Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B006008.837ON36936917140.0
CAGL0M02937g8.837ON37338311731e-160
KAFR0B039008.837ON37938411351e-155
ZYRO0G14124g8.837ON36938011251e-153
SAKL0D01540g8.837ON36537511021e-150
Kwal_27.102758.837ON37938410731e-145
KLTH0C03938g8.837ON37639210501e-142
Kpol_1068.118.837ON38139210481e-141
Skud_13.4488.837ON36437810451e-141
TPHA0I002208.837ON37738010341e-139
NCAS0C004308.837ON36937810311e-139
Smik_13.4898.837ON37238010241e-138
Suva_13.4648.837ON3663779911e-133
YMR276W (DSK2)8.837ON3733819851e-132
ABL129W8.837ON3453709811e-132
NDAI0K004408.837ON4044089871e-132
Ecym_46088.837ON4064099801e-131
KLLA0D01859g8.837ON3713819591e-128
TBLA0D032308.837ON3753759451e-126
KNAG0J002908.837ON3673848561e-112
TBLA0B032408.837ON2842191742e-13
KLTH0G12540g8.311ON77771102e-06
CAGL0B01589g8.311ON77771083e-06
Kpol_1036.628.311ON77771084e-06
ZYRO0D05962g8.311ON77771075e-06
TPHA0C008908.311ON77771058e-06
SAKL0H15818g8.311ON77621032e-05
TDEL0F043808.311ON77771004e-05
KLLA0F17974g8.311ON77771004e-05
NDAI0J010708.311ON7777988e-05
Smik_12.184.16ON4601071089e-05
Ecym_35721.480ON4431091071e-04
KAFR0C030008.142ON397551071e-04
KLLA0A00616g5.701ON1281221001e-04
TPHA0E002405.701ON1281221001e-04
TPHA0D046005.701ON1281221001e-04
TBLA0E021105.701ON1281221001e-04
CAGL0G02475g5.701ON1281221001e-04
TDEL0G017504.16ON7777962e-04
Kpol_1043.695.701ON128122992e-04
ZYRO0G06622g5.701ON128122992e-04
Kwal_YGOB_Anc_5.7015.701ON128122992e-04
NDAI0H002704.16ON7777952e-04
NCAS0B035208.311ON7779952e-04
KLTH0E01078g5.701ON128122982e-04
AFR285C5.701ON128122982e-04
KNAG0L021205.701ON128122982e-04
Kwal_27.101521.480ON381461043e-04
KNAG0J028804.16ON153107993e-04
SAKL0E14894g5.701ON128122973e-04
Ecym_84084.16ON15386983e-04
TPHA0K022504.16ON153107984e-04
KNAG0C065805.701ON149107984e-04
Suva_10.34singletonON15186974e-04
KAFR0E005301.480ON379811024e-04
TDEL0B022005.701ON128122964e-04
AFR358W1.480ON413741024e-04
KAFR0D022305.701ON128122965e-04
KAFR0H002205.701ON128122965e-04
Suva_11.3305.701ON128122965e-04
Skud_11.3335.701ON128122965e-04
YIL148W (RPL40A)5.701ON128122965e-04
YKR094C (RPL40B)5.701ON128122965e-04
TBLA0G006704.16ON229107996e-04
NDAI0D049304.16ON229107996e-04
KAFR0I014704.16ON229107996e-04
Kwal_55.206074.16ON231107987e-04
Ecym_40195.701ON128122947e-04
Suva_10.33singletonON25486997e-04
KLTH0C03410g1.480ON391461007e-04
SAKL0H25784g4.16ON305107998e-04
Suva_10.32singletonON6262898e-04
Suva_9.405.701ON144107959e-04
Skud_12.294.16ON381107990.001
YLL039C (UBI4)4.16ON381107990.001
KLLA0E00749g4.16ON381107990.001
ACL062C4.16ON382107990.001
Suva_10.304.16ON381107990.001
Skud_9.205.701ON125107930.001
Smik_11.3575.701ON125107930.001
KLTH0E05852g4.16ON40986980.001
CAGL0D05082g4.16ON533107990.001
NCAS0C058504.16ON388107980.001
ZYRO0G07854g4.16ON460107990.001
Kpol_1070.64.16ON533107990.001
Skud_5.531.480ON39787980.001
Smik_9.215.701ON124107920.001
NDAI0E050305.701ON128122920.001
NCAS0A032105.701ON128122920.001
NCAS0G002405.701ON128122920.001
SAKL0D11814g1.480ON40094960.002
NDAI0G003301.480ON42763960.002
CAGL0L06028g8.142ON50538950.003
Suva_5.321.480ON40994940.004
YEL037C (RAD23)1.480ON39893940.004
NDAI0F003005.701ON187107900.006
Smik_5.561.480ON39793920.006
TPHA0C023908.386ON15071880.007
Ecym_41818.386ON15271880.007
NCAS0C029408.386ON15271870.010
KLTH0F08734g8.386ON15071870.010
ZYRO0C04026g8.386ON15271870.010
YDR139C (RUB1)8.311ON7777830.010
CAGL0L01309g1.480ON39286900.011
TPHA0O004401.480ON36977900.012
Kwal_23.33118.386ON15071860.012
AGL128W8.386ON15271860.013
SAKL0H13926g8.386ON15471860.013
NDAI0G022808.386ON15271860.013
KLLA0D18304g8.386ON15071860.015
KAFR0H020008.386ON15271860.015
CAGL0G08173g8.386ON15271860.015
YLR167W (RPS31)8.386ON15271850.016
TDEL0F051008.386ON15071850.017
KNAG0A027308.386ON15071840.023
TBLA0D022108.142ON56338880.025
KLLA0E22133g1.480ON38390870.028
Smik_7.918.142ON39938870.028
NDAI0B01850singletonON40344870.030
Kpol_1030.58.386ON15271830.031
Kpol_1024.168.386ON15271830.031
YGL181W (GTS1)8.142ON39638860.034
TBLA0H031808.386ON15271830.036
NCAS0B045908.142ON44738860.036
Suva_10.2668.386ON15271820.042
Skud_12.2348.386ON15271820.042
Smik_12.2298.386ON15271820.042
SAKL0H24772g8.142ON41443840.067
Suva_7.818.142ON40138830.083
ZYRO0F05192g1.480ON38463820.11
TDEL0B046908.142ON44238810.15
Skud_7.908.142ON39638780.35
NCAS0G041201.480ON39258770.42
KAFR0I027801.480ON21467760.44
ZYRO0D08140g6.343ON7370700.45
Kpol_370.61.480ON40464760.70
Skud_15.3556.97ON1150102760.75
Ecym_42448.311ON5034661.1
TBLA0B021601.480ON40462741.2
TDEL0C025901.480ON36858741.2
NCAS0C040908.142ON39655731.3
KLTH0E02178g5.617ON593102731.5
Kpol_1018.695.617ON59049695.6
SAKL0H26048g4.5ON55242685.7
Kpol_541.508.142ON51138677.8
TPHA0H004008.142ON46638678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00600
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   664   0.0  
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   456   e-160
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   441   e-155
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   437   e-153
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   429   e-150
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   417   e-145
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   409   e-142
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   408   e-141
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   407   e-141
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   402   e-139
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   401   e-139
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   399   e-138
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   386   e-133
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   384   e-132
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   382   e-132
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   384   e-132
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   382   e-131
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   374   e-128
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   368   e-126
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   334   e-112
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    72   2e-13
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    47   2e-06
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    46   3e-06
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    46   4e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    46   5e-06
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    45   8e-06
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    44   2e-05
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    43   4e-05
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    43   4e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    42   8e-05
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    46   9e-05
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    46   1e-04
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    46   1e-04
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    43   1e-04
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    43   1e-04
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    43   1e-04
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    43   1e-04
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    43   1e-04
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    42   2e-04
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    43   2e-04
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    43   2e-04
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    43   2e-04
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    41   2e-04
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    41   2e-04
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    42   2e-04
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    42   2e-04
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    42   2e-04
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    45   3e-04
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    43   3e-04
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    42   3e-04
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    42   3e-04
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    42   4e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    42   4e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    42   4e-04
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    44   4e-04
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    42   4e-04
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    44   4e-04
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    42   5e-04
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    42   5e-04
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    42   5e-04
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    42   5e-04
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    42   5e-04
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    42   5e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    43   6e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              43   6e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    43   6e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    42   7e-04
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    41   7e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    43   7e-04
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    43   7e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    43   8e-04
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    39   8e-04
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     41   9e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    43   0.001
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    43   0.001
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    43   0.001
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    43   0.001
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    43   0.001
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     40   0.001
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    40   0.001
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    42   0.001
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    43   0.001
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             42   0.001
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    43   0.001
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    43   0.001
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    42   0.001
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     40   0.001
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    40   0.001
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    40   0.001
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    40   0.001
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    42   0.002
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    42   0.002
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    41   0.003
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    41   0.004
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    41   0.004
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        39   0.006
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    40   0.006
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    39   0.007
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    39   0.007
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    38   0.010
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    38   0.010
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    38   0.010
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    37   0.010
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    39   0.011
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    39   0.012
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    38   0.012
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    38   0.013
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    38   0.013
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    38   0.013
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    38   0.015
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    38   0.015
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    38   0.015
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    37   0.016
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    37   0.017
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    37   0.023
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.025
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    38   0.028
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    38   0.028
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    38   0.030
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    37   0.031
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    37   0.031
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    38   0.034
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    37   0.036
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    38   0.036
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    36   0.042
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    36   0.042
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    36   0.042
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    37   0.067
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    37   0.083
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    36   0.11 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.15 
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    35   0.35 
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    34   0.42 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    34   0.44 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    32   0.45 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    34   0.70 
Skud_15.355 Chr15 (636562..640014) [3453 bp, 1150 aa] {ON} YOR18...    34   0.75 
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    30   1.1  
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    33   1.2  
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    33   1.2  
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     33   1.3  
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    33   1.5  
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    31   5.6  
SAKL0H26048g Chr8 complement(2292824..2294482) [1659 bp, 552 aa]...    31   5.7  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    30   7.8  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    30   8.0  

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/369 (90%), Positives = 334/369 (90%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
           KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180
           SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180

Query: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDXX 240
           NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGD  
Sbjct: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDST 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAADNQQNQPFD 300
                                            PGSNPLASMFGNQGVGAADNQQNQPFD
Sbjct: 241 TEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMFGNQGVGAADNQQNQPFD 300

Query: 301 PSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGA 360
           PSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGA
Sbjct: 301 PSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGA 360

Query: 361 LDSLLNGDV 369
           LDSLLNGDV
Sbjct: 361 LDSLLNGDV 369

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  456 bits (1173), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 240/383 (62%), Positives = 283/383 (73%), Gaps = 24/383 (6%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSIT+ +K GQ+KW+VS++P +T+   K+EIAKVSEIP+ NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
            I+D HAIH+VKSGG    + + A T++ ES+ ++  +  VPSNIASGQTGGFNPL+DLT
Sbjct: 61  NIKDDHAIHMVKSGGNA--STSNAPTNANESSNSS--TTAVPSNIASGQTGGFNPLADLT 116

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180
            ARYAG+ NLPSADMFGPDGG+ N P+QD+ML M+ENPIFQSQMNEMLSNP+M+DFMIQS
Sbjct: 117 GARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQS 176

Query: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAA----AASFPAP 236
           NPQLQAMGPQARQ+LQSPFFRQMLTNP M+RQSMQF+ MMN  GG   A    A++FPAP
Sbjct: 177 NPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFPAP 236

Query: 237 G----DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAAD 292
           G    +                                   P SNP A+M GN      +
Sbjct: 237 GGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAMMGNM-----N 291

Query: 293 NQQ-----NQP-FDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKN 346
           NQQ      QP FDP++LASLL GG     A++DNRPPEERYEQQLRQLNDMGFFDF++N
Sbjct: 292 NQQGGAGVQQPAFDPTLLASLL-GGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRN 350

Query: 347 VAALRRSGGSVQGALDSLLNGDV 369
           VAALRRSGGSVQGALD+LLNGDV
Sbjct: 351 VAALRRSGGSVQGALDALLNGDV 373

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  441 bits (1135), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 237/384 (61%), Positives = 280/384 (72%), Gaps = 20/384 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSIT+ +K GQ+KW+V+ N   ++A  K+EI+K+SEIPA NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQ----ESNTAAPGSATVPSNIASGQTGGFNPL 116
           KI++GH+IHLVKSGG     +A  +T+      E+  +AP   +VPSNIASGQTGGFNPL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAP---SVPSNIASGQTGGFNPL 117

Query: 117 SDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDF 176
           +DLTSARYAG+ N+PSADMFGPDGGL + P+QDDML ML+NP+FQSQMNEMLSNPQM+DF
Sbjct: 118 NDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDF 177

Query: 177 MIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAA-----A 231
           MIQSNPQLQAMGPQARQ+LQSP FRQML NP M+RQSMQF+ MMN  GGND AA     +
Sbjct: 178 MIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMN--GGNDPAATGNDPS 235

Query: 232 SFPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXPGS---NPLASMFGNQG 287
           +FPAPG+                                    P     NP A+ FG   
Sbjct: 236 AFPAPGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMS 295

Query: 288 VGAADNQQNQP-FDPSMLASLLGGGAAQQR-AEQDNRPPEERYEQQLRQLNDMGFFDFEK 345
                +Q  QP FDP++LAS+LG   +QQ  A+QDNRPPEERYE QLRQLNDMGFFDF++
Sbjct: 296 SNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDR 355

Query: 346 NVAALRRSGGSVQGALDSLLNGDV 369
           NVAALRRSGGSVQGALD+LLNGDV
Sbjct: 356 NVAALRRSGGSVQGALDALLNGDV 379

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  437 bits (1125), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 230/380 (60%), Positives = 277/380 (72%), Gaps = 25/380 (6%)

Query: 2   SITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYK 61
           +ITVQ+K GQ+KWEV+V+PE TV+ FK+EI+KVSEIPA++QRLIYSGKILKDDQ ++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IQDGHAIHLVKSGGGGGNTAAKASTSSQES------------NTAAPGSATVPSNIASGQ 109
           +QDGH++HLVKS    GN +  +S+++  +            N +   +   PSN+++GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 110 TGGFNPLSDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLS 169
           +GGFNPL+DLTSARYAGFT+LPSADMFGPDGG TNMPNQ+D+L ML+NPIFQSQMNEMLS
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 170 NPQMVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAA 229
           NPQMVDFMIQSNPQLQAMGPQARQ+ QSPFFRQMLTNPQM+RQSMQF+ MMNP GG + A
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242

Query: 230 AASFPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVG 289
           A +FPAPG+                                      NP A++ G  G  
Sbjct: 243 ANAFPAPGNENTEGESAAGANDGGNPAAAATNAGAPPA--------GNPFAALLGGGGPL 294

Query: 290 AADNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAA 349
                     DP +LAS+L G  +QQ+  QDNRPPEERYE QLRQLN+MGFFDF++NVAA
Sbjct: 295 QQPGGL----DPQLLASML-GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAA 349

Query: 350 LRRSGGSVQGALDSLLNGDV 369
           LRRSGGSVQGALDSLLNGDV
Sbjct: 350 LRRSGGSVQGALDSLLNGDV 369

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  429 bits (1102), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 233/375 (62%), Positives = 269/375 (71%), Gaps = 16/375 (4%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSIT+ +K GQ+KW+VS+ P  TV E K+ I+KVSEIP ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
           KI D HA+HLV+SGG     AA  S S+  ++T A  +A VPSNI+SGQTGGFNPL+DLT
Sbjct: 61  KIADDHAVHLVRSGGP--KPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLT 118

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180
            ARYAG+ NLPSADMFGPDGGLTN PN D++L ML+NPI QSQMNEMLSNPQMVDFMIQ 
Sbjct: 119 GARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQ 178

Query: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDXX 240
           NPQLQAMGP+AR+LLQS +FRQM+TNP M+RQSMQF+ M     G + A  +FPAPG   
Sbjct: 179 NPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFG-MEGAEGAGGAFPAPGTAT 237

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAAD---NQQNQ 297
                                              +NP AS+F  Q    A    N +  
Sbjct: 238 QTASTEGGPAGTTASPSTTGNGSANSE-------AANPFASLFNGQANPFASMFPNGRAP 290

Query: 298 PFDPSMLASLLGGGAA---QQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSG 354
            FDPS+L+S LGG  A   QQ+  QDNRPPEERYEQQLRQLNDMGFFDF++NVAALRRSG
Sbjct: 291 QFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSG 350

Query: 355 GSVQGALDSLLNGDV 369
           GSVQGALD+LLNGDV
Sbjct: 351 GSVQGALDALLNGDV 365

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  417 bits (1073), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 231/384 (60%), Positives = 272/384 (70%), Gaps = 20/384 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSITV VK GQSKW+VSV+ + TVA+FK  IA+ S+I   NQRLIYSGKILKDDQ +ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIQDGHAIHLVKSG--GGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSD 118
           KI DGHA+HLVKSG   G G   A  S S+  +NTA+ G+A  P++++SGQ GGFNPLSD
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 119 LTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178
           LTSARYAG+ NLPSAD FGPDGG+T+ PN DDML MLENP+ QSQMNEMLSNPQM+DF+I
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAA-SFPAPG 237
           Q +PQLQ+MGPQARQ+LQSPFFRQM+TNP+M+RQSMQFS ++  +G   AA A +FPAPG
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGANAFPAPG 240

Query: 238 DXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXPGSNPLASMFGNQGV 288
                                                          +NP  SM G Q  
Sbjct: 241 TADSDASAQPASTNTSTADAAQSATNANPFASLLAGQAAAPGGASAPANPFLSMLGQQAP 300

Query: 289 GAADNQQNQPFDPSMLASLLGGG---AAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEK 345
           GA        FDP+ML++LLGG    A+QQ   QD RPPEERYEQQLRQLNDMGFF+F++
Sbjct: 301 GAGGLPA---FDPAMLSALLGGAGNNASQQ--PQDTRPPEERYEQQLRQLNDMGFFEFDR 355

Query: 346 NVAALRRSGGSVQGALDSLLNGDV 369
           NVAALRRSGGSVQGALD+LLNGDV
Sbjct: 356 NVAALRRSGGSVQGALDALLNGDV 379

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  409 bits (1050), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 261/392 (66%), Gaps = 39/392 (9%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSITV +K GQ+KW+V+++P  T+A+FK  IA  SEI   NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGG-----GNTAAKASTSSQESNTAAPGSA---TVPSNIASGQTGG 112
           KI D H++HLVKSGG       G TAA +  ++    T+ P +    + P+N+++GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 113 FNPLSDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQ 172
           FNPLSDLTSARYAGF NLPSAD FGPDGG+T+ PN DD+L MLENP+ QSQMNEMLSNPQ
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 173 MVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAAS 232
           M+DF+IQ +PQLQ+MGPQAR LLQSPFFRQM+TNP M+RQSMQFSSM+          +S
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLG-GDSAAGGGSS 239

Query: 233 FPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAAD 292
           FPAPG                                      +NP AS+ G Q   +  
Sbjct: 240 FPAPGTPAEADAPSQPAANPSAAPSAGT---------------ANPFASLLGGQAGASGA 284

Query: 293 NQQNQPF---------------DPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLND 337
           +    PF               DP +L+S+LGG  A  +  QD RPPEERYE QLRQLND
Sbjct: 285 SPAANPFLSMLGGGSAGTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLND 344

Query: 338 MGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369
           MGFF+F++NVAALRRSGGSVQGALD+LLNGDV
Sbjct: 345 MGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  408 bits (1048), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 229/392 (58%), Positives = 269/392 (68%), Gaps = 34/392 (8%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I + +K GQ+KWEV+V+   TV + K+EIAKVSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGS-ATVPSNIASGQTGGFNPLSDL 119
           KIQD H+IHLVKSGG      + ++ ++  S      S A +PSNIA+GQ+GGFNPLSDL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 120 TSARYAGF-TNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178
           TSARYAG+  NLPSADMFGPDGG+ +MPNQDDML MLENP+FQSQMNEMLSNPQM+DFMI
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSG--GNDAAAASFPAP 236
           QSNPQLQAMGP+ARQ+ QSPFFRQMLTNP+M+RQSMQ ++MM  +G  G +AAA+SFPAP
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASSFPAP 240

Query: 237 GDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFG------------ 284
           G+                                      NP AS+F             
Sbjct: 241 GETDTTAAAETNTETTSTPAATGAAAAGQ----------QNPFASLFNPAMNPFAAMMNN 290

Query: 285 -------NQGVGAADNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLND 337
                      GAA       FDPS+ AS+      QQ+ EQDNRPPEERYE QLRQLND
Sbjct: 291 NAAAAAGAGATGAAGATGTPAFDPSLFASMF-QPPQQQQQEQDNRPPEERYESQLRQLND 349

Query: 338 MGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369
           MGFFDF++NVAALRRSGGSVQGALD+LL+ DV
Sbjct: 350 MGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  407 bits (1045), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 258/378 (68%), Gaps = 23/378 (6%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MS+ + +K GQ KWEV+V PE TV +FK+ I+K + IP ANQRLIYSGKILKDDQ V+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIQDGHAIHLVKS-----GGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNP 115
            IQDGH++HLVKS      GG        +TS+    +A P       N++SGQ+ GFNP
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATP-------NMSSGQSAGFNP 113

Query: 116 LSDLTSARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQM 173
           L+DLTSARYAG+ N+PSADMFGPDGG  N    NQD++L M+ENPIFQSQMNEMLSNPQM
Sbjct: 114 LADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQM 173

Query: 174 VDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASF 233
           +DFMIQSNPQLQAMGPQARQ+LQSP FRQMLTNP+M+RQSMQF+ MM+P+  N AA+A F
Sbjct: 174 LDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASA-F 232

Query: 234 PAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAADN 293
           PAPG                                    P  NP A+       G    
Sbjct: 233 PAPGGDASEEGANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFANAGNTAPTGMP-- 290

Query: 294 QQNQPFDPSMLASLLGGGAAQQRAEQ--DNRPPEERYEQQLRQLNDMGFFDFEKNVAALR 351
                FDP++LAS+     A  +A Q  D+RPPEERYE QLRQLNDMGFFDF++NVAALR
Sbjct: 291 ----AFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALR 346

Query: 352 RSGGSVQGALDSLLNGDV 369
           RSGGSVQGALDSLLNGDV
Sbjct: 347 RSGGSVQGALDSLLNGDV 364

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  402 bits (1034), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 262/380 (68%), Gaps = 14/380 (3%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSI+VQ+K GQ+KW+V+V P  T+ EFK+ I+K S+IPA NQRLIYSGKILKD + VESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIQDGHAIHLVKSG-GGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDL 119
           KIQDGH+IHLVKSG        +  + ++  +  A    + VP+NI SGQT GFNPL+DL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 120 TSARYAGFT-NLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178
           TSARYAG+   +PSADMFGPDGG+TNMPNQDDML MLENP+FQSQMNEMLSNPQMV++MI
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAA----ASFP 234
            SNPQLQA+GPQAR++ QSPFFRQMLTNP M+RQSM+ + MM   G          +SFP
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSSFP 240

Query: 235 APGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XPGSNPLASMFGNQG----VG 289
           APG+                                    PG NP A + GN       G
Sbjct: 241 APGETSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPFAGL-GNPAAAGSTG 299

Query: 290 AADNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAA 349
           A    Q   F+PSMLAS+L     +Q A++D RPPE RYE QLRQLNDMGFF+F++N+AA
Sbjct: 300 APGTPQYPGFNPSMLASML--QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAA 357

Query: 350 LRRSGGSVQGALDSLLNGDV 369
           LRRSGGSVQGALD+LLN DV
Sbjct: 358 LRRSGGSVQGALDALLNNDV 377

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  401 bits (1031), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 260/378 (68%), Gaps = 18/378 (4%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSI++ VK GQ+ W+VS++P  T+ + K+EIAKVSE+PA NQRLI+SGKILKDDQ VE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
           KI DG +IH+VKSGGG  N     S   Q + TA P    V  N+A+G+TGGFNPLSDLT
Sbjct: 61  KILDGLSIHMVKSGGGSANK--NKSPPPQANTTATP----VAPNMAAGETGGFNPLSDLT 114

Query: 121 SARYAGFTNLPSADMFGPDGGLTNM-PNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQ 179
           SARYAG+ NLPSAD FGPDGGL N  PNQD+ML ML+NP+FQSQMNEMLSNPQM+DF+IQ
Sbjct: 115 SARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQ 174

Query: 180 SNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMN----PSGGNDAAAAS-FP 234
           +NPQLQAMGPQARQ+LQ+P FRQMLTNP M+RQSMQ +  MN    P+G   A  +S FP
Sbjct: 175 ANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFP 234

Query: 235 APG---DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAA 291
           APG   D                                   P  NP A+   N     +
Sbjct: 235 APGGDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGMANTNAAGS 294

Query: 292 DNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALR 351
            N     FDPS  AS+    AAQQ+ E D RPPEERYE QLRQLNDMGFFDF++NVAALR
Sbjct: 295 GNP--PAFDPSFFASMFQPPAAQQQQE-DTRPPEERYEHQLRQLNDMGFFDFDRNVAALR 351

Query: 352 RSGGSVQGALDSLLNGDV 369
           RSGG+V+ AL++LLNGDV
Sbjct: 352 RSGGNVESALNALLNGDV 369

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  399 bits (1024), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 218/380 (57%), Positives = 258/380 (67%), Gaps = 19/380 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MS+ + +K GQ KWEVSV PE TV++FK+ I+K + +P ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
            IQDGH++HLVKS          A+ ++  + T A        N++SGQ+ GFNPL+DLT
Sbjct: 61  HIQDGHSVHLVKSQPKP--QPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLT 118

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178
           SARYAG+ N+PSADMFGPDGG  N    NQD++L M+ENPIFQSQMNEMLSNPQM+DFMI
Sbjct: 119 SARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMI 178

Query: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDA---AAASFPA 235
           QSNPQLQAMGPQARQ+LQSP FRQMLTNP M+RQSMQF+ MM+P+ G  +   AA++FPA
Sbjct: 179 QSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFPA 238

Query: 236 PG----DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAA 291
           PG    +                                   P  NP AS     G G  
Sbjct: 239 PGGDAPEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFASAGNATGTGMP 298

Query: 292 DNQQNQPFDPSMLASLLGGGAAQQRAEQ--DNRPPEERYEQQLRQLNDMGFFDFEKNVAA 349
                  FDP++LAS+     A  +A Q  D RPPEERYE QLRQLNDMGFFDF++NVAA
Sbjct: 299 A------FDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAA 352

Query: 350 LRRSGGSVQGALDSLLNGDV 369
           LRRSGGSVQGALDSLLNGDV
Sbjct: 353 LRRSGGSVQGALDSLLNGDV 372

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  386 bits (991), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/377 (59%), Positives = 259/377 (68%), Gaps = 19/377 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MS+ V VK GQ KWEVSV PE TV +FK+ I++ + IP ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGG-GGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDL 119
            IQDGH++HLVKS        A  A   +  S T A  SAT   N++SGQ+ GFNPL+DL
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSAT--PNMSSGQSAGFNPLADL 118

Query: 120 TSARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQMVDFM 177
           TSARYAG+ N+PSADMFGPDGG  N    NQD++L M++NPIFQSQMNEMLSNPQM+DFM
Sbjct: 119 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFM 178

Query: 178 IQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNP---SGGNDAAAASFP 234
           IQSNPQLQAMGPQARQ+LQSP FRQMLTNP M+RQSMQF+ MM+P   +G    AA++FP
Sbjct: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAFP 238

Query: 235 APGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGVGAADNQ 294
           APG                                       NP  + F N G  AA   
Sbjct: 239 APGGDAPEETTDTDAAPSSNAGANAAANPFASLL--------NPALNPFANAGNSAAATG 290

Query: 295 QNQPFDPSMLASLL--GGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRR 352
               FDP++LAS+      AAQ    +D RPPEERYEQQLRQLNDMGFFDF++NVAALRR
Sbjct: 291 M-PAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRR 349

Query: 353 SGGSVQGALDSLLNGDV 369
           SGGSVQGALDSLLNGDV
Sbjct: 350 SGGSVQGALDSLLNGDV 366

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  384 bits (985), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/381 (57%), Positives = 258/381 (67%), Gaps = 20/381 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MS+ + +K GQ KWEV+V PE TV +FK+ I K + IP ANQRLIYSGKILKDDQ VESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
            IQDGH++HLVKS       +A  + ++  +  AA        N++SGQ+ GFNPL+DLT
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAA--GTGATPNMSSGQSAGFNPLADLT 118

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMP--NQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI 178
           SARYAG+ N+PSADMFGPDGG  N    NQD++L M+ENPIFQSQMNEMLSNPQM+DFMI
Sbjct: 119 SARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMI 178

Query: 179 QSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPS---GGNDAAAASFPA 235
           QSNPQLQAMGPQARQ+LQSP FRQMLTNP M+RQSMQF+ MM+P+   G    AA++FPA
Sbjct: 179 QSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFPA 238

Query: 236 PGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASM-------FGNQGV 288
           PG                                      +NP AS+       F N G 
Sbjct: 239 PGGDAPEEGSNTNTTSSSNTGNNAGTNAGTNAGANT---AANPFASLLNPALNPFANAGN 295

Query: 289 GAADNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVA 348
            A+       FDP++LAS+        +AE D RPPEERYE QLRQLNDMGFFDF++NVA
Sbjct: 296 AASTGM--PAFDPALLASMFQPPVQASQAE-DTRPPEERYEHQLRQLNDMGFFDFDRNVA 352

Query: 349 ALRRSGGSVQGALDSLLNGDV 369
           ALRRSGGSVQGALDSLLNGDV
Sbjct: 353 ALRRSGGSVQGALDSLLNGDV 373

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  382 bits (981), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/370 (57%), Positives = 253/370 (68%), Gaps = 26/370 (7%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M+I +QVK GQ++WEVSV    +V E K EIAKVSEIPA NQRLIYSGKILKDDQ VESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
           KI DGHAIHLVKSGG     AA A+        A   +  VPS+I++GQ+GGFNPL+DLT
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAG--AGAVPSSISAGQSGGFNPLADLT 118

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180
            ARYAG+TNLPS DMFGPDGGL +   Q++++GMLENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 119 GARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178

Query: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDXX 240
           +P LQAMGP AR++LQSPFFRQMLTNP ++RQ  +    M  +G        FPAPG   
Sbjct: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGGAGAEQ--GTDFPAPG--- 233

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPG-SNPLASMFGNQGVGAADNQQNQPF 299
                                            PG +NPL +   ++G+         P 
Sbjct: 234 -----------SAATPDAAAPAPNPLAAILGLQPGAANPLGAAPADRGLAMP------PL 276

Query: 300 DPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQG 359
           DP+ML+SL  G  A   A  DNRPPEERYEQQLRQLNDMGFFDF++NVAALRR+GGSVQG
Sbjct: 277 DPAMLSSLF-GAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQG 335

Query: 360 ALDSLLNGDV 369
           ALD+LLNGDV
Sbjct: 336 ALDALLNGDV 345

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  384 bits (987), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/408 (52%), Positives = 258/408 (63%), Gaps = 46/408 (11%)

Query: 2   SITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYK 61
           +I++ +K GQ+ W+VS++   ++A  KDEIAKVSEIPA NQRLIYSGKILKDDQNV+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLTS 121
           IQDGH++HLV+SG           T +  + T    + TVPSNI++GQTGGFNPL+DLTS
Sbjct: 63  IQDGHSVHLVRSG------KKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTS 116

Query: 122 ARYAGFT-NLPSADMFGPDGGLTNM-PNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQ 179
           ARYAG+  NLPSAD FGPDGG+     N D+ L ML+NPI QSQMNEMLSNPQM+DFMIQ
Sbjct: 117 ARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQ 176

Query: 180 SNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMM-------NPSGGNDAAAAS 232
           SNPQLQAMGPQARQ+ QSP FRQMLTNP M+RQSMQ ++MM         +   D AA+S
Sbjct: 177 SNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASS 236

Query: 233 FPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGS----NPLASMF----- 283
           FPAPG                                      S    NP AS+F     
Sbjct: 237 FPAPGGDDIINNNNTNTNTNTNTNNDTNDTATSNNDNANNNASSANTQNPFASLFNPTAN 296

Query: 284 ---------------GNQGVGAADNQQNQ-----PFDPSMLASLLGGGAAQQRA--EQDN 321
                           N G G+  N         PFDPSM ASL GG  A      +QD 
Sbjct: 297 NDSTGLAPNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQQDT 356

Query: 322 RPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369
           RPPEERYE QLRQLNDMGFFDF++N+AALRR+GGSV+ A+++LLNGDV
Sbjct: 357 RPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  382 bits (980), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/409 (51%), Positives = 262/409 (64%), Gaps = 43/409 (10%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           MSI++ VK GQ+KW+VS +P  ++   K  IA+VS IPA NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHAIHLVKS----------GGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQT 110
           KI DGH+IHLV+S            GG + + +A  S   ++TA  GS TVP+NI +GQ 
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGS-TVPNNITAGQM 119

Query: 111 GGFNPLSDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSN 170
           GGFNPL+DLT ARYAG+ NLPS DMFGPDGGL +   Q+++LGML+NPIFQSQ+NEML+N
Sbjct: 120 GGFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLAN 179

Query: 171 PQMVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAA 230
           PQM+DF+IQ +P LQAMGP AR++LQSPFFRQM+TNP ++RQ  +F   M+    N  + 
Sbjct: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF--QMDMGAANGQST 237

Query: 231 ASFPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPG-SNPLASMFG----- 284
             FPAPG                                       SNP A+MF      
Sbjct: 238 NDFPAPGSANNSATTSGDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPFAAMFAPPANS 297

Query: 285 --NQGVGA--------------ADNQQNQ------PFDPSMLASLLGGG--AAQQRAEQD 320
             N G  A              AD+QQ        P DP+ML++LL GG  A  ++  +D
Sbjct: 298 GPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATGRQQTED 357

Query: 321 NRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369
           NRPPEERY+QQL QLN+MGF DF++NVAALRRSGGSVQGAL++LLNGDV
Sbjct: 358 NRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  374 bits (959), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/381 (56%), Positives = 256/381 (67%), Gaps = 27/381 (7%)

Query: 3   ITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKI 62
           I+V VK GQ+ W V +    T+  FK+ I+ VS +PA NQRLIYSGKILKD + VESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLTSA 122
           QDGH++H+VKSGG    T    +T S  S  A   ++  PSNI++GQTGGFNPL+DLT A
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAAT--NSAAPSNISAGQTGGFNPLADLTGA 121

Query: 123 RYAGFTNLPSADMFGPDGGL--TNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180
           RYAG  NLPSADMFGPDGGL  +N  N + ML MLENPIFQSQMNEMLSNPQMVDF+IQ 
Sbjct: 122 RYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQ 181

Query: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDXX 240
           NPQLQA+GP+AR +LQSPFFRQM+T+PQM+RQSMQ ++ M  S   D AA++FPAPG   
Sbjct: 182 NPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMS--PDGAASAFPAPGSAS 239

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFG-NQGVGAADN------ 293
                                              +NP A +FG   G  AA N      
Sbjct: 240 GAGGANETSTNDADSAATGAAASSTGQ--------ANPFAGLFGATPGNAAAANPFAGLF 291

Query: 294 ---QQNQPFDPSMLASLLGGGAAQQRA--EQDNRPPEERYEQQLRQLNDMGFFDFEKNVA 348
              QQ Q F+  +LAS+ GG +    A    DNRPPEERYE QLRQLNDMGFFDF++NVA
Sbjct: 292 PGGQQPQ-FNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVA 350

Query: 349 ALRRSGGSVQGALDSLLNGDV 369
           ALRR+GGSVQGALD+LLNGDV
Sbjct: 351 ALRRAGGSVQGALDALLNGDV 371

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  368 bits (945), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/375 (54%), Positives = 253/375 (67%), Gaps = 13/375 (3%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M+I+V +K GQ+ W+V +    T+ +FKD+IA VSEIPA NQRLIYSGKILKDDQ +ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
           KIQDGH+IH+VKSG     TA+  + S   +NT AP +    S +++G+  GFNPLSDLT
Sbjct: 61  KIQDGHSIHMVKSGAHA--TASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLT 118

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180
           SARYAG+TNLPSADMFGPDGG     +QDDML MLENP+FQSQMNEMLSNP++VDF+I S
Sbjct: 119 SARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178

Query: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDXX 240
           NPQLQ++GPQAR + QSP FRQMLTNP M+RQSM+ + MMN  G   A+A+SFPAPGD  
Sbjct: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN-GGEGTASASSFPAPGDST 237

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXPGSNPLASMFG-----NQGVGA 290
                                                   +NP A++F         +G 
Sbjct: 238 TTTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSMNPYAALGG 297

Query: 291 ADNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAAL 350
            +   N  F+P+  A  L   A   +  +DNRPPEERYE QLRQLNDMGFFDF+KNVAAL
Sbjct: 298 GNGNANNMFNPAAFAQALQAAAPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAAL 357

Query: 351 RRSGGSVQGALDSLL 365
           RRSGGSVQGA+++LL
Sbjct: 358 RRSGGSVQGAVNALL 372

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  334 bits (856), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/384 (54%), Positives = 253/384 (65%), Gaps = 32/384 (8%)

Query: 1   MSITVQVKCGQSKWEVSVNPE---KTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNV 57
           M ITV VK GQ++W+V+V  E    TVA+FK+ +A V+ +P  NQRLIYSGKILKD Q +
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLS 117
           E YKI DGH +HLVKSGG     ++ +S+ +  +   A  +    +++A+GQ  GFNPL+
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 118 DLTSARYAGFT-NLPSADMFGPDGGLTNMPNQ------DDMLGMLENPIFQSQMNEMLSN 170
           DLTSARYAG+   +PSADMFGPDGGLT+          +++L MLENPIFQSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 171 PQMVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAA 230
           PQMVDF+IQSNPQLQAMGPQAR++LQSP FRQMLTNP M+RQSMQFS MM  SG     A
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGGA 240

Query: 231 A--SFPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGSNPLASMFGNQGV 288
              +FPAPG                                     G+NP +S+FG    
Sbjct: 241 DPNAFPAPGGDDTGAPTNTSTNASAAGPA-----------------GANPFSSLFGGAPA 283

Query: 289 GAADNQQNQP-FDPS--MLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEK 345
            AA   Q+ P FD +  M A    G  A   A QD RPPEERYEQQLRQLNDMGF DF++
Sbjct: 284 PAAQPFQSAPGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDR 343

Query: 346 NVAALRRSGGSVQGALDSLLNGDV 369
           NVAALRR+GGS+QGALD+LLNGDV
Sbjct: 344 NVAALRRAGGSLQGALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 109/219 (49%), Gaps = 18/219 (8%)

Query: 3   ITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKI 62
           I+V +K  + K+ +    ++ +++   +I    +IP  NQRLIYSG+IL  ++ ++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDGHAIHLV--KSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120
           +DGH I ++  K      +     +T+   +N+  P S T P N +    G  N ++  T
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNT-PIN-SPTPFGEGNIITITT 119

Query: 121 SARYAGFTNLPSADMFGPDGGLTNMPN-QDDMLGMLENPIFQSQMNEMLSNPQ-MVDFMI 178
           +          S D +G      + P  + ++L +L++P    Q NEML N Q ++ F+I
Sbjct: 120 T----------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLI 168

Query: 179 QSNPQLQAMGPQ-ARQLLQSPFFRQMLTNPQMLRQSMQF 216
           Q+NP L+ M    ARQ+L+ P  ++   +   L Q +  
Sbjct: 169 QTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISL 207

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M +TV+   G+ +  V V+P+  V   K+ + +   IP   QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           +  G  +HLV +  GG
Sbjct: 60 NLSSGMQLHLVLTLRGG 76

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G+ +  V V+ E  V   K+ + +   IPA+ QRLI+ GK + +D  + + 
Sbjct: 1  MIIKVKTLTGK-EIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
          K+ DG  +HLV +  GG
Sbjct: 60 KLSDGMQLHLVLTLRGG 76

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M + V+   G+ +  V +     V   K+ + +   IP + QRLI+ GK + D+Q V+S 
Sbjct: 1  MYVKVKTLTGK-EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
          K+ DG  +HLV +  GG
Sbjct: 60 KLTDGMQLHLVLTLRGG 76

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G+ +  V +N E  +   K+ + +   IP + QRLI+ GK + D Q V S 
Sbjct: 1  MIIKVKTLTGK-EIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
          K+ DG  +HLV +  GG
Sbjct: 60 KLVDGMQLHLVLTLRGG 76

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G+ +  + V     V   KD + +   IP + QRLI+ GK + D+Q VES 
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           + DG  +HLV +  GG
Sbjct: 60 NLIDGMQLHLVLTLRGG 76

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 16 VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
          +S+   + V   K+ + +   IP + QRLI+ GK ++DDQ V+S  +  G  +HLV +  
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLVLTLR 74

Query: 76 GG 77
          GG
Sbjct: 75 GG 76

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G+ +  V +  +  +   K  + +   IP + QRLI+ GK + D Q +E+ 
Sbjct: 1  MIIKVKTLTGK-EIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
          K+ DG  +HLV +  GG
Sbjct: 60 KLVDGMVLHLVLTLRGG 76

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M + V+   G+ +  V V   +TV   K+ + +   IP + Q+LI+ GK + D+  + S 
Sbjct: 1  MQLKVKTLTGK-EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           +QDG  +HLV +  GG
Sbjct: 60 DLQDGSLLHLVLTLRGG 76

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G+ +  V ++  + V   K+ + +   IP + QRLI+ GK + D+Q+V S 
Sbjct: 1  MIIKVKTLTGK-EIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           + DG  +HLV +  GG
Sbjct: 60 NLVDGMQLHLVLTLRGG 76

>Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..49546)
           [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 1/107 (0%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GGG       T + ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGGVMQIFVKTLTGKTITLEVESSDTIDNVKS 182

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 1/107 (0%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GGG       T + ++ T    S+    N+ S
Sbjct: 290 NIQKESTLHLVLRLRGGGVMQIFVKTLTGKTITLEVESSDTIDNVKS 336

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 214 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 258

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 368 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 412

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 444 NIQKESTLHLVLRLRGG 460

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {ON}
           similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 1   MSITVQVK-CGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVES 59
           M IT+  K   + K  + ++P  T+AE K  +AK  +   +  ++I+SGK+L+D   +++
Sbjct: 1   MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60  YKIQDGHAIHLVKSGGGGGN----TAAKASTSSQESNTAAPGSATVPSN 104
            K++DG  +  + S    G      A   ST ++ +  AAPG   V S+
Sbjct: 61  CKLKDGDQVIFMISKKKTGTLMSPAATTTSTETKVTEAAAPGIRAVESS 109

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 310 GGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           G    Q    D+R  E  Y +Q+RQL +MGF D EKN+ AL++S G++  A+D L
Sbjct: 173 GRYDDQEVSDDDRY-ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YKR094C RPL40B Fusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {ON}
           Anc_5.701 YIL148W
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [387
           bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 bp,
           128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
           bp, 128 aa] {ON} highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           IQ    +HLV    GG
Sbjct: 60 NIQKESTLHLVLRLRGG 76

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {ON}
           complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P14796 Saccharomyces
           cerevisiae YKR094C RPL40B
          Length = 128

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
           aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           IQ    +HLV    GG
Sbjct: 60 NIQKESTLHLVLRLRGG 76

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKT--VAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVE 58
          M I V+   G+   E+ V+ + T  V   K+ + +   IP + QRLI+ GK + D+Q V 
Sbjct: 1  MIIKVKTLTGK---EIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVS 57

Query: 59 SYKIQDGHAIHLVKSGGGG 77
          S  + DG  +HLV +  GG
Sbjct: 58 SANLIDGMQLHLVLTLRGG 76

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P61864 Saccharomyces
           cerevisiae YKR094c RPL40B and highly similar to
           uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPKATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, 128
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YKR094C (RPL40B) and YIL148W (RPL40A); 1-intron
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
           bp, 128 aa] {ON} 
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%)

Query: 23 TVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAI 68
          TV E K ++A+  E   +  +LIYSGKIL+DD+ +  YK++DG  +
Sbjct: 23 TVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
           YLL039C
          Length = 153

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 136 NIQKESTLHLVLRLRGG 152

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
           [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
           Saccharomyces cerevisiae YLR167W RPS31 and highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YIL148W and highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094C and highly similar to
           uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
           proteins that are cleaved to yield a ribosomal protein
           of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + E        A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKAVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLVKSGGGGGNTAAKAST 86
           IQ    +HLV    GG     K  T
Sbjct: 60 NIQKESTLHLVLRLRGGMQIFVKTLT 85

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGG 78
            IQ    +HLV    GG 
Sbjct: 136 NIQKESTLHLVLRLRGGA 153

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
           YLL039C
          Length = 153

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 136 NIQKESTLHLVLRLRGG 152

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [450
           bp, 149 aa] {ON} 
          Length = 149

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 15  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 74

Query: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116
           GG    +  A AS  + E +      A +P   +N    + G  N L
Sbjct: 75  GGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTNQL 121

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLVKSGGGGGNTAAKAST 86
           IQ    +HLV    GG     K  T
Sbjct: 60 NIQKESTLHLVLRLRGGMQIFVKTLT 85

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLV 71
            IQ    +HLV
Sbjct: 136 NIQKESTLHLV 146

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
          + K  V +    T+ + K+++A +        +LI+SGK+LKDDQ V S  ++D   + +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 VKSGGGGGNTAAKASTSSQES 91
          + S      +A K +   Q+S
Sbjct: 70 MISKKKATPSATKVTEPPQQS 90

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
           {ON} 
          Length = 128

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +    AS  + E +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 1  MSITVQVK-CGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVES 59
          M+IT+  K   + +  + ++P  T+AE K  +A+  +   +  ++I+SGK+L+D   +E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIQDGHAIHLVKS 73
           K++DG  +  + S
Sbjct: 61 CKLKDGDQVIFMIS 74

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
           {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {ON} 
          Length = 128

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
           RPL40AFusion protein, identical to Rpl40Bp, that is
           cleaved to yield ubiquitin and a ribosomal protein of
           the large (60S) ribosomal subunit with similarity to rat
           L40; ubiquitin may facilitate assembly of the ribosomal
           protein into ribosomes
          Length = 128

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
           128 aa] {ON}  RPL40BFusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
           YLL039C
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 212 NIQKESTLHLVLRLRGG 228

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 212 NIQKESTLHLVLRLRGG 228

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
           YIL148W
          Length = 229

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 212 NIQKESTLHLVLRLRGG 228

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {ON}
           YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 212 NIQKESTLHLVLRLRGG 228

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
           similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +  A AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLVKSGGGGGNTAAKAST 86
           IQ    +HLV    GG     K  T
Sbjct: 60 NIQKESTLHLVLRLRGGMQIFVKTLT 85

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKAST 86
            IQ    +HLV    GG     K  T
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLT 161

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKAST 86
            IQ    +HLV    GG     K  T
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLT 237

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%)

Query: 23 TVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAI 68
          T++E K  +A+  +   +  +LIYSGKIL+DD+ +  YK+ DG  +
Sbjct: 23 TISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YLL039c UBI4 ubiquitin
          Length = 305

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 288 NIQKESTLHLVLRLRGG 304

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 16 VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
          + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 60

Query: 76 GG 77
          GG
Sbjct: 61 GG 62

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)
          Length = 144

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 31  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 90

Query: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116
           GG    +  A AS  + + +      A +P   +N    + G  N L
Sbjct: 91  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 137

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
           381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 364 NIQKESTLHLVLRLRGG 380

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
           UBI4Ubiquitin, becomes conjugated to proteins, marking
           them for selective degradation via the ubiquitin-26S
           proteasome system; essential for the cellular stress
           response; encoded as a polyubiquitin precursor comprised
           of 5 head-to-tail repeats
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 364 NIQKESTLHLVLRLRGG 380

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 364 NIQKESTLHLVLRLRGG 380

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL039C
           (UBI4)
          Length = 382

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 364 NIQKESTLHLVLRLRGG 380

>Suva_10.30 Chr10
           complement(67747..67841,68061..68288,68558..69013,
           69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++ K L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 364 NIQKESTLHLVLRLRGG 380

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)
          Length = 125

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 12  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 71

Query: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116
           GG    +  A AS  + + +      A +P   +N    + G  N L
Sbjct: 72  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 118

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {ON}
           YKR094C (REAL)
          Length = 125

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 12  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 71

Query: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116
           GG    +  A AS  + + +      A +P   +N    + G  N L
Sbjct: 72  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 118

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 105 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKAST 86
            IQ    +HLV    GG     K  T
Sbjct: 164 NIQKESTLHLVLRLRGGMQIFVKTLT 189

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 181 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKAST 86
            IQ    +HLV    GG     K  T
Sbjct: 240 NIQKESTLHLVLRLRGGMQIFVKTLT 265

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 257 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKAST 86
            IQ    +HLV    GG     K  T
Sbjct: 316 NIQKESTLHLVLRLRGGMQIFVKTLT 341

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 333 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 392 NIQKESTLHLVLRLRGG 408

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
           to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
           ubiquitin
          Length = 533

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 364 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 408

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 440 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 484

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 516 NIQKESTLHLVLRLRGG 532

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 364 NIQKESTLHLVLRLRGG 380

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 364 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 408

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 440 NIQKESTLHLVLRLRGG 456

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
           complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 60  NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 136 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 180

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 212 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 256

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 288 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 332

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 364 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 408

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIAS 107
            IQ    +HLV    GG     K  T   ++ T    S+    N+ S
Sbjct: 440 NIQKESTLHLVLRLRGGMQIFVKTLTG--KTITLEVESSDTIDNVKS 484

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDGHAIHLVKSGGGG 77
            IQ    +HLV    GG
Sbjct: 516 NIQKESTLHLVLRLRGG 532

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
          + K  + + P  T+ E K ++A+ +    +  +LIYSGK+L+D + V    ++DG  +  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKSGGGGGNTAAKASTSSQESNTAAPG 97
          + S      T      ++ E+ T  P 
Sbjct: 71 MISQKKSTKTKVTEPPAAPETATTVPA 97

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)
          Length = 124

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 11  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 70

Query: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116
           GG    +  A AS  + + +      A +P   +N    + G  N L
Sbjct: 71  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 117

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [387
           bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +    AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
           {ON} Anc_5.701
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +    AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {ON}
           Anc_5.701
          Length = 128

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
           M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KIQDGHAIHLVKSGGGGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFN 114
            IQ    +HLV    GG    +    AS  + + +      A +P   +N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 115 PL 116
            L
Sbjct: 120 QL 121

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 3  ITVQVK-CGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYK 61
          IT+  K   + K  + ++P  TV + K ++A          +LI+SGK+L+D + +E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 IQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAA 95
          ++DG  +  + S      + A  +T +  SN AA
Sbjct: 62 LKDGDQVIFMIS---KKRSTATKTTEAPVSNAAA 92

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
          + K  + + P  T+ + K ++A+      +  ++IYSGK+L+D Q VE  ++++G  I  
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIF 70

Query: 71 VKS 73
          + S
Sbjct: 71 MIS 73

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           +Y ++LRQL ++GF + +KN+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
           YEL037C (REAL)
          Length = 409

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%)

Query: 11  QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
           + K  + + P  T+ E K ++A+ S    +  +LIYSGK+L+D + V    ++DG  +  
Sbjct: 11  KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71  VKSGGGGGNTAAKASTSSQESNTAAPGSATVPSN 104
           + S      T         E+   A   +T P++
Sbjct: 71  MISQKKSTKTKVTEPPVVPETTAPARDESTEPAS 104

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
           RAD23Protein with ubiquitin-like N terminus, subunit of
           Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
           binds damaged DNA; enhances protein deglycosylation
           activity of Png1p; also involved, with Rad4p, in
           ubiquitylated protein turnover
          Length = 398

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 11  QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
           + K  + + P  T+ E K ++A+      +  +LIYSGK+L+D + V    ++DG  +  
Sbjct: 11  KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71  VKSGGGGGNTAAKASTSSQESN-TAAPGSATVP 102
           + S         K ST ++ +    AP SAT P
Sbjct: 71  MVS--------QKKSTKTKVTEPPIAPESATTP 95

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 46/107 (42%), Gaps = 6/107 (5%)

Query: 16  VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGG 75
           + V    T+   K +I     IP   QRLI++GK L+D + +  Y IQ    +HLV    
Sbjct: 74  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 133

Query: 76  GGG---NTAAKASTSSQESNTAAPGSATVP---SNIASGQTGGFNPL 116
           GG    +    AS  + + +      A +P   +N    + G  N L
Sbjct: 134 GGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 180

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
           YEL037C (REAL)
          Length = 397

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 6/93 (6%)

Query: 11  QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
           + K  + + P  T+ E K ++A+      +  +LIYSGK+L+D + V    ++DG  +  
Sbjct: 11  KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71  VKSGGGGGNTAAKASTSSQESNTAAPGSATVPS 103
           + S          A T   E   AA  +AT P+
Sbjct: 71  MVSQKKS------AKTKVTEPPVAAEPTATTPA 97

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 36.6 bits (83), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 3  ITVQVKCGQSKWEVSVNPEKT--VAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          + V+VK    K E+SV  +++  V   K+ + +   IP + QRLI+ GK + D   V   
Sbjct: 1  MIVKVKTLTGK-EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDA 59

Query: 61 KIQDGHAIHLVKSGGGG 77
           + +G  +HLV +  GG
Sbjct: 60 HLVEGMQLHLVLTLRGG 76

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 48/86 (55%), Gaps = 8/86 (9%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
          + K+ + +   +++   K+ +++      +  +LI+SGK+LKD  +VES   +DG+ +  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VKSGGGGGNTAAKASTSSQESNTAAP 96
          + S        AK +T+++ + ++AP
Sbjct: 71 MVS--------AKKATATKVTESSAP 88

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 23 TVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHLVKSGGGGGNTAA 82
          TV   K ++A+  E   +  +LIYSGK+L+D  ++E   ++DG  +  + S      T  
Sbjct: 23 TVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVIFMISKKKSTVTQV 82

Query: 83 KASTSSQESNTAAPGSA 99
             T S+E   AAP  A
Sbjct: 83 TEPTESKE--VAAPEVA 97

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           +Y +QL++LNDMGF + + N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDG-HAIH 69
          + K  + +  + T++  K+ IA+  +  A+  +LIY+GKIL+D + V    +++G   I 
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 70 LVKSGGGGGNTAAKASTSSQESNTAAPGSA 99
          ++       +     ST+  +  + A  SA
Sbjct: 70 MISKTKKKADVKVTESTTEPQDESQATASA 99

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           RY +QL +L DMGF D  KN+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLL--NGD 368
           +Y ++LR+L +MGF D + N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           RY +QL +L DMGF D  KN+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           +Y +QLR L DMGF D + NV AL    G++   ++ L
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINIL 192

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          M I V+   G++   + V    T+   K +I     IP   QRLI++GK L+D + +  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHAIHLV 71
           IQ    +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369
           R+  QLR L ++G+ D + NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           RY +QL +L DMGF D  KN+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 35/63 (55%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAIHL 70
          + K  + ++P  +V + K  +A       +  +LIYSGK+L+D +N++   ++DG  +  
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQVIF 70

Query: 71 VKS 73
          + S
Sbjct: 71 MIS 73

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           RY ++LR L +MG+ D + N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           RY +QL +L DMG+ D  KN+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAI 68
          + K  +++    TV + K ++A+      +  +LIYSGK+L+D + +E   ++DG  +
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQR--LIYSGKILKDDQNVE 58
          M + ++    +SK++++     TV + K  I K  ++        LIYSGK+L+DD  + 
Sbjct: 1  MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 59 SYKIQDG 65
          S  ++D 
Sbjct: 61 SLHLKDN 67

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 31.6 bits (70), Expect = 0.45,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 1  MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60
          + + V  + G+ K  V    E  V +FK  ++     PA+  +L+  G ILKD  +++ Y
Sbjct: 2  IEVVVNDRLGK-KIRVKCLEEDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDY 60

Query: 61 KIQDGHAIHL 70
          +I D   + L
Sbjct: 61 EIHDNTFLEL 70

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 23 TVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDG-HAIHLVKSGGGGGNTA 81
          TV + K +IA   +   +  +LIYSGK+L++D  +    ++DG   I ++      G   
Sbjct: 23 TVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIFMISKKKSTGTKV 82

Query: 82 AKAS 85
           +A+
Sbjct: 83 TEAT 86

>Skud_15.355 Chr15 (636562..640014) [3453 bp, 1150 aa] {ON} YOR188W
           (REAL)
          Length = 1150

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 56  NVESYKIQDGH--AIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGF 113
           N+   +IQ  H  A+H +K      ++ A +S  + +     P   ++ SNI    +  +
Sbjct: 725 NITDEEIQSSHSSAVHSLKLSTNTNDSYADSSKLTTDGKLVEPRKVSIQSNIDDDSSSYY 784

Query: 114 NP-LSDLTSARYAG---FTNLPSADMFGPDGGLTNMPNQDDM 151
           +P ++D+ ++R      + N  S   F  +  L  + ++DDM
Sbjct: 785 SPNMNDIPTSRMPSQPTYPNFHSKKTFTNEPHLEMLQSRDDM 826

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 30.0 bits (66), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 16 VSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGK 49
          + V PE  V   K+ + +   IP A QRLI+ GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDG-HAIH 69
          + K  + ++ + T+   K +IA          +LIYSGKILK+D  + +  ++D  H I 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 34/58 (58%)

Query: 11 QSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKIQDGHAI 68
          + K  + ++   +V + K ++A+  E      +LIYSGK+L+D ++++   ++DG  +
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 311 GAAQQRAEQDNRPPEERYEQQLRQLNDMGF-FDFEKNVAALRRSGGSVQGALDSL 364
           G + +    D+R    +Y +QL +L DMG+  D ++   AL R+ G +  +LD +
Sbjct: 182 GGSNRHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 15/102 (14%)

Query: 138 PDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMI--QSNPQLQAMGPQARQLL 195
           PD G   M +  +M+  L+N     +  E++ +PQ+V  ++  QSNPQ+  MGP   ++L
Sbjct: 125 PDLGFGQMFSDPNMIEKLKN---NPKTAELMKDPQLVSKVLQFQSNPQM--MGP---EIL 176

Query: 196 QSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPG 237
           Q P  R M     ML   +   S+   S G + AA S  AP 
Sbjct: 177 QDP--RMMTIMAAMLGVDL---SIGGDSNGQEPAAPSKEAPA 213

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 7/49 (14%)

Query: 138 PDGGLTNMPNQDDMLGMLE-NPIFQSQMNEMLSNPQMVDFMIQ--SNPQ 183
           PD GLT M N  +++  L+ NP    +  EM+ +PQ+V  +IQ  SNPQ
Sbjct: 128 PDMGLTQMFNDPNLIENLKKNP----KTAEMMKDPQLVAKLIQYRSNPQ 172

>SAKL0H26048g Chr8 complement(2292824..2294482) [1659 bp, 552 aa]
           {ON} similar to uniprot|P38734 YHL036W Saccharomyces
           cerevisiae MUP3 Low affinity methionine permease,
           similar to Mup1p
          Length = 552

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 118 DLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPI 159
           DL+S RY  FT+L + DM   +  +TN   Q   LG+    +
Sbjct: 28  DLSSVRYGSFTSLETQDMLALNSNITNDVPQGRHLGVFSTIV 69

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           RY ++L +L +MGF D + N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 327 RYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSL 364
           +Y + ++ L  MG+ D + N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,981,792
Number of extensions: 1408085
Number of successful extensions: 6284
Number of sequences better than 10.0: 223
Number of HSP's gapped: 6343
Number of HSP's successfully gapped: 330
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)