query: 810  KEQTSEVQTDVKQPADGPSH--QPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLT 867
            + + S    D  + A GP      +PPRKL FDDV R E+ N+PMKFT SAFGFPLP LT
Sbjct: 872  RAEDSHPSLDPGKSALGPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLT 931

Query: 868  VSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQV 927
            VSTVIMFDHRLPI VERAIYRLSHLKLSDPKRELRQQV+LSNFMY+YLNLVNH+LY++Q+
Sbjct: 932  VSTVIMFDHRLPIYVERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 991

Query: 928  AQENDLTTETSGGTAFKTEHNSANGSICIPD 958
             ++ +       G  F++  N A+ S  +P+
Sbjct: 992  EEDKNQ------GIQFESTDNMASSSGVVPE 1016

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  386 bits (992), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 341/1008 (33%), Positives = 486/1008 (48%), Gaps = 184/1008 (18%)

Query: 5   DGRSDANLEEQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLL 64
           D R+  N + ++Q     +   ++ EKRKSEVLIAAQS+D+E+Q+VK+LKR+S GS+DL 
Sbjct: 6   DHRASLNNDMRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLP 65

Query: 65  MDPELEYRVNVNSPNTRKXXXXXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTG 124
           +DPE+E+R++ +                      P  D   D+  + +    +DS + T 
Sbjct: 66  LDPEMEFRMSPSHSQRSSSSDAVSLESQAEE---PNQDDDSDDNLSYL----NDSIELTA 118

Query: 125 ADYLQTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXX 184
            +YL+          S       S      R L+GV   RRGG++   R+L         
Sbjct: 119 HEYLEEPRDFLVERSSVSK----SEDSHNGRNLSGV---RRGGMSKKPRELSNGGDDN-- 169

Query: 185 XXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKE-----TTDNDNDES 239
                  +T+ L WVPA QHP+VKPEN+LELVQDTLH + +D + E     T + +N   
Sbjct: 170 -------VTQNLFWVPANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYL 222

Query: 240 NKENAKAYDRLPIDITRK-RDSLVRRPSRLRKSYTEFE---EYDETESLEGSVAVGKESR 295
              N KA    P    R  ++SLVRRPS LRKSYTE E   +++  +S E +     E  
Sbjct: 223 ASANTKAS---PSSQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQSELN 279

Query: 296 NSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSF--AS 353
           N  +    A  SSG S     LKDITEEL +ISN AG T  DA+ LARTLSMA S+    
Sbjct: 280 NIIKNRPRA-TSSGSS-----LKDITEELTRISNKAGFTDGDAVCLARTLSMASSYDGEQ 333

Query: 354 SEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTY 413
           S+ N+  +T                 +   D+E+AS +L K+G+ IPARSSLRRSKFNTY
Sbjct: 334 SQANQSANT-----------------DHTPDSEYASTILTKNGLAIPARSSLRRSKFNTY 376

Query: 414 RVRSSGSTSSLDDEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSS 473
           R+R+   +S        +    +     E    +S                   + SP+S
Sbjct: 377 RIRTPNGSSVTSSSLRSTSLPNEERKDPEGYIEKSDR-----------------LRSPTS 419

Query: 474 INDFQDIYDHYRQPSVDWEKELKKGTESDDS-----NKG-----------NQLDFETSKE 517
           +NDF +IYDHYRQ SV    E     ++D S     NK            N+    +SK 
Sbjct: 420 VNDFNEIYDHYRQGSVGSTSE-PHAVDNDASSASPFNKSLVHPSHHETHLNEESESSSKH 478

Query: 518 IASSKLS-DLSQGNAKSSIEAQDMEQASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVK 576
                L+  L +    ++ +A++ E   S    ++  K+S W+W      K+T+ ++++ 
Sbjct: 479 STDKTLNYPLEKDGKGNNSKAKNKENKPSGT--QILRKKSSWNWF----GKKTSKDQDIA 532

Query: 577 DTARQEVPLHREPSDSHIDEDFEKTSTPVTTEI---QRSNHSKNRHLPIFPANESSKRKD 633
           +   Q           +   DF   S    T     ++ NHS++RH  I    +S  R  
Sbjct: 533 NDDEQ-----------NTFSDFLSVSGNAKTSYIPTEKVNHSRHRHYSI----DSGSRGS 577

Query: 634 TTEEP---AVSTKMGRXXXXXXXNLTRQMFEKKIANLFRR--------KGKKKLPDY--G 680
              +P   AVS+           +  +Q  EKK   LF+R        + K+   +Y  G
Sbjct: 578 IAADPSKLAVSS-----------SPKKQKREKKFIQLFKRSRTASTGSRDKEDKVNYLGG 626

Query: 681 TSRDHTGAELKSKRSSDNLSKF---AKTSKTPV-------------KLRSESRVEEHLRN 724
           TS + T   LK+K SS N+SK     + +K P               L   S +++ +  
Sbjct: 627 TSGNPTDM-LKTKASSRNVSKPTLDVQPAKIPTIGGERRSASLDESSLDKGSDLDQGMEK 685

Query: 725 SVSKDVVPDTAIV--AGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKEL 782
           SV+K + P   +   A   + +     + P +Q A  +           S    ES  +L
Sbjct: 686 SVAK-LQPSVCLTSKAKNEVSTPVHVVENPQVQGANKLDGEHQVEPVFESDTDTESETDL 744

Query: 783 DGDDSQDVSMDQNAQTSIDISTETLSMKEQTSEVQT-------------------DVKQP 823
            G   Q   + Q+A      +   + ++E   + Q                    D   P
Sbjct: 745 QGSLKQGFEVKQSASVEKADTQPVIQLEEPFQQKQASRKDVQDSSPVDIEDNAGIDPMAP 804

Query: 824 ADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVE 883
           A G     +PPRKLTF DV + E+ N+PMKF+DS+FGFPLP LT+STV+M DHRL INVE
Sbjct: 805 AAG--GYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVE 862

Query: 884 RAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQEN 931
           RAIYRLSHLKL DPKRELRQQVVLSNFMYAYLNLVNH+LY++Q+ ++N
Sbjct: 863 RAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEEDN 910

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  369 bits (948), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 321/985 (32%), Positives = 464/985 (47%), Gaps = 267/985 (27%)

Query: 34  SEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKXXXXXXXXXXX 93
           SEV IAAQS+D E+++VK+LKR+SIGS+DLLMDPE+                        
Sbjct: 6   SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEM------------------------ 41

Query: 94  XHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTNHSS--ANHQSTPNVKPTSPQI 151
             D+ P Y+ G     ++  +  D    +T   Y   T+++S     +  P  K   PQ 
Sbjct: 42  --DMLP-YNNGYRNSWSTQLEQGDKPLKSTR--YSDPTHYNSKIVRQERLP-FKQNQPQK 95

Query: 152 S------VKRTLTGVGS----LRRGGVNIPTRKLXXXXXXXXXXXXXXXX----ITKQLL 197
           S      V+ T    GS     RRG VN  +R+                     + + LL
Sbjct: 96  SDKEQTQVENTKKQPGSPKSLTRRGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLL 155

Query: 198 WVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLP--IDIT 255
           WV A QHP+VKPEN++ELVQD LHNIQ+D+         +E +KEN+   D++    +  
Sbjct: 156 WVRADQHPNVKPENYIELVQDALHNIQIDK--------TEEHDKENSDTLDKVSRYYNSN 207

Query: 256 RKRD----SLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRS 311
            KR      LVRRPS LRKSYTEF+E  +++  E S             S+     S   
Sbjct: 208 NKRSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQS-------------STNNNVDSTPH 254

Query: 312 SRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLD 371
           ++  +LKDITEEL +ISN AGLT++DA+TLARTLSMA   + +E +E  D  +R     +
Sbjct: 255 NKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMA---SVAEEDETDDLQER----PE 307

Query: 372 ADDVQNEYNKEDDNEFASNMLMKHGVVIPA-RSSLRRSKFNTYRVRSSGSTSSLDDEHHE 430
           A+D     ++ +D+ +AS ML+    +I +  S+L+RSK+ TY +R+             
Sbjct: 308 AEDDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDPT------ 360

Query: 431 SETKRKLSSGLENVTAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIYDHYRQPSVD 490
                        +   + +  QD+           I +SP SIND   IYDHYR+PS D
Sbjct: 361 -------------IPVSTESQHQDV-----------IEASPGSIND---IYDHYREPSGD 393

Query: 491 WEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGN-AKSSIEAQDMEQASSTVVR 549
           W   ++   E+++  K    D +++ +I       +  G+   S+ +  D+ +       
Sbjct: 394 WSSLIQVAPENENK-KRTDTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPA--- 449

Query: 550 EMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEI 609
             + KR+GW W     S +T+ + NV              SD H +ED    S       
Sbjct: 450 -HRKKRNGWLW-----SSKTSEKVNVT-------------SDKHENEDIVPES------- 483

Query: 610 QRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNLTRQMFEKKIANLFR 669
            R NHSKNRH P++             +  ++  +G           +   +KKI+N+FR
Sbjct: 484 -RFNHSKNRHEPLY-----------NHKIEIANTLGTLPEK------KNAIDKKISNIFR 525

Query: 670 RKGKKKLPDYGTS-------------RDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSES 716
           RK   +  +   S              DH    +++  +++  +   K     V++R+ S
Sbjct: 526 RKHHTRRANQENSLAGLKISQLQWRNNDHKEKAVEATNNTEENNGSEKVLAEAVEVRTHS 585

Query: 717 RVEE----HLRNSVSKDVVPDTAI---------VAGEVIPSKSKAED--------LPA-- 753
                   H++N    + V +T +         +  E+IP  SK ++         PA  
Sbjct: 586 SYTPQGNVHVKNEYQTNNVENTNVREIPTANNGIEKEIIPEVSKHQNHQQQKSTARPAHS 645

Query: 754 -------------------------------LQPAVSVTSTKSAHVPLASSVVIESVKEL 782
                                          LQPAV+VTSTK+        +VI++V   
Sbjct: 646 SKFRITEKQTQGQDQGQDQGQAHGSDIGGVSLQPAVNVTSTKN------QEIVIQNV--- 696

Query: 783 DGDDSQDVSMDQNAQTSIDISTETLSMKEQ-TSEVQTDVKQPADGPSHQPVPPRKLTFDD 841
                                T T S +E+ T   +T  K+P         PPRKLTF D
Sbjct: 697 -------------------TVTATPSQREEATDSSKTASKKPL-------YPPRKLTFAD 730

Query: 842 VKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKREL 901
           VK+ +++NAP++FTDSAFGFPLP LT STVIMFDHRLPI+VERAIYRLSHLKLS+ KR L
Sbjct: 731 VKKKDKANAPIEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRAL 790

Query: 902 RQQVVLSNFMYAYLNLVNHTLYMEQ 926
           R+QV+LSNFMY+YLNLVNHTLYMEQ
Sbjct: 791 REQVLLSNFMYSYLNLVNHTLYMEQ 815

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109W ZDS2 Protein that interacts with silencing
           proteins at the telomere involved in transcriptional
           silencing paralog of Zds1p
          Length = 1211

 Score =  363 bits (932), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 258/572 (45%), Positives = 322/572 (56%), Gaps = 108/572 (18%)

Query: 18  VRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV--NV 75
           +R+R S  ++ +EKRKSEV+IAAQS+DNEVQ+VK+LKRISIGS+D+L+DPELEYRV  N 
Sbjct: 44  LRERRSTNDTMKEKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRVSSNA 103

Query: 76  NSPNTRKX--------XXXXXXXXXXXHDVAPCYDKGEDEG---EASVSDGADDSFDTTG 124
                RK                      V   Y     EG   E+  S+ ++ SFD T 
Sbjct: 104 GKQENRKSWTSGVPARPAEEVENMQNRATVRYTYPSRAVEGEPDESFESELSEISFDVTN 163

Query: 125 ADYLQTTN-------HSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXX 177
           ++YL+  +         S N  +       S   S  R+++GVG+L+RG  NIP RK   
Sbjct: 164 SEYLEGLDPNDDSSIQKSENDTTDLRGSQKSQVSSSGRSISGVGTLKRGASNIPLRK--- 220

Query: 178 XXXXXXXXXXXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLD-EKKETTDNDN 236
                         +TK LLWVPA QHP+VKPEN+LELVQDTLHNI+L+  + E T ND 
Sbjct: 221 TSTSSDASSGSNGSLTKNLLWVPANQHPNVKPENYLELVQDTLHNIRLEGNEDEQTGNDM 280

Query: 237 DE--------SNKENA-KAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGS 287
           +         +NKEN  K Y  LP    RK +SLVR+PSRLRKSYTEF+E ++ + L+ S
Sbjct: 281 NTTTAKVEHGTNKENEDKGY--LP----RKNNSLVRKPSRLRKSYTEFDEEND-DYLDTS 333

Query: 288 VAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSM 347
               K S    E +S    SS  SSR VSL+DIT+EL KISNNAGLT SDAITLARTLSM
Sbjct: 334 GFSKKRSSEDVEDASNLTISSTNSSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSM 393

Query: 348 AGSFASSEVNEDYDTSKRNGIHLDADDVQNEYN-------KEDDNEFASNMLMKHGVVIP 400
           AGSF S E ++  + S+        DD+Q  YN       KEDD EFASNM MK+G VIP
Sbjct: 394 AGSFTSDEPDDIIENSRGT----QGDDLQY-YNEADAMEKKEDDAEFASNMFMKNGFVIP 448

Query: 401 ARSSLRRSKFNTYRVRSSGSTSSLDD---------EHH---------------------- 429
           ARSSLRRSKFNTYRVRS+ S  +LD+         +HH                      
Sbjct: 449 ARSSLRRSKFNTYRVRSA-SDENLDENKSINSGLSDHHGHTHSVLPSQTDYVPTPSSREE 507

Query: 430 -----ESETKRKLSSGLENVTAESSAS------QQDIYHSPS-------------IKGNG 465
                +S   R+L +  E    E SA+      QQD   +P              I  +G
Sbjct: 508 RSVDSKSSQDRRLENMKETPADEDSAASGAYVKQQDYLGTPGDQHSHGSKSPSQFIGEDG 567

Query: 466 SIMSSPSSINDFQDIYDHYRQPSVDWEKELKK 497
           S ++SPS+I+DFQDIYDHYRQ SVDWEKELKK
Sbjct: 568 SNLTSPSTISDFQDIYDHYRQSSVDWEKELKK 599

 Score =  228 bits (582), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 117/142 (82%), Gaps = 12/142 (8%)

Query: 830  QPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRL 889
            QP+P RKLTF DVKR ++ NAPM+FTDSAFGFPLPMLTVSTV+MFDHRLPINVERAIYRL
Sbjct: 1068 QPLPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPINVERAIYRL 1127

Query: 890  SHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQE------------NDLTTET 937
            SHLKLSDPKRELRQQV+LSNFMYAYLNLVNHTLYMEQVAQE            N  +T  
Sbjct: 1128 SHLKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQEGGQEIPTASKTTNAASTAH 1187

Query: 938  SGGTAFKTEHNSANGSICIPDM 959
            +G  ++ T+ N ANG+ICIPD+
Sbjct: 1188 TGSGSYTTDQNDANGAICIPDI 1209

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  283 bits (723), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 238/673 (35%), Positives = 346/673 (51%), Gaps = 125/673 (18%)

Query: 24  MTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKX 83
           +T SQR+KRKSEVLIAAQS+DNE+++VK+LKR+SIGS+DLL+DPEL+ +           
Sbjct: 18  VTASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFG--------- 68

Query: 84  XXXXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGA-DYLQTTNHSSA----NH 138
                               GE  G  S S  A +S  T G    +  T +S      N 
Sbjct: 69  --------------------GESNGRRSWSGTAYNSASTPGGTTRMNNTRYSDPTPLENL 108

Query: 139 QSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLW 198
               ++K  S     +    G     + GV+  +RKL                + K LLW
Sbjct: 109 HERGDLKLESSDKGRQSNYAGS----KKGVHSTSRKL------------NANALKKNLLW 152

Query: 199 VPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPID---IT 255
           VPA QHP+VKP+N+LELVQDTL NIQL+  ++  D+ N+ +    +K YD    D   + 
Sbjct: 153 VPANQHPNVKPDNYLELVQDTLQNIQLNGSEDNNDDQNNGNKNSGSKVYDNKENDTENLN 212

Query: 256 RKRD-----SLVRRPSRLRKSYTEFEEYDETESLEG-SVAVGKESRNSFERSSIAPCSSG 309
           R        SL+RRPS LR+SYTEF   D++E   G S  V K          +   +S 
Sbjct: 213 RAMSRHGTASLIRRPSTLRRSYTEF---DDSEDDNGDSKTVNK----------VEERTSR 259

Query: 310 RSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIH 369
              R VSL+DITEEL KISN+AGLT +DAITLARTLSMAGS+  S+  ++ + S + G H
Sbjct: 260 IKERPVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSY--SDKKDEAEPSNQEGHH 317

Query: 370 L--DADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLDDE 427
           +  D++ + ++    DD E+ASNM + + +  P RSSLRRS+FNTYR+R       ++++
Sbjct: 318 IEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERSSLRRSRFNTYRIRQQEQEKEVEED 377

Query: 428 H---HESETKRKLSSGLENVTAESSASQQDIYHSPSIKG--NGSIMSSPSSINDFQDIYD 482
                + ET+  L   L N T++++    D + SP  +       MSSP SI DFQDIYD
Sbjct: 378 KEKIKDYETEHHLP--LANNTSKTAI---DPHKSPFRQQAEEPESMSSPGSIGDFQDIYD 432

Query: 483 HYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDMEQ 542
           HYRQ S +WE+E+  G E +      + + ++ ++    +L +   G  KSS   ++ E 
Sbjct: 433 HYRQSSGEWEQEM--GIEKEAEVVATKFEIDSLEQ--DLELREEPVGVIKSSSTEENKET 488

Query: 543 ASSTVVREMKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTS 602
                  +   +R+GW+WLN   +++ + E N +D                 DE+ E   
Sbjct: 489 -------KRHRRRNGWTWLNNKMNRDDDNEGNQRD-----------------DENEENMD 524

Query: 603 TPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNLTRQMFEK 662
              +  ++R N SK  H+ +F  +E +++ +  E  + S            + TRQ  EK
Sbjct: 525 ---SQRMEREN-SKRHHISLFNGSEKAEQSNKEEANSASA-------PTTTSQTRQKIEK 573

Query: 663 KIANLFRRKGKKK 675
             ANLFRRK   K
Sbjct: 574 TFANLFRRKPHHK 586

 Score =  196 bits (498), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 138/218 (63%), Gaps = 39/218 (17%)

Query: 748 AEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSM--------------- 792
           +++LP LQPAVSV+STKS     +     E +K+ +   S  + +               
Sbjct: 701 SDNLPKLQPAVSVSSTKSN----SRDTGEEEIKKRNEKRSNTIELSNEQHRKYVQKEKTH 756

Query: 793 DQNA------QTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQP--------------V 832
           +Q A      Q       ++ S     + ++T ++ P++ PS  P              +
Sbjct: 757 EQKAPCRSPSQAPSQAPGQSPSQAPIETSIETPIETPSETPSEAPAKTQAAPPLRHTSVL 816

Query: 833 PPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHL 892
           PPRKLTF DVK+ ++ NAP++FTDSAFGFPLP+LTVSTVIMFDHRLPINVERAIYRLSHL
Sbjct: 817 PPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHL 876

Query: 893 KLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQE 930
           KLS+ KR LR+QV+LSNFMYAYLNLVNHTLYMEQVA +
Sbjct: 877 KLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHD 914

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  264 bits (675), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 239/683 (34%), Positives = 330/683 (48%), Gaps = 153/683 (22%)

Query: 27  SQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKXXXX 86
           SQR+KRKSEVLIAAQS+DNE+++VK+LKR+SIGS+DLL+DPEL+ +    S N R+    
Sbjct: 21  SQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGES-NGRRSWSG 79

Query: 87  XXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTNHSSANHQSTPNVKP 146
                    +V                              +  T +S        +V+ 
Sbjct: 80  ATSSSTSAPNVTRS---------------------------MNNTRYSDPTPLEKLHVQS 112

Query: 147 TSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAAQHPS 206
           ++   S +R   G  +  +  V+ P+RKL                +   LLWVPA QHP+
Sbjct: 113 STETESYERCRQGNYTGHKKVVHSPSRKL------------NANALKNNLLWVPANQHPN 160

Query: 207 VKPENFLELVQDTLHNIQLDEKKETTDNDNDE-----------SNKENAKAYDRLPIDIT 255
           VKP+N+LELVQDTL NI+L +  +  DN+++E            NKEN        +++ 
Sbjct: 161 VKPDNYLELVQDTLQNIRLGDNDDDNDNNDNEGDEAHGETESYGNKENLNV-----VNVN 215

Query: 256 R-----KRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGR 310
           R        SL+RRPS LR+SYTEF++       EG +  G +  +S   +     +S  
Sbjct: 216 RGMPRHGNASLIRRPSTLRRSYTEFDDS------EGDIGQGDD--DSMTVNKAKERTSRI 267

Query: 311 SSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHL 370
             R +SL+DITEEL KISN+AGLT  DAITLARTL+MAGS++        + S+      
Sbjct: 268 RERPISLRDITEELTKISNSAGLTDDDAITLARTLNMAGSYSDKGDGPRSEDSRVGYEEE 327

Query: 371 DADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGSTSSLDDEHHE 430
           +A    ++    DD E+ASNM + +    P RSSL+RS+FNTYR+RS   T   ++E   
Sbjct: 328 NAKVTGSQTETPDDVEYASNMPINNDSTGPERSSLKRSRFNTYRIRS--HTEEQEEEQVL 385

Query: 431 SETKRKLSSGL---ENV------TAESSASQQDIYHSPSIKGNGSIMSSPSSINDFQDIY 481
            ETK++  S L   EN       + +S   Q+D    P        +SSP SI DFQDIY
Sbjct: 386 EETKKEDVSRLHLAENTIEIGINSPKSPFRQEDDESDP--------VSSPGSIGDFQDIY 437

Query: 482 DHYRQPSVDWEKELKKGTESDDSNKGNQLDFETSKEIASSKLSDLSQGNAKSSIEAQDME 541
           DHY Q S DWEKE               +  E SK +   K+ D    NA    E +  E
Sbjct: 438 DHYTQSSGDWEKE---------------MGIEKSKALEGGKVED----NAVEQ-ELEPQE 477

Query: 542 QASSTVV-------REMK--GKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDS 592
           +++ TVV       +E K   +R+GW+WLN   +KE +  +N                D 
Sbjct: 478 ESTGTVVSGTTDDSKETKRHRRRNGWTWLNNKMNKEEDNGEN--------------QGDD 523

Query: 593 HIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPANE----SSKRKDTTEEPAVSTKMGRXX 648
             DED E      +  ++R N SK  H+ IF   E    SSK +      + ST      
Sbjct: 524 EGDEDVE------SQRMERDN-SKKHHISIFNGAEKTEASSKEEANNANASTSTSQ---- 572

Query: 649 XXXXXNLTRQMFEKKIANLFRRK 671
                  TRQ  EK  ANLFRRK
Sbjct: 573 -------TRQKIEKTFANLFRRK 588

 Score =  192 bits (489), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 122/186 (65%), Gaps = 3/186 (1%)

Query: 745 KSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSMDQNAQTSIDIST 804
           +S  E LP LQPA+SV+STKS           +  KE   +  +     ++ Q  +D   
Sbjct: 737 ESDTESLPKLQPAISVSSTKSNPRDCEEVDAKKKNKEKRSNTGKHA---KHVQKEMDHEQ 793

Query: 805 ETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLP 864
              +     +                 +PPRKLTF DVK+SE+ NAP++FTDSAFGFPLP
Sbjct: 794 RGQAAAAPVAPADPAAPPAPALRHTSVLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLP 853

Query: 865 MLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYM 924
           +LTVSTV+MFDHRLPINVERAIYRLSHLKLS+ KRELR+QV+LSNFMYAYLNLVNHTLYM
Sbjct: 854 LLTVSTVVMFDHRLPINVERAIYRLSHLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYM 913

Query: 925 EQVAQE 930
           EQ   +
Sbjct: 914 EQAGHD 919

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  254 bits (648), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 238/740 (32%), Positives = 365/740 (49%), Gaps = 134/740 (18%)

Query: 9   DANL-EEQNQVRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDP 67
           D NL E+Q+  R  +S   S  +KRKS VLIAA+S+D E++++K LKR SIGS+D+LMDP
Sbjct: 10  DTNLREQQSNDRLLSSNATSMDDKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDP 69

Query: 68  ELEYRV-NVNSPNTRKXXXXXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGAD 126
           ELEYRV N+N    ++             D+ P           +  D +DD       +
Sbjct: 70  ELEYRVSNIN----KQSTDTYSKRRSITSDLQPL---------DANDDFSDDPLGIKSTE 116

Query: 127 YLQTTNHSSANHQSTPNVKPTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXX 186
           +L ++   S+N     + K T      +R L+G  SL      IP               
Sbjct: 117 FLPSSVIRSSNPSGNRSDKYT------RRKLSGSRSLN----TIP---------DSMAYN 157

Query: 187 XXXXXITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDND---ESNKEN 243
                  K LLWVPA +HP+V P+N+++++Q++L+N+ L E  E  D D+    + NKEN
Sbjct: 158 SKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNNLSL-ESNEDVDKDSKVLPQENKEN 216

Query: 244 A-KAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSS 302
             +  +RL +   R+  SLVRRPS+LRKSYTEF   D+ E       + K ++++ E S+
Sbjct: 217 IYEDRERLSVAYKRRNRSLVRRPSQLRKSYTEFNNSDDEEDNTDENNLSKNNKDTNENSA 276

Query: 303 IAPCSSGRSSR-------TVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSE 355
                S ++S+       ++SLKDIT EL KISN+ GL+ SDA++LAR+LS+ G +    
Sbjct: 277 NTSMDSIKTSKSFDNKRYSISLKDITAELTKISNSVGLSDSDAVSLARSLSITGPYQ--- 333

Query: 356 VNEDYDTSKRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRV 415
             ++ ++     I LD    +   N    +EF SNM++++G++IP RSSLRRSKF TYR 
Sbjct: 334 --DETESDGAGDIMLDNPSDEESLN----DEFVSNMVLRNGLMIPTRSSLRRSKFTTYRS 387

Query: 416 RSSGSTS------SLDDEHHESETKRKLSSG--------LENVTAESSASQQDIYHSPSI 461
           R+S S S      + DD+   S +  K +          L  V  ++  S +D       
Sbjct: 388 RTSSSDSLSPKKQNFDDKQETSVSSSKANENEIKNPFGKLPEVNLKAEESNED------- 440

Query: 462 KGNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKK--GTESDDSNKGN---------QL 510
             + S+ +SP++ +DFQDIYDHYRQPS DW+ E KK   T   DS+  N         +L
Sbjct: 441 --DESLKTSPAA-SDFQDIYDHYRQPSSDWDMEFKKHDDTSFTDSSITNSYSYTSSVQKL 497

Query: 511 DFETSKEIA-----------------SSKLSDLS------QGNAKSSIEAQDME--QASS 545
           D E S EI                  S K  +L          + +SI  + +E  + S 
Sbjct: 498 DTEPSDEIEDQNNDFSYEIDSYEVPDSDKFDNLDGTENSLNNKSSTSINKEHIETSKPSE 557

Query: 546 TVVREMK-----GKRSGWSWL---NGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDE- 596
            + +E +      +++ W W    +G   ++ +TE   + + +    +     + ++ E 
Sbjct: 558 LLAKENEPEKHHSRKAAWPWFSKRHGESHEKNHTEHENEPSKQSFEGMQSFVVNGNVQEA 617

Query: 597 -DFEKTSTPVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNL 655
            D +K  +  ++  +R   SKNRH+ IF   ES   + T EE     K          N 
Sbjct: 618 DDAKKIGSRDSSNNRRRT-SKNRHIQIFKPFES---QSTGEE-----KNDSGESNQSSNN 668

Query: 656 TRQMFEKKIANLFRRKGKKK 675
            +Q FEK   +LF+RKG +K
Sbjct: 669 IKQKFEKTFGDLFKRKGSRK 688

 Score =  182 bits (462), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 98/125 (78%), Gaps = 3/125 (2%)

Query: 832  VPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSH 891
            +PPRKL F DV +S+  N P++FTDSAFGFPLP+LT+STVIMFDHRLP+NVERAIYRLSH
Sbjct: 930  LPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRLSH 989

Query: 892  LKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFKTEHNSAN 951
            LKLS+PKR LR QV+LSNFMYAYL+LVNHTLYMEQ  Q   L T T   T      +S N
Sbjct: 990  LKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQHEQ---LPTSTMNQTNIAMMTDSVN 1046

Query: 952  GSICI 956
             +I +
Sbjct: 1047 ENILV 1051

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  228 bits (581), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 177/497 (35%), Positives = 240/497 (48%), Gaps = 140/497 (28%)

Query: 551  MKGKRSGWSWLNGMGSKETNTEKNVKDTARQEVPLHREPSDSHIDEDFEKTSTPVTTEIQ 610
            +  KR+GW W +     E+NTE                                ++   Q
Sbjct: 719  LFSKRNGWHWSSQKNPIESNTE--------------------------------LSQANQ 746

Query: 611  RSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRXXXXXXXNLTRQMFEKKIANLFRR 670
             + ++K+RHL  F  + S+  KD +   + +               ++ F+KK A LF+R
Sbjct: 747  TTTNNKSRHLQFF--SHSADLKDESTNSSTTDTDTSTLAQK-----KETFDKKFAKLFKR 799

Query: 671  KGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSK-TPVKLRSES------------- 716
            K  +               LK+K S+ +LSKF K +K +  +L S +             
Sbjct: 800  KSHEN-----------KNILKTKSSNSSLSKFRKHAKKSDTRLLSNTNKVGTSPPPPSSS 848

Query: 717  ------RVEEHLRNSVSKDVVPD------TAIVAGEVIPS-------------------- 744
                  R   H  NS    + P        + VA   IP+                    
Sbjct: 849  NITDPDRTMNHQSNSEKTSLTPTPKSKSLISKVAPVSIPTPTITISPSSDFVTQSEDIND 908

Query: 745  -KSKAEDL---PALQPAVSVTSTKSAHVPLASSV--------VIESVKELDGDDSQ---- 788
             ++K EDL   PALQPAVS +STK+      + +         +E+V+E++GDDSQ    
Sbjct: 909  ERNKNEDLFDLPALQPAVSFSSTKTTTSTSNNEIDSNKSSKEFVETVREIEGDDSQELSG 968

Query: 789  -DVSMDQN--------------AQTSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVP 833
             D+S + N               +   ++S E++  ++QT        QP        +P
Sbjct: 969  GDISYEDNNIKNQLQEDESVVSPEDHFELSQESIEAEDQTQSFNDSATQPLS--QQHGLP 1026

Query: 834  PRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLK 893
            PRKLTFDDVKR E+ NAP++FTDSAFGFPLP LTVSTVIMFDHRL INVERAIYRLSHLK
Sbjct: 1027 PRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIMFDHRLGINVERAIYRLSHLK 1086

Query: 894  LSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDL-TTETSGGTAFKTE------ 946
            LSD KRELR+QV+LSNFMYAYLNLVNHTLYMEQVAQ+  +   E +G  A   +      
Sbjct: 1087 LSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQQETIDNVEFTGDDANDHQMNMVTG 1146

Query: 947  ----HNSANGSICIPDM 959
                +N +NGSI IPD+
Sbjct: 1147 NGGIYNDSNGSILIPDI 1163

 Score =  219 bits (557), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 178/444 (40%), Positives = 238/444 (53%), Gaps = 87/444 (19%)

Query: 117 DDSFDTTGADYLQ---TTNHSSANHQS--TPNVKPTSPQISVKRTLTGVGSLRRGGVNIP 171
           +DS D T ++YL    T    + N  +  T N +P S Q S  R+++GVGSL+R G+N  
Sbjct: 164 EDSIDVTQSEYLHDEATLKKKTQNDMNIETSNDQPNSLQRSSHRSMSGVGSLKRNGLN-- 221

Query: 172 TRKL---------------------XXXXXXXXXXXXXXXXITKQ-LLWVPAAQHPSVKP 209
            RKL                                     +T Q LLWVPA QHP++KP
Sbjct: 222 RRKLPFLSSSYASTSSTSKQSILSSQSEKDPTFTSSSSSDNLTPQNLLWVPANQHPNIKP 281

Query: 210 ENFLELVQDTLHNIQLDEK-------KETTDND------NDESNKENAKA-YDRLP--ID 253
           E++LELVQDTLHNI LD+        K +TD+D       DE+NKEN    Y   P   +
Sbjct: 282 ESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETNKENLNIDYLTKPSTSE 341

Query: 254 ITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSS----------- 302
           + RK  SLVRRPS LRKSYTEFEE++ ++  + +    +E + S + S+           
Sbjct: 342 LRRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLSTDNSTNNANHHQDIII 401

Query: 303 -------IAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSE 355
                  I P  + RSSR VSLKDITEEL KISNNAGLT SDAITLARTLSMAGSF  + 
Sbjct: 402 NNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAITLARTLSMAGSFQDNS 461

Query: 356 VNEDYDTS---KRNGIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNT 412
            N     +   ++NG            N  +D+E+ASNM MK+G+ IP RSSLRRS+FNT
Sbjct: 462 NNNHNSDNFNEEQNG------------NTPEDDEYASNMFMKNGLTIPTRSSLRRSRFNT 509

Query: 413 YRVR-SSGSTSSLDDEHHESETKRKLSSGLENVTAESSASQ-QDIYHSPS--IKGNGSIM 468
           YR+R  S STS+       + +  ++++  + VT     +Q +D  ++P+       S M
Sbjct: 510 YRIRSGSSSTSAQSSSSSRTTSGSQMTNNNKTVTEPGRGNQPEDHNNTPASHYTARLSYM 569

Query: 469 S--SPSSINDFQDIYDHYRQPSVD 490
           S  SP SI+   D+YDHY+    D
Sbjct: 570 STTSPGSIS---DLYDHYQNSDSD 590

 Score = 75.9 bits (185), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 50/56 (89%)

Query: 18 VRQRTSMTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73
          +    S+ ++++EKRKS++ IAA+S+DNE+Q+V++LKR+SIGS+DLL+DPELE+RV
Sbjct: 24 INNAASIQQARKEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFRV 79

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
            [3006 nt, 1002 aa]
          Length = 1001

 Score =  226 bits (576), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 170/462 (36%), Positives = 226/462 (48%), Gaps = 119/462 (25%)

Query: 594  IDEDFEKTSTPVTTEIQ-----RSNHSKNRHLPIFPANESSKRKDTTEEPAVSTK----- 643
            I+ DF  T+    T+ Q     RSNH+KNRH PI    E+ K K  T    +  K     
Sbjct: 563  INSDFLNTAFAERTKSQKVLANRSNHTKNRHSPIITKIENKKGKKNTSTSNLDDKERLPD 622

Query: 644  ---------------------------MGRXXXXXXXNLTRQMFEKKIANLFRRKGKKKL 676
                                                    ++ FEKK+ NLFRRKG  K 
Sbjct: 623  SNSKSSVSSNGNVSDSSDNHKIENSNSSSNDNEPSIQEHKKERFEKKLVNLFRRKGNSKS 682

Query: 677  PDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEEHLRNSVS--------- 727
            P          A+ K  R S N     K+S T ++LR  S  +E L NS S         
Sbjct: 683  P----------AKDKLTRKSQNHVIKKKSSLTNIRLRIGSYKQEELSNSKSTKPSEEAQE 732

Query: 728  -----------KDVVPDTAIVAG--------EVI---PSKSKAEDLPA------LQPAVS 759
                       ++ + D  I+          E I      ++ ED  A      LQPA++
Sbjct: 733  KPEGNQDYEQAEEEIKDVGIINSTTEDVCQEEPIDDPADDTEEEDYDANESATQLQPALN 792

Query: 760  VTSTKSAHVPLASSVVIESVKELDGD-DSQDVSMDQNAQTSIDISTETLSMKEQTSEVQT 818
            V  T +       + ++ESV ELD D DSQD S          I TE++++++ T   + 
Sbjct: 793  VVRTAN------DNCIVESVNELDDDEDSQDFSNGS-------IYTESIALQKNTYATKD 839

Query: 819  DVKQPADGPSHQP---VPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFD 875
               Q  D  +  P   +PPRKLTF+DV+R ++ N  M FTDSAFGFPLP+LTVSTVIMFD
Sbjct: 840  VTIQNNDLANQAPPTILPPRKLTFEDVERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFD 899

Query: 876  HRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQE----- 930
            HRLP+NVERAIYRLSHLKLSD +R LR+QV+LSNFMYAYL+LVNH+LYMEQV +E     
Sbjct: 900  HRLPVNVERAIYRLSHLKLSDSRRSLREQVLLSNFMYAYLHLVNHSLYMEQVEEESMDAS 959

Query: 931  ----NDLTTETS---------GGTAFKTEHNSANGSICIPDM 959
                ++   ET+            +++T  N A+G+I IPD+
Sbjct: 960  YSDMDNSEIETAIADNDPNKWNSNSYRTNQNDAHGAISIPDL 1001

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  202 bits (514), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 142/225 (63%), Gaps = 28/225 (12%)

Query: 734 TAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSMD 793
           + I  G+ + S S  E L  LQPAV+V+STKS       +   +  K+  GD        
Sbjct: 689 SGIEVGKEVESDS--EGLLQLQPAVNVSSTKSNRRDTEEAETRKQNKKKRGD-------- 738

Query: 794 QNAQTSIDISTETLS-------MKEQTSEVQTDVKQPADGPSHQPV------PPRKLTFD 840
                +ID+  E L+         E+ ++VQT+       P   P+      PPRKLTF 
Sbjct: 739 -----TIDLPNERLTKDVQKEKAHERKAQVQTEAPVQVQAPVAPPLRHTSVLPPRKLTFA 793

Query: 841 DVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRE 900
           DVK+ E+ NAP++F+DSAFGFPLP+LTVSTVIMFDHRLPINVERAIYRLSHLKLS+ KR 
Sbjct: 794 DVKKPEKPNAPVQFSDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSKRG 853

Query: 901 LRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSGGTAFKT 945
           LR+QV+LSNFMYAYLNLVNHTLYMEQ AQ+ +      G +A  T
Sbjct: 854 LREQVLLSNFMYAYLNLVNHTLYMEQAAQDKEQQQHREGFSAQHT 898

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  195 bits (495), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 184/320 (57%), Gaps = 52/320 (16%)

Query: 657 RQMFEKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSES 716
           ++  +KKI+NLF+RK  KK  +          E       DN             + SES
Sbjct: 543 KERLDKKISNLFKRKKGKKTDNV--------LEADVPLEKDNCYDI---------ISSES 585

Query: 717 RVEEHLRNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPL-ASSVV 775
             +E + N + +   P+ +I  G +I   + A+D       + V S +S +     S  V
Sbjct: 586 --QEEIGNVIPRTTSPE-SIRGGSLISFTNSADD-------IDVKSYQSDNQQRRLSDEV 635

Query: 776 IESVKELDGDDSQ----DVSMDQN------AQTSIDISTETLSMKEQTSEVQTDVKQPAD 825
           +E V+EL+ D  +    D+  D N       + SID S E++S+  Q+  + TD  +P  
Sbjct: 636 VEYVQELEEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSIN-QSYSLHTD--EP-- 690

Query: 826 GPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERA 885
              ++   P+KLTFDDVK+ E++NAPM+FTDSAFGFPLP LT+STVIM DHRL INVERA
Sbjct: 691 ---NKVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERA 747

Query: 886 IYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSG------ 939
           IYRLSHLKLS+  RELRQQV+LSNFMYAYLNLV HTL +E+  Q+   T+          
Sbjct: 748 IYRLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQSTSSPDNKVVELE 807

Query: 940 GTAFKTEHNSANGSICIPDM 959
           G+ + T HN ++G+I IP++
Sbjct: 808 GSNYNTAHNQSDGTILIPEL 827

 Score =  167 bits (422), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 150/410 (36%), Positives = 204/410 (49%), Gaps = 83/410 (20%)

Query: 34  SEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPNTRKXXXXXXXXXXX 93
           SE L AAQS+D EVQNVK+LKR+SIGSIDL+ DPEL    NV    T +           
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPEL----NVTVTGTEREDTSYDA---- 72

Query: 94  XHDVAPCYDKGEDEGEASVSDGAD-----DSFDTTGADYLQTTNHSSANHQSTP------ 142
             D++      ED+    + DG+D      S D T  +YL + +++  +   +P      
Sbjct: 73  --DLSNGSFTEEDDTTTEI-DGSDADETSASIDRTRVEYLTSYDNTQESSNESPKGVART 129

Query: 143 -----NVKPTS-PQISVK-RTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQ 195
                N    S   IS+K RTL G  SL     N+   K                 ++ +
Sbjct: 130 RSLNLNYHANSNSDISIKERTLRGSRSLS----NLKKPK------------NEEQSVSDK 173

Query: 196 LLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDE--------SNKENAKAY 247
           L WVPA QHP+VKPEN+LELV++TL+ I    +   TD             SNKEN    
Sbjct: 174 LFWVPANQHPNVKPENYLELVKETLNKI----RDINTDGKEKSENNSEEEVSNKENINEN 229

Query: 248 DRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCS 307
            RL       R S+VRRPS+LRKSYTEF   D  E L+ +++  +          I    
Sbjct: 230 GRL-------RGSIVRRPSKLRKSYTEFSSED-LELLDKALSNNR----------IISTR 271

Query: 308 SGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNG 367
           +  +S+ +SLK+IT EL K SN AGLT  +A+TLARTLS+A S  +   NE     + N 
Sbjct: 272 NTTNSKRLSLKEITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQ--NETGRNDQSNT 329

Query: 368 IHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRS 417
                 + Q +    DD+ FA+ ++     +    SSLRRSKFNTYRV++
Sbjct: 330 ------EQQKQSEDADDDTFATAVVGNSHSLASNTSSLRRSKFNTYRVKA 373

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  193 bits (491), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/215 (49%), Positives = 138/215 (64%), Gaps = 29/215 (13%)

Query: 745 KSKAEDLPALQPAVSVTSTKS------------AHVPLASSVVIESVK-----ELDGDDS 787
           +S +E LP LQPAVSV+STKS             +   +++  I + +     + +  D 
Sbjct: 690 ESDSESLPQLQPAVSVSSTKSNSRDREEEEAKKKNKKRSNTTEISNQQHSKHVQKENTDE 749

Query: 788 QDVSMDQNAQTSIDIST--ETLSMKEQTSEVQTDVKQPADGPSHQP----------VPPR 835
           Q   +   AQ  +  S   +  +  + ++ VQT     A   +  P          +PPR
Sbjct: 750 QKAQLQAPAQEQVQTSVPVQASAPVQNSAPVQTSAPVEASAQTQAPAAPPLKHTSILPPR 809

Query: 836 KLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLS 895
           KLTF DVK+ ++ N+P++FTDSAFGFPLP+LTVSTVIMFDHRLPINVERAIYRLSHLKLS
Sbjct: 810 KLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLS 869

Query: 896 DPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQE 930
           + KR LR+QV+LSNFMYAYLNLVNHTLYMEQVA +
Sbjct: 870 NSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVAHD 904

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  185 bits (469), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 94/106 (88%)

Query: 832 VPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSH 891
           +PPR+LTFDDV R E+ N+PMKFT SAFGFPLP LT+STVIMFDHRLPI  ERAIYRLSH
Sbjct: 791 LPPRELTFDDVIRPEKPNSPMKFTPSAFGFPLPPLTISTVIMFDHRLPIYAERAIYRLSH 850

Query: 892 LKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTET 937
           LKLSDPKRELRQQV+LSNFMY+YLNLVNH+LY++Q+ +E ++   T
Sbjct: 851 LKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEEKNMGMNT 896

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  175 bits (444), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 1/108 (0%)

Query: 829  HQPVP-PRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIY 887
            HQP   P KL+F DVKR ++ N  M FTDSAFGFPLP+LT STVIMFD+RLPI+VERAIY
Sbjct: 962  HQPTDIPHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIY 1021

Query: 888  RLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTT 935
            RLSHLKLS+PKR LRQQV+LSNFMYAYL+LVNHTLYME+ A+ +D+ +
Sbjct: 1022 RLSHLKLSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEKYAKSHDMNS 1069

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 144/255 (56%), Gaps = 38/255 (14%)

Query: 192 ITKQLLWVPAAQHPSVKPENFLE-------LVQDTLHNIQLDEKKETTDNDNDESNKENA 244
           I+K LLWVPA+QHP+ KP+N  +       LVQD+  N  LD ++E   N          
Sbjct: 155 ISKNLLWVPASQHPNAKPKNINQDSLLNNGLVQDS--NSDLDTQEELQRN---------- 202

Query: 245 KAYDRLPIDITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERS-SI 303
           K+Y    ++  RK +SLVR+PS LRKSYT+F + D   +          SRN+ +   + 
Sbjct: 203 KSY----LNSRRKNNSLVRKPSTLRKSYTDFTDDDSDYNRSREANTSNNSRNTSDNEMNN 258

Query: 304 APCSSGRS---SRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDY 360
              S G S     T SL DI EEL+KISN+AGLT ++A TLAR+LS+ G + + E+ E+ 
Sbjct: 259 LKASHGNSPSADSTFSLNDIKEELSKISNSAGLTETNAATLARSLSITGKYINRELLEED 318

Query: 361 DTSKRNGIHLDADDVQNEYN-----------KEDDNEFASNMLMKHGVVIPARSSLRRSK 409
           D +  +  + DA+D+                 E D EFAS++L+   V +P RSSLRR K
Sbjct: 319 DEASTSDDNNDANDINTSIEDKSTLKQIPDLNEVDGEFASHILLTKNVNVPVRSSLRRKK 378

Query: 410 FNTYRVRSSGSTSSL 424
           FNTYRVRSS +TS L
Sbjct: 379 FNTYRVRSSSTTSHL 393

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/45 (68%), Positives = 38/45 (84%)

Query: 32 RKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVN 76
          R+ E+LIAAQ++D EVQ+VK LKR SIGS DL+ DPELE+RVN N
Sbjct: 36 REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEFRVNTN 80

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 51/126 (40%), Gaps = 33/126 (26%)

Query: 476 DFQDIYDHYRQPSVDWE---KELKKGTESDDSNKGNQLDFETS----------------- 515
           D QDIY+HYRQPS D E   K LK     + ++K  + DF  S                 
Sbjct: 505 DIQDIYNHYRQPSSDDEEILKYLKSKDNEETTHKEVETDFSHSSGSQESINISSSPSPET 564

Query: 516 ------KEIASSKLSDLSQGNA---KSSIEAQDMEQASSTVVREMKGKRSGWSWLNGMGS 566
                   IA    + +S  N    KS+I   D +  S    R  K KR GWSW++    
Sbjct: 565 IVTVPDNSIAGLNTNAISNSNISTLKSTISNIDSKLQS----RRHKHKRHGWSWVSNQEE 620

Query: 567 KETNTE 572
             +N E
Sbjct: 621 YSSNLE 626

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/112 (68%), Positives = 95/112 (84%), Gaps = 3/112 (2%)

Query: 818 TDVKQPADGPSHQP---VPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMF 874
           T +++P +  ++Q    +PPRKLTFDDVK+ E+ N PM++TDSAFGFPLP+LTVSTVIM+
Sbjct: 699 TSIQKPTNMANYQHKSILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMY 758

Query: 875 DHRLPINVERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQ 926
           D RL  NVERAIYRLSHLKL + KR LR+QV++SNFMYAYLNLVNHTL+MEQ
Sbjct: 759 DCRLATNVERAIYRLSHLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 171/395 (43%), Gaps = 86/395 (21%)

Query: 28  QREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRVNVNSPN--TRKXXX 85
           Q+E+R S + +AAQS+ +EVQNV  LKR+S+GSID+L D ++E+  N    N   +K   
Sbjct: 7   QKEQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFSFNKLQRNISAKKTQE 66

Query: 86  XXXXXXXXXHDVAPCYDKGEDEGEASVSDGADDSFDTTGADYLQTTNHSSANHQSTPNVK 145
                       +  Y+    EG     D  D+S  TT              + S    +
Sbjct: 67  ILSQKRTSTETESVSYNTLL-EGFYGSDDAEDESEKTT-------------RNTSISETR 112

Query: 146 PTSPQISVKRTLTGVGSLRRGGVNIPTRKLXXXXXXXXXXXXXXXXITKQLLWVPAAQHP 205
             SP +  +     VG++ R                          I+K LLWV A  HP
Sbjct: 113 DKSPSVPARARGRKVGAVSR----------SSRTANLGKKGGYDKEISKGLLWVSADVHP 162

Query: 206 SVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPIDI--------TRK 257
           +VKPEN++ELVQDTL                ++ N  +    +RLP D          +K
Sbjct: 163 NVKPENYIELVQDTL----------------EQYNSSDYSISERLPEDKQVLLSAFRAKK 206

Query: 258 RDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRSS--RTV 315
             SLVR+PS+LRKSY   E  +              + N+   +   P  S R     T+
Sbjct: 207 SHSLVRKPSKLRKSYISIESNNT------------PAENNDANAHRKPLGSSRDPVVSTI 254

Query: 316 SLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRNGIHLDADDV 375
           SLK+++EEL KIS++AGLT  DAITLA TL +  S                   L +D+V
Sbjct: 255 SLKELSEELAKISSSAGLTKDDAITLATTLWLTHSL------------------LHSDNV 296

Query: 376 QNEYNKED----DNEFASNMLMKHGVVIPARSSLR 406
               + +D     N FA++      + IP RS LR
Sbjct: 297 TTIKSSQDIDGYINSFATSFSRSGPLEIPKRSVLR 331

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  172 bits (435), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 95/118 (80%)

Query: 822  QPADGPSHQPVPPRKLTFDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPIN 881
            + A+G   +P    KLTF DVKR+ Q N+ M F +SAFGFPLP LT ST+IM D+RLPIN
Sbjct: 1416 ESAEGTEREPEVNYKLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPIN 1475

Query: 882  VERAIYRLSHLKLSDPKRELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSG 939
            VERAIYRLSHLKLSDPKRELR+QV+LSNFMY+YL+LVNHTLY+EQV Q N    ET+G
Sbjct: 1476 VERAIYRLSHLKLSDPKRELREQVLLSNFMYSYLHLVNHTLYLEQVTQGNGDGEETTG 1533

 Score =  110 bits (276), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 175/355 (49%), Gaps = 51/355 (14%)

Query: 196 LLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNK--ENAKAYDRLPID 253
           L W    +  S+KP+N++ELV D    I        T N    +NK  +    YD +P  
Sbjct: 368 LSWSSVNKRSSLKPDNYIELVNDA---INSSNNVSVTTNSTPTANKIEQGDSYYDNIPDS 424

Query: 254 --ITRKRDSLVRRPSRLRKSYTEFE----EYDETESLEG-SVAVGKESRNSFERSSI--- 303
             +  +R+S VRRPS LR SYT+ +    +Y++  ++   S ++ + S N  + +     
Sbjct: 425 RKVKYRRNSNVRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNNDHQLTPDDSF 484

Query: 304 ---APCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDY 360
              A  ++   +  ++LKD+T+EL K+SNNAGLT SDAITLA+TLS+      +    + 
Sbjct: 485 NFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERLLDNTTTVNS 544

Query: 361 DTS----KRNGIHL---------DADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRR 407
           +T+    K N I+L           +  Q+E   EDD E+ASN+     + I  RS+L+R
Sbjct: 545 NTNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNINISNRSTLKR 604

Query: 408 SKFNTYRVRSSGSTSSLDDEHHESET-KRKLSSGLENV-----------TAESSASQQDI 455
           +KF +   R  G++S   +   + ET KR  S+ + N+           + +++ S    
Sbjct: 605 NKFKSATSR--GNSSEESNLQLDLETIKRDPSNNMPNIIISKSTIDVNDSIDNAESNNKK 662

Query: 456 YHSPSIKGNGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKKGTESD--DSNKGN 508
           +   +   N  +  SPS+     +IYDHYRQ S DW  +L K  E    D N GN
Sbjct: 663 FLDSNEMLNNQLNVSPSA----SEIYDHYRQTSGDWTDDLNKAREQFQVDPNGGN 713

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%)

Query: 29 REKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73
          R+KR S+V IAAQS+D +VQNVK LKR SIGSIDLL DP+LE  V
Sbjct: 32 RQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLELVV 76

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  162 bits (410), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 135/226 (59%), Gaps = 20/226 (8%)

Query: 733  DTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKELDGDDSQDVSM 792
            D++++      ++S+   L  LQPA+++ +T+    P   +V   +     G +S ++  
Sbjct: 835  DSSVLDASGPLTESRNTPLNGLQPAITIKTTRQPD-PHTHAVAPRAETPPSGKNSANLPT 893

Query: 793  DQNAQ--------TSIDISTETLSMKEQTSEVQTDVKQPADGPSHQPVPPRKLTFDDVKR 844
                Q        TS  +S +T     +  +  T+   PA  P    +P RKLTF DV  
Sbjct: 894  KNGRQRRKTGAYSTSTRVS-KTPKRSSRGQQASTNGNGPA--PVTSTLPLRKLTFADVPP 950

Query: 845  SEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPKRELRQQ 904
            + ++N P++F DS FGFPLP+LT ST+IMF++RLPI+VERAIYRLSHLKL D K+ELRQQ
Sbjct: 951  TGRANGPVQFMDSTFGFPLPLLTRSTIIMFENRLPISVERAIYRLSHLKLGDTKKELRQQ 1010

Query: 905  VVLSNFMYAYLNLVNHTLYMEQV--------AQENDLTTETSGGTA 942
            V+LSNFMYAYL+LVNH+LY+EQ         A  + L  +TSG  A
Sbjct: 1011 VLLSNFMYAYLHLVNHSLYLEQYGLGADGSGAAPDSLAADTSGKDA 1056

 Score =  126 bits (317), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 132/392 (33%), Positives = 187/392 (47%), Gaps = 92/392 (23%)

Query: 193 TKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLPI 252
           T  + WV A QHP+V P   L  V   L N+ +++K+ T                DRL I
Sbjct: 145 TNAVKWVRADQHPNVSPSKQLNEV---LENLHIEDKQVTKK--------------DRLSI 187

Query: 253 DITRKRDSLVRRPSRLRKSYTE-----------FEEYDETESLEG--SVAVGKESRNSFE 299
              + + S+VRRPS+LR S  +           F +  +T S E   S +   ++  S  
Sbjct: 188 TYKKNKSSIVRRPSKLRHSSNDESFDSDIEDPSFTKDHDTFSFENESSFSTNDQTDISIT 247

Query: 300 R--SSIAPCSSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVN 357
           R  S     S+G S+  +SLK+IT+EL +ISN+AGL  SDAI LA++L +  S+ ++ +N
Sbjct: 248 RFDSRDTINSNGNSNHRLSLKNITDELTRISNDAGLVDSDAINLAQSLGLTSSYQNN-IN 306

Query: 358 EDYDTSKRNGIHLDADDVQNE------YNKED-----------DNEFASNMLMKHGVVIP 400
           + YD  K   I+   D   NE      +N++D              FA N     G+ +P
Sbjct: 307 DFYD-DKNLAIY---DSTINESSNMETFNEQDKILNLNSENSKGGTFAVN-----GMKVP 357

Query: 401 ARSSLRRSKFNTYRV-RSSGSTSSLDDE----------HHESETKRKLSS---GLEN--- 443
            RSSLRRSKFNTYR  R++   S + ++           H SE K  ++     L N   
Sbjct: 358 MRSSLRRSKFNTYRYSRNNQKDSDIPEKKEIENPYMGSQHISEEKSDVTEIQVALSNNQN 417

Query: 444 --VTAESSA-------SQQDIYHSP-SIKGNGSIMSSPSSINDFQDIYDHYRQPSVDWEK 493
             V+ E +        SQ+D    P   K +    S  S ++DFQDIYDHYRQPS +WE 
Sbjct: 418 ALVSPERNNDKISFKDSQKDYLTKPIEEKADADEQSGSSPVSDFQDIYDHYRQPSSEWED 477

Query: 494 EL---KKGTESDDSNKGNQLDFETSKEIASSK 522
           E+    K  ES  S  GN +      E+ASSK
Sbjct: 478 EIFNASKNPESSISLNGNLVAL---PELASSK 506

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (72%)

Query: 26 ESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73
          E+  E R   +L A Q +D E++NV  LKR SIGS+D+L+DPELEYR+
Sbjct: 8  ETNIESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRI 55

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 136/234 (58%), Gaps = 43/234 (18%)

Query: 192 ITKQLLWVPAAQHPSVKPENFLELVQDTLHNIQLDEKKETTDNDNDESNKENAKAYDRLP 251
           + + LLWV A QHP+VKPEN+LELVQ+TL N+ L  +  T       +N+  A++   L 
Sbjct: 188 LGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPT-------ANETQAQSLSGL- 239

Query: 252 IDITRKR-----DSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPC 306
               RKR     +SL RRPSRLR SYTE  E DE + +                ++ AP 
Sbjct: 240 -KTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPL-----------AAAAPT 287

Query: 307 SSGRSSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNEDYDTSKRN 366
            S R  RTVSLKDITEEL K+SN AGLT +DA+TLARTL +A          D  T+   
Sbjct: 288 MSSR--RTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVA----------DESTTDST 335

Query: 367 GIHLDADDVQNEYNKEDDNEFASNMLMKHGVVIPARSSLRRSKFNTYRVRSSGS 420
           G  L ++++ +E     + EFAS M  K G  +PAR SLRRSKFNTYR++SS S
Sbjct: 336 GQGL-SNNLADE-----EEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQSSSS 383

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%)

Query: 24 MTESQREKRKSEVLIAAQSIDNEVQNVKSLKRISIGSIDLLMDPELEYRV 73
          M  S+R+KRKSEVLIAAQS+D EV++VK+LKR+SIGS+DLLMDPELEYRV
Sbjct: 1  MPMSKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRV 50

>TPHA0O00240 Chr15 complement(32729..33787) [1059 bp, 352 aa] {ON}
           Anc_1.517 YJR068W
          Length = 352

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 14/108 (12%)

Query: 254 ITRKRDSLVRRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSS---IAPCSSGR 310
           +TR  D L  R S+ R     F+  DET +L+    V  +    +E  +   I   S+G 
Sbjct: 172 VTRIIDPLASRCSKFR-----FKALDETNALDRLKYVATQESTKYEEGTLEKILQISAGD 226

Query: 311 SSRTVSLKDITEELNKISNNAGLTSSDAITLARTLSMAGSFASSEVNE 358
             R ++L      L  +S ++    SD IT+ +   +AG    S +N+
Sbjct: 227 LRRAITL------LQSVSKSSTFNKSDMITIKKVEELAGVVPESIINQ 268

>Skud_14.8 Chr14 (9768..9905,9909..9914,9918..9926,9930..9998) [222
           bp, 74 aa] {ON} YMR273C (REAL)
          Length = 74

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 40/87 (45%), Gaps = 15/87 (17%)

Query: 263 RRPSRLRKSYTEFEEYDETESLEGSVAVGKESRNSFERSSIAPCSSGRSSRTVSLKDITE 322
           RR S LR SYTEF   D+ E   G      +  N  E          R+SR +   +  E
Sbjct: 1   RRSSTLRSSYTEF---DDIEDENGQRNKDSKFVNKVEE---------RTSR-IRENECHE 47

Query: 323 ELN--KISNNAGLTSSDAITLARTLSM 347
            L   KISN+A LT    I L RTLS+
Sbjct: 48  TLKNKKISNSASLTDIGVIALVRTLSI 74

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 704 KTSKTPVKLRSESRVEEHLRNSVSKDVVPDTAIVAGE-VIPSKSKAEDLPALQPAVSVTS 762
           KT   P+ ++S+     H  N V   ++  T ++ GE  +PS  K     ++  A+   +
Sbjct: 229 KTYDDPILIKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKH---ISMYNALGWQA 285

Query: 763 TKSAHVPLASSVVIESVKELDGDDSQDVSMDQNA 796
            K  H+PL +S+  + + +  GD S  +SM +N 
Sbjct: 286 PKYIHIPLLTSINDKKLSKRKGDSSI-LSMKKNG 318

>Suva_15.285 Chr15 complement(487395..489320) [1926 bp, 641 aa] {ON}
           YDR341C (REAL)
          Length = 641

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 70/313 (22%), Positives = 120/313 (38%), Gaps = 57/313 (18%)

Query: 351 FASSEVNEDYDTSKRNGIHLDADDVQNEYNKEDDNE----FASNMLM--KHGVVIPARSS 404
           F S  ++    T  R  I+ D    +++ +KE  +E    F  N L+  K G ++   + 
Sbjct: 303 FRSLSIHHYIQTYSRLNINFDIFSGESQVSKESMDEALRIFYQNHLVEEKDGALVIDLAQ 362

Query: 405 LRRSKFNTYRVRSSGSTSSLD-DEHHESETKRKLSSGLENVTAESSASQQDIYHSPSIKG 463
             ++       +S G+T  L  D     E K+ L     +      +SQQD+Y S     
Sbjct: 363 WSKNLGKAVVQKSDGTTLYLTRDVGAAMERKKNLQF---DKMVYVISSQQDLYMS----- 414

Query: 464 NGSIMSSPSSINDFQDIYDHYRQPSVDWEKELKK----GTESDDSNKGNQLDFETSKEIA 519
                           ++   ++ + DW K L        +   + KGN +  +T  + A
Sbjct: 415 ---------------QLFTILQKMNFDWAKNLNHVNFGMVQGMSTRKGNVVFLDTILDEA 459

Query: 520 SSKLSDLSQGNAKSSIEAQDMEQA------SSTVVREMKGKRSG---WSWLNGMGSKETN 570
             K   + + N     + +D  Q       S+ ++++MKGKR     + W N M S E +
Sbjct: 460 RDKAFQIMKNNQIKIAQVEDPHQVADLIGISAIIIQDMKGKRINNYEFDW-NRMLSFEGD 518

Query: 571 TEKNVKDTARQEVPLHRE----PSDSHIDEDFEKTSTPVTTEIQRSNHSKNRHLPIFPAN 626
           T   ++ T  +   L R      +D  +  DF     P   E+ R        L  +P  
Sbjct: 519 TGPYLQYTHSRLRSLERSSNNITTDMLVQADFSSLDEPQLVELVRL-------LAQYP-- 569

Query: 627 ESSKRKDTTEEPA 639
           +  KR   T+EPA
Sbjct: 570 DILKRAFKTQEPA 582

>CAGL0B02057g Chr2 complement(190333..191136) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q03898 Saccharomyces
           cerevisiae YDR130c FIN1
          Length = 267

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 286 GSVAVGKESRNSFERSSIAPCSSGRSSR-TVSLKDITEELNKISNNAGLTSS 336
           G+V  G+++RN F+R SI+P     + R +V  K  +    K SNNA LT++
Sbjct: 9   GNVVQGRDTRNVFDRLSISPQKRSSNKRDSVVWKPASRISPKKSNNAPLTTA 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.123    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,800,679
Number of extensions: 4448385
Number of successful extensions: 25159
Number of sequences better than 10.0: 722
Number of HSP's gapped: 26033
Number of HSP's successfully gapped: 891
Length of query: 959
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 840
Effective length of database: 39,836,145
Effective search space: 33462361800
Effective search space used: 33462361800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)