Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005908.838ON54154125110.0
ZYRO0G14146g8.838ON5073709971e-129
Kpol_1068.108.838ON6173728071e-99
SAKL0D01518g8.838ON5743826602e-78
TPHA0I002308.838ON6143936527e-77
NCAS0B003108.838ON5643566365e-75
Kwal_27.102728.838ON5513796331e-74
KLTH0C03916g8.838ON5703836141e-71
NDAI0E003008.838ON6644455972e-68
Ecym_46098.838ON5203915638e-65
TBLA0D032508.838ON6834565683e-64
KAFR0A028208.838ON4533465334e-61
ABL128W8.838ON4743715302e-60
Smik_13.208.838ON5103675148e-58
Skud_13.278.838ON5143685122e-57
YML114C (TAF8)8.838ON5103605112e-57
Suva_13.298.838ON5093745024e-56
KLLA0D01617g8.838ON5623893983e-41
KNAG0G034108.838ON5263813261e-31
CAGL0B02299g8.838ON6432243032e-28
NDAI0A067803.154ON62090890.037
KLLA0B05841g4.173ON187890840.14
KAFR0F038304.173ON184594840.17
NCAS0A020404.173ON183790810.38
YLR342W (FKS1)4.173ON187690800.50
Kpol_499.124.173ON189990780.79
Smik_12.4294.173ON187890771.0
YGR032W (GSC2)4.173ON189590761.2
Skud_12.4274.173ON188390761.4
ZYRO0A12518g4.173ON188393761.5
Kwal_YGOB_14.13654.173ON168590751.7
SAKL0B04158g4.173ON190394742.1
KNAG0D039204.173ON187994742.2
NCAS0J007604.173ON187084742.6
KLTH0F10428g3.367ON79547715.0
Smik_15.1307.121ON76137705.7
SAKL0G00704g5.675ON114146706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00590
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   971   0.0  
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   388   e-129
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   315   1e-99
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   258   2e-78
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   255   7e-77
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   249   5e-75
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   248   1e-74
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   241   1e-71
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   234   2e-68
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   221   8e-65
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   223   3e-64
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   209   4e-61
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   208   2e-60
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   202   8e-58
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   201   2e-57
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   201   2e-57
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   197   4e-56
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   157   3e-41
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   130   1e-31
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   121   2e-28
NDAI0A06780 Chr1 complement(1545760..1547622) [1863 bp, 620 aa] ...    39   0.037
KLLA0B05841g Chr2 complement(522241..527877) [5637 bp, 1878 aa] ...    37   0.14 
KAFR0F03830 Chr6 (750178..755715) [5538 bp, 1845 aa] {ON} Anc_4....    37   0.17 
NCAS0A02040 Chr1 (387566..393079) [5514 bp, 1837 aa] {ON} Anc_4....    36   0.38 
YLR342W Chr12 (809997..815627) [5631 bp, 1876 aa] {ON}  FKS1Cata...    35   0.50 
Kpol_499.12 s499 complement(30272..35971) [5700 bp, 1899 aa] {ON...    35   0.79 
Smik_12.429 Chr12 (748638..754274) [5637 bp, 1878 aa] {ON} YLR34...    34   1.0  
YGR032W Chr7 (548264..553951) [5688 bp, 1895 aa] {ON}  GSC2Catal...    34   1.2  
Skud_12.427 Chr12 (750276..755927) [5652 bp, 1883 aa] {ON} YLR34...    34   1.4  
ZYRO0A12518g Chr1 (992718..998369) [5652 bp, 1883 aa] {ON} highl...    34   1.5  
Kwal_YGOB_14.1365 s14 (293772..295589,295591..298827) [5055 bp, ...    33   1.7  
SAKL0B04158g Chr2 (370872..376583) [5712 bp, 1903 aa] {ON} highl...    33   2.1  
KNAG0D03920 Chr4 (710373..716012) [5640 bp, 1879 aa] {ON} Anc_4....    33   2.2  
NCAS0J00760 Chr10 complement(118763..124375) [5613 bp, 1870 aa] ...    33   2.6  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    32   5.0  
Smik_15.130 Chr15 (222948..225233) [2286 bp, 761 aa] {ON} YOL036...    32   5.7  
SAKL0G00704g Chr7 complement(64152..67577) [3426 bp, 1141 aa] {O...    32   6.4  

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/541 (90%), Positives = 492/541 (90%)

Query: 1   MEDHSHERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMIL 60
           MEDHSHERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMIL
Sbjct: 1   MEDHSHERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMIL 60

Query: 61  IDDQLNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKE 120
           IDDQLNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKE
Sbjct: 61  IDDQLNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKE 120

Query: 121 FDSLHSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYN 180
           FDSLHSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYN
Sbjct: 121 FDSLHSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYN 180

Query: 181 QPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYGN 240
           QPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYGN
Sbjct: 181 QPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYGN 240

Query: 241 EQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYS 300
           EQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYS
Sbjct: 241 EQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYS 300

Query: 301 KIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQEL 360
           KIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQEL
Sbjct: 301 KIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQEL 360

Query: 361 RDKKAQKLKNFTDQQXXXXXXXXXXXXXXXXXXXXYSGSEDEDLPQAEFENPSMTNDIPV 420
           RDKKAQKLKNFTDQQ                    YSGSEDEDLPQAEFENPSMTNDIPV
Sbjct: 361 RDKKAQKLKNFTDQQLENGDINLLDLDENNDDFFNYSGSEDEDLPQAEFENPSMTNDIPV 420

Query: 421 PNLPTPAPEEHSRAEAQSHSEVQPVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPAQM 480
           PNLPTPAPEEHSRAEAQSHSEVQPVI                             TPAQM
Sbjct: 421 PNLPTPAPEEHSRAEAQSHSEVQPVIESNAQPEAQAQAQSESQAQAESMAEVEQQTPAQM 480

Query: 481 ETQVMPEAESHQERSSVESQHELASPPEVDAQPQEQESDEDDTNFLFDESITTEQQDEIQ 540
           ETQVMPEAESHQERSSVESQHELASPPEVDAQPQEQESDEDDTNFLFDESITTEQQDEIQ
Sbjct: 481 ETQVMPEAESHQERSSVESQHELASPPEVDAQPQEQESDEDDTNFLFDESITTEQQDEIQ 540

Query: 541 L 541
           L
Sbjct: 541 L 541

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  388 bits (997), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 193/370 (52%), Positives = 273/370 (73%), Gaps = 12/370 (3%)

Query: 9   HIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDM 68
           +IQ+T LPTL E+ H   E  VVK+L+K+VALQLKPM A I++FAF+ L+ L+D QLNDM
Sbjct: 4   YIQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDM 63

Query: 69  IGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLK 128
           I QLHR SN+QRRE+IAKGD+ + ++G+N++P+ ++ Q + S++YS+ Y KEF+ LHSL+
Sbjct: 64  ISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLR 123

Query: 129 E---TFTDAVV---DEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQP 182
           +   +    +V   D++   ++V   LV P NPL  ++PKW+P FPPDHTYKFTPQY+ P
Sbjct: 124 DLQSSLAHEMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHP 183

Query: 183 ITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSD-ADGASYDEALVREETAAIYGNE 241
           ITDET IRR+IV+E KQSE+AL HL +  N   P+ D  + + YD  L  +ET AIYG++
Sbjct: 184 ITDETTIRRQIVEEAKQSELALSHLSQKKN---PTDDIVNRSQYDSELAEQETLAIYGSQ 240

Query: 242 QKKRKKN--ASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKY 299
            KKRK     ++S+DLLSKLPQTNFS+EEYA +R+E+ARKKV+E+EERQ++ Q++PF+K 
Sbjct: 241 LKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKL 300

Query: 300 SKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQE 359
           S+IA +  +DK  ++Q  RE    LQRS  HL+KSIPEL+  K +   KA+++R +RLQE
Sbjct: 301 SRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSKRLQE 360

Query: 360 LRDKKAQKLK 369
           LR ++ ++ K
Sbjct: 361 LRAQREEQEK 370

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  315 bits (807), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/372 (47%), Positives = 251/372 (67%), Gaps = 14/372 (3%)

Query: 8   RHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQL 65
           ++IQLT LPTL E  + +TE A+ KIL+KAVALQLK M  D  I+KFAFEHLM L+  Q+
Sbjct: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66

Query: 66  NDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLH 125
           +DM+ +LHR S++QRR ++AK D+ ++L+G+NLTP DL++Q+Q SQY SK Y K+++SL 
Sbjct: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLT 126

Query: 126 SL-------KETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQ 178
            +         T+    +   + S    ++LV  +NPL + IP W+P FPPD+TYKFTPQ
Sbjct: 127 KIATTTTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFTPQ 186

Query: 179 YNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIY 238
           YN PITDETIIRR++V+EGKQSE ALL+LL+       S D   +S +  L  EET A Y
Sbjct: 187 YNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSSEMELATEETLATY 246

Query: 239 GNEQKKRKKNASSSSDLLSKLP-QTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFI 297
                + K   S       K P Q + ++EEYAR+RVEI RKKV+ YEERQ+++QRNPF+
Sbjct: 247 SAITLRNKHLTS----FFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFL 302

Query: 298 KYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERL 357
           K S++  +N+ +K  +  A  EI   L+RSL + I SIP+ Q  +++AR +AE++++ RL
Sbjct: 303 KISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQERKEARERAEEEKERRL 362

Query: 358 QELRDKKAQKLK 369
            E++  K +KLK
Sbjct: 363 AEIKALKEEKLK 374

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  258 bits (660), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 155/382 (40%), Positives = 239/382 (62%), Gaps = 33/382 (8%)

Query: 8   RHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADI--SKFAFEHLMILIDDQL 65
           + I+L  LPTL    H   E  + KILS+AVA++LKPM  D+  S+FAFE+L+ L+ + L
Sbjct: 17  KQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENL 76

Query: 66  NDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL- 124
           + M+  LHRF ++QRR  I+K D+ L L+GY+L+ ++L ++ ++SQY    + ++ + + 
Sbjct: 77  SFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIA 136

Query: 125 -------HSLKETFTDAVVDEDNGSE------DVINELVRPNNPLIRYIPKWMPAFPPDH 171
                    L +  T+  +     SE      D+++ LV P N   +YIPKW+P FPPDH
Sbjct: 137 QKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILD-LVPPTNKNNQYIPKWLPEFPPDH 195

Query: 172 TYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGAS------- 224
           TY+FT QYN+P+ DE  +RR++V+EGKQSE AL++LLK+ +    S++ D  +       
Sbjct: 196 TYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHD----STNQDLGNNERVEKR 251

Query: 225 --YDEALVREETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVV 282
             Y+E   +EET  I+G E+KK      +S +LL  LP  NFS+EEYAR+RVEIAR+KV+
Sbjct: 252 SLYEE--TQEETFLIFGPERKK-SHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVL 308

Query: 283 EYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTK 342
           EYE+ Q++LQ+NPFIK + +          R+   +E+ SMLQRS   L++S+P+L   K
Sbjct: 309 EYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVK 368

Query: 343 QDARRKAEQKRDERLQELRDKK 364
              R  A ++R E L++L +++
Sbjct: 369 ARERELANERRREMLEKLNEER 390

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  255 bits (652), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 149/393 (37%), Positives = 220/393 (55%), Gaps = 36/393 (9%)

Query: 6   HERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDD 63
            ++++QLT LPTL E  +  T+  +  IL+KA+ALQLK M  D  I+KFAF HL  L+D+
Sbjct: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDE 101

Query: 64  QLNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDS 123
           QL+DM+ Q+ + + +QRR+ +AK D+ L+L+G+NL P+DL   HQ S+Y  + YG E   
Sbjct: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTL 161

Query: 124 LHSLK-------ETF--TDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYK 174
           L+ L          F  TD  + +D+  E +  +LV   N L   IP W+P+FPPD+TYK
Sbjct: 162 LNRLATDTNEVLTVFKKTDKTLKDDSTLETL--KLVPITNTLENIIPDWLPSFPPDYTYK 219

Query: 175 FTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTP---------SSDADGASY 225
           FTPQ+N+ ITD T+IR+++  EGK+SE ALLHLL++    T          S D D A  
Sbjct: 220 FTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKL 279

Query: 226 DEALVREETAAIYGNEQKKRKKNASSSSDLLSKL-------PQTNFSIEEYARSRVEIAR 278
                  E  A+Y      RKK  +   D   ++           F IE+Y   R+ I R
Sbjct: 280 -------EMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVR 332

Query: 279 KKVVEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPEL 338
            KV +YE++Q++LQ +PF+K + +    +  K  R      I ++L+RS   LI SIP L
Sbjct: 333 NKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTL 392

Query: 339 QMTKQDARRKAEQKRDERLQELRDKKAQKLKNF 371
              K+D R +A  ++  R  E   ++ +KLK  
Sbjct: 393 NQNKKDTRERAMVEKKRRHDEWLKRREEKLKKL 425

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  249 bits (636), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 133/356 (37%), Positives = 218/356 (61%), Gaps = 17/356 (4%)

Query: 20  EIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMIGQLHRFSNVQ 79
           EI    ++  V K+L+K++ALQLKP+  ++S+ AF  L +L++DQL+ +I +LHR S +Q
Sbjct: 38  EIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISELHRMSVIQ 97

Query: 80  RRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKETFTDAVVDED 139
           RR + AK D+ L L+G NL  ++L  Q Q S +     GK++D+L     T  D+     
Sbjct: 98  RRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMA 157

Query: 140 N-GSEDVINE----LVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQPITDETIIRRRIV 194
           N G + ++N     L++PNNP    IP W+PAFPPDHTYKFTPQ+N+PITD+ +I+++++
Sbjct: 158 NPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLI 217

Query: 195 DEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYGNEQKKRKK------- 247
           +EGK+SE +LL+LL ++   +   + + +++D  L REE  AIYG +   RKK       
Sbjct: 218 EEGKKSEKSLLNLLNDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLI 277

Query: 248 NASSSSDLLSKLPQTN--FSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALS 305
           +   +       PQ +  F++  YA  RVE+ RK+V E+E  Q+K ++NPF++ S++   
Sbjct: 278 SIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMI-- 335

Query: 306 NSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQELR 361
            +  K  R     EI + LQRS + + ++ P+L+  +      A QKR+E++++L+
Sbjct: 336 -NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLK 390

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  248 bits (633), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 149/379 (39%), Positives = 234/379 (61%), Gaps = 27/379 (7%)

Query: 7   ERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQ 64
           +R +QL +LPTL EI     +  + K+L KA+A+QLK + AD  IS+ AFE+L+IL+++ 
Sbjct: 16  QRVVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEM 75

Query: 65  LNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEF--- 121
           L++M+  LH+ +N+QRR  I+K D+ L ++GYNL+ +DL  + + S+Y    + ++    
Sbjct: 76  LSNMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKV 135

Query: 122 --DSLHSLKETFTDAVVDEDNGS---------EDVINELVRPNNPLIRYIPKWMPAFPPD 170
             DS +  K+  T    +E   S         +DV+  LV P+    +++P+W+P FPPD
Sbjct: 136 EEDSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLT-LVPPSVKDTKHVPRWLPDFPPD 194

Query: 171 HTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHL--LKNMNPPTPSSDADGASYDEA 228
           HTY+FT QYN+PITDE +++R++ +E   SE AL+HL  L +    +   D+D   Y+EA
Sbjct: 195 HTYRFTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTI-YEEA 253

Query: 229 LVREETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQ 288
             ++ET  ++G  +KK+    +  +DLL  LPQ NFS+EEYAR+RVEIAR++V EYE  Q
Sbjct: 254 --QQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQ 311

Query: 289 MKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRK 348
           ++LQ+  FIK + +    S  ++  +Q  +EI ++L RS   L+KS P L+      RRK
Sbjct: 312 LQLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLK-----ERRK 366

Query: 349 AEQKRDERLQELRDKKAQK 367
            E    E  + LRD+K +K
Sbjct: 367 REIALAEENRRLRDEKLRK 385

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/383 (38%), Positives = 236/383 (61%), Gaps = 21/383 (5%)

Query: 8   RHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQL 65
           + +QL HLP L+EI     +  + K+L KAVA+QLK + ++  IS+FAFE+L+IL++  L
Sbjct: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76

Query: 66  NDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYS-------KTYG 118
           ++M+  LH+  N+QRR  I+K D+ L + GYNLT ADL  + + SQY         +   
Sbjct: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVR 136

Query: 119 KEFDSLHSLKET-FTDAVVDEDNGSEDVINE-----LVRPNNPLIRYIPKWMPAFPPDHT 172
           +E + + + ++T  ++  + E    E  I +     LV P     +Y+P+W+P FPPDHT
Sbjct: 137 EESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHT 196

Query: 173 YKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEAL--V 230
           Y+FT Q+N+PITDE +++R++ +E   SE AL+HL K  +  +PS   +GA  DE     
Sbjct: 197 YRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPS---EGADSDEIFKES 253

Query: 231 REETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMK 290
           +++T  I+G  +K +    + +SDLL  LPQ N+++EEYAR+RVEIAR+KV EYE  Q+ 
Sbjct: 254 QQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLL 313

Query: 291 LQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAE 350
           LQ+  FIK + + LS  + K   +Q  +E+ ++L RS   L+KS P L+  ++     AE
Sbjct: 314 LQKGAFIKAAHL-LSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAE 372

Query: 351 QKRDERLQELRDKKAQKLKNFTD 373
           + R  R +++R ++ ++LKN  D
Sbjct: 373 ENRRLREEQIRQEREERLKNSKD 395

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  234 bits (597), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/445 (33%), Positives = 227/445 (51%), Gaps = 103/445 (23%)

Query: 20  EIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMIGQLHRFSNVQ 79
           EI H   +  + K+L K++A+QLK  K D SK AF  L +L+DDQLN +I +LHR S +Q
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79

Query: 80  RRESIAKGDVHLFLQGYNLTPADLDKQHQASQYY-SKTYGKEFDSLHSLKETFT------ 132
           RR S+AK D+ L+++G+N+ P+DL+ Q+++S+Y   K  GKE+  L  L E         
Sbjct: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139

Query: 133 -DAVVDEDN-----------GSEDVINELVRPNNPLIRY-IPKWMPAFPPDHTYKFTPQY 179
            ++   +DN            + D  N L++P NP     I  W+P+FPPDHTYKFTPQ+
Sbjct: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199

Query: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKNMN-------------PPTPSSDADG---- 222
           N PITDE +I++++V+EG +SE ALL+ LKN++             PP+PS   +G    
Sbjct: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259

Query: 223 -----------------------ASYDEALVREETAAIYGNEQKKR--KKNASSSSDLLS 257
                                     D  L  EET AIYG + +    ++++SS  +++S
Sbjct: 260 TDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319

Query: 258 ------------KLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIAL- 304
                             F + +Y+  RVE+ RKKV  +E ++++L++NPF+K SK+   
Sbjct: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCL 379

Query: 305 ----------------------------SNSSDKSGRRQATREIHSMLQRSLQHLIKSIP 336
                                       +  S    R Q   EI S L+RS   ++ + P
Sbjct: 380 EKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILNNYP 439

Query: 337 ELQMTKQDARRKAEQKRDERLQELR 361
           +L+  K+   + A +KRD+RLQELR
Sbjct: 440 KLKKAKKQRVKLAIEKRDQRLQELR 464

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  221 bits (563), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 150/391 (38%), Positives = 227/391 (58%), Gaps = 40/391 (10%)

Query: 10  IQLTHLPTLDEI-DHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQLN 66
           IQL  LP L E+  H   +     +LS++VALQLK MK+D  I++  F ++M  I+ Q+N
Sbjct: 19  IQLKKLPGLQEVAKHNPMQI----LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMN 74

Query: 67  DMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLH- 125
           DM   LHRF+N+QRR  I+  D+ LFL+G  +    L  + + S+Y  KTY  EF ++  
Sbjct: 75  DMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIER 134

Query: 126 ---SLKETFTDAVVDED----NGSE------DVINELVRPNNPLIRYIPKWMPAFPPDHT 172
               L E +   + DE+    N +E      D++N LV P N    Y+P W+P FPPDHT
Sbjct: 135 QSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILN-LVPPTNINNSYVPTWLPEFPPDHT 193

Query: 173 YKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNP---PTPSSDADGASYDEAL 229
           YKFT  YN+PI+DE  ++R + +EGK SE ALL++L +           +    +Y E+ 
Sbjct: 194 YKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQTYKES- 252

Query: 230 VREETAAIYGNE-QKKRKKNA------SSSSDL-LSKLPQTNFSIEEYARSRVEIARKKV 281
            +EET  IYG E Q+ R++NA      +++ DL L+      F+I+EYARSR+ +AR+KV
Sbjct: 253 -QEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKV 311

Query: 282 VEYEERQMKLQRNPFIKYSKIAL-SNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQM 340
            E+E  +++ Q+NPFI+ S I     ++ K+ R+ A RE + +L+RS   ++KSIP+L+ 
Sbjct: 312 EEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQ 371

Query: 341 TKQD----ARRKAEQKRDERLQELRDKKAQK 367
            K +    A  +   K+ ER  EL  K  Q+
Sbjct: 372 LKANEMAAAIERERIKQKEREMELEKKHLQQ 402

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  223 bits (568), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 147/456 (32%), Positives = 232/456 (50%), Gaps = 100/456 (21%)

Query: 12  LTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMK--ADISKFAFEHLMILIDDQLNDMI 69
           L +LP L +  +    + + ++L+K++ALQLKPM     IS  AF  L+ L+D QLNDMI
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKE 129
            QL R S  QRR +IA  D+ L+L+ +NL P+DL    + S +    + K+++ L+ L  
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161

Query: 130 TFTDAV----VDEDNGSEDVINE---------LVRPNNPLIRYIPKWMPAFPPDHTYKFT 176
            +         + +  + D++N          +V P+N ++R +P+W+P+ PPDHTYKFT
Sbjct: 162 DYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221

Query: 177 PQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNP------PTPSSD----------- 219
           P YN+PITDET++++ +V+EGK +E AL+ LL+          PTP +D           
Sbjct: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINI 281

Query: 220 ---ADGASY------------------DEALVREETAAIYGNEQKKRK--------KNAS 250
               +G S                   DE L ++ET AIYG+  + RK         +  
Sbjct: 282 DTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPK 341

Query: 251 SSSDLLSKL--PQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALSNSS 308
           + + L  +   P T F++EEYAR +V+  R++V+ YEE+Q++ Q+NPF KYSK+ +  S 
Sbjct: 342 AETQLSEEFVYPST-FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQ 400

Query: 309 ------------------------------------DKSGRRQATREIHSMLQRSLQHLI 332
                                                   ++Q   +I  M  RSL +LI
Sbjct: 401 FHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSLNNLI 460

Query: 333 KSIPELQMTKQDARRKAEQKRDERLQELRDKKAQKL 368
            S+P L   K  AR  AE +R++++QE+  KK ++L
Sbjct: 461 NSLPNLAKEKASAREIAENEREKKVQEMLKKKQKEL 496

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  209 bits (533), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 197/346 (56%), Gaps = 32/346 (9%)

Query: 33  ILSKAVALQLKP--MKADISKFAFEHLMILIDDQLNDMIGQLHRFSNVQRRESIA-KGDV 89
           +L K+VA++LKP  +   +   AF++L+ L+D QLND+I QL R S +QRR S A K D+
Sbjct: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88

Query: 90  HLFLQGYNLTPADLDKQHQASQYYSKTYGKEF-----DSLHSLKETFTDAVVDEDNGSED 144
            L L+G+NL+ ++L+ + + S +  + Y ++      DS+H      TD V   +  S  
Sbjct: 89  LLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDSIHY--NQHTDFVGPVETSSFQ 146

Query: 145 VINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQSEVAL 204
           ++N    P NPL   IP W P+ PPDHTYKFTP+YN  I D  II+++  DE K  + AL
Sbjct: 147 LLN----PTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTAL 202

Query: 205 LHLLKNMNPPTPSSDADGASYDEALVREETAAIYGNEQKKRKKNASSSSDLLSKL-PQTN 263
            +L+   N    + + +   YDE L + E+ A++G  ++K   N      L S + P T 
Sbjct: 203 FNLI---NKIESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSIIVPITK 259

Query: 264 FSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSM 323
           F IEEY+  RV IAR KV ++E + + L+ NPFI      +++ +D          + S 
Sbjct: 260 FDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINL----INDQTD----------VKSY 305

Query: 324 LQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQELRDKKAQKLK 369
           L RS Q +I SIPEL + K+ A R+AE +RDER+  LR+    KLK
Sbjct: 306 LNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLK 351

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  208 bits (530), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 206/371 (55%), Gaps = 34/371 (9%)

Query: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQLND 67
           IQL  LP L E+        + K+L++AV L LK M++D  I++  FE+L+  ++ QL+D
Sbjct: 19  IQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75

Query: 68  MIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLH-- 125
           M+  LHRF+NVQRR  ++  DV LFL G  +    L +++  SQY  + +     S+   
Sbjct: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135

Query: 126 --SLKETFTDAVVDEDNGSE----------DVINELVRPNNPLIRYIPKWMPAFPPDHTY 173
             SL   +   + +E+  S           D++N LV P N    Y+PKW+P FPPDHTY
Sbjct: 136 SASLMGHWHQPMSEEELLSSSHAEFFFKDVDILN-LVPPTNNNNHYVPKWLPEFPPDHTY 194

Query: 174 KFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALV--R 231
           KFT  YNQPITDE  ++R++ +E K SE ALLH+L      T    AD A   + +   +
Sbjct: 195 KFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTA---TKKPRADDAQLPQIISDGQ 251

Query: 232 EETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKL 291
           +E   IYG E+++     +         P   F+IE+YAR RVE+AR++V E+E++++++
Sbjct: 252 QENLLIYGPERRRLAPEPA---------PTRGFNIEDYARCRVELARRRVEEFEQQKLQV 302

Query: 292 QRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQ 351
           Q+NPFI+ +      ++ +  R+   RE   +L RS   ++ +IP L+ TK      A +
Sbjct: 303 QKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAAYE 362

Query: 352 KRDERLQELRD 362
           +   R + +R+
Sbjct: 363 RERARQESMRN 373

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  202 bits (514), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 202/367 (55%), Gaps = 34/367 (9%)

Query: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69
           +QL  LP L EI H + +A VV+IL K V  QL  +   IS FA + L+ L+  Q++ M 
Sbjct: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMF 76

Query: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKE 129
             LH  + +QRR   ++ D+ L  + +N+  A L +Q Q S++    +  E+  L  L  
Sbjct: 77  RNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLS- 135

Query: 130 TFTDAVVDEDNGSEDV---------INELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYN 180
           +F     +E++  +++         IN L+ P+NPL + IP W+P FPPDHTYKFTP++N
Sbjct: 136 SFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195

Query: 181 QPITDETIIRRRIVDEGKQSEVALLHLLKNM---------NPPTPSSDADGASYDEALVR 231
            PITD   I++ IV E ++SE ALL+L K +         +PP    DAD          
Sbjct: 196 HPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLDDADAT-------- 247

Query: 232 EETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKL 291
           E+   I+GN  ++RK   +++S     L ++N  IE+YA+ RVE+AR++V ++E  Q+K 
Sbjct: 248 EQQLEIWGNALQERKPTITATS-----LNESN--IEQYAKYRVELARERVAKFELNQLKR 300

Query: 292 QRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQ 351
            +NPF+K S+    +       +     I    ++S+   + ++P++Q  K++  R A++
Sbjct: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360

Query: 352 KRDERLQ 358
           +R + L+
Sbjct: 361 ERAKSLR 367

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  201 bits (512), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 127/368 (34%), Positives = 199/368 (54%), Gaps = 36/368 (9%)

Query: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69
           +QL +LP L EI H K +A VV+IL K V  QL  +   IS FA + L+ L+  Q++ M 
Sbjct: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMF 76

Query: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL----- 124
             LH  + +QRR    + D+ L  + +NL PA L +Q Q S++    +  E++ L     
Sbjct: 77  RNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVSSSS 136

Query: 125 -----HSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQY 179
                H+ ++   +    E+  +E  I+ L+ P+NPL + +P W+P FPPDHTY+FTP++
Sbjct: 137 FSASSHNEEDEEDELNNIEEQQNE--ISVLLPPSNPLEKLMPSWLPNFPPDHTYRFTPEF 194

Query: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKNM---------NPPTPSSDADGASYDEALV 230
           N PITD   I+R IV E K+SE ALL+L K +          PP    DAD         
Sbjct: 195 NHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDADAG------- 247

Query: 231 REETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMK 290
            E+   I+GN  ++ K+ A S S       + N  IE+YA+ RVE+AR++V ++E  Q+K
Sbjct: 248 -EQQLEIWGNALQEEKRTAISKS-----FNENN--IEQYAKYRVELARERVSKFEVNQLK 299

Query: 291 LQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAE 350
             +NPF++ S+   S+ S     R   R I    ++S+     ++P++Q  K++  R A 
Sbjct: 300 RTKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAI 359

Query: 351 QKRDERLQ 358
           ++R   L+
Sbjct: 360 EERSRSLK 367

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  201 bits (511), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 206/360 (57%), Gaps = 20/360 (5%)

Query: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69
           +QL +LP L EI H + +A VV+IL K V  QL  +   IS FA + L+ L+  Q++ M 
Sbjct: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMF 76

Query: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFD------S 123
             LH  + +QRR   ++ D+ L L+ +NL    L +Q QAS++    +  E++      S
Sbjct: 77  RNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSS 136

Query: 124 LHSLKETFTDAVVDEDNGSE--DVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQ 181
           L +L     D   + +N  E  + IN L+ P+NPL + IP W+P FPPDHTYKFTP++N 
Sbjct: 137 LAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFNH 196

Query: 182 PITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDA---DGASYDEALVREETAAIY 238
           PITD   I++ IV E ++SE ALL+L K+++  + +S+     G   ++A+  E+   I+
Sbjct: 197 PITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAI--EQQLEIW 254

Query: 239 GNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIK 298
           GN  ++RK   +  S       + N  IE+YA+ RVE+AR++V ++E  Q+K  +NPF+K
Sbjct: 255 GNALEERKPTITEKS-----FNENN--IEQYAKYRVELARERVTKFEVNQLKRTKNPFLK 307

Query: 299 YSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQ 358
            S+      S     +   + I    ++S+   + ++P++Q  K++  R A+++R + L+
Sbjct: 308 ISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEERAKSLK 367

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  197 bits (502), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 205/374 (54%), Gaps = 26/374 (6%)

Query: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69
           +QLT+LP L E+ H + +A V++IL K+V  QL  +   IS FA + ++ L+  Q++ M 
Sbjct: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGMF 76

Query: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKE 129
             LH  + +QRR  +++ D+ L  + +NL  A L +Q Q S++    +  E++ L  +K 
Sbjct: 77  RNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKL--VKS 134

Query: 130 TFTDAV----------VDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQY 179
           +   AV          ++     ++ IN L+ P+NPL + IP W+P FPPDHTYKFTP++
Sbjct: 135 SSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEF 194

Query: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALVREETAAIYG 239
           N PITD   I+R IV E  +SE ALL+L K +   + +S        +A    E   I+G
Sbjct: 195 NHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWG 254

Query: 240 NEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKY 299
           N   +RK    + S       + N  IE+YA+ R+E+AR++V ++E  Q+K  +NPF+K 
Sbjct: 255 NTLHERKPAIIAKS-----FNEKN--IEQYAKYRIELARERVSKFEVNQLKRTKNPFLKI 307

Query: 300 SKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDA-------RRKAEQK 352
           S+   S  +     +   R I   L++S+   + ++P++Q  K++        R+K+ ++
Sbjct: 308 SESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKR 367

Query: 353 RDERLQELRDKKAQ 366
           R E L   R KK Q
Sbjct: 368 RQEELISQRKKKEQ 381

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  157 bits (398), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 118/389 (30%), Positives = 213/389 (54%), Gaps = 40/389 (10%)

Query: 7   ERHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQ 64
           +R ++L  LP L+E+ H      + ++ ++AV LQLK +  +  IS+ AF+ L  +   Q
Sbjct: 18  QRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQ 74

Query: 65  LNDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL 124
           L+D++  L + + VQRR  I+K D++L+ +G  +   DL+ Q + S +    +  E ++L
Sbjct: 75  LDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANAL 134

Query: 125 H----SLKETFTDAVVDEDNGSE----------DVINELVRPNNPLIRYIPKWMPAFPPD 170
           +     +K+ F   + +++  S           D++N L+  +N   +Y+P W+P  PPD
Sbjct: 135 NETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILN-LLPSSNKSNKYVPSWLPELPPD 193

Query: 171 HTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLK---NMNPPTP-SSDADGASYD 226
           HTYKFT  Y +PITDE ++++++++EG+ SE ALL++L    N +P    + D+D ++ +
Sbjct: 194 HTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANN 253

Query: 227 EAL---VRE---ETAAIYGNEQKKRKKNASSSSDLLSKL------PQTNFSIEEYARSRV 274
            AL   ++E   ET  I+   +         ++ +L  +      P  NF++ EY + R 
Sbjct: 254 AALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRD 313

Query: 275 EIARKKVVEYEERQMKLQRNPFIKYSKIA--LSNSSDKSGRRQATREIHSMLQRSLQHLI 332
            I +++    E +    +RNPFI+ + I       S KS R+    ++ +ML+RS   LI
Sbjct: 314 AIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKS-RKSVENQLKTMLRRSYLGLI 372

Query: 333 KSIPELQMTKQDARRKAEQKRDERLQELR 361
            SIP ++  ++ AR++AE+ R+  LQE R
Sbjct: 373 DSIPRVKEVRERARKEAEE-RERLLQEQR 400

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/381 (29%), Positives = 188/381 (49%), Gaps = 64/381 (16%)

Query: 20  EIDHGKTEAAVVKILSKAVALQLKPMKADISKFA--------FEHLMILIDDQLNDMIGQ 71
           E+ H   +A V ++L+ +VA Q+    A              F+ L+ L+++QL+ M+ +
Sbjct: 25  ELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVEEQLSGMVTE 84

Query: 72  LHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKET- 130
           LHR + VQRR+     DV L LQG+ LTP D+++Q     Y SK  G  ++ +   +E  
Sbjct: 85  LHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQ----MYLSKKIG--YNRMQVPREQT 138

Query: 131 --FTDAVVDED---------------NGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTY 173
               DA    D               +GS D+  EL     P+   IP W+P  PP+HTY
Sbjct: 139 VQLQDATGSYDRFKLVENQQLIASGLSGS-DMSQEL-----PIAEKIPAWLPKLPPNHTY 192

Query: 174 KFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEA----- 228
           KFT +YN+ + DE +++ +I+ E  + EV+L +L++N +      DAD    + A     
Sbjct: 193 KFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCD-----RDADTKVDERARETPP 247

Query: 229 ----LVREETAAIYGNEQKKRKKNASSSSDLLSKL-PQTNFSIEEYARSRVEIARKKVVE 283
                + +E  A+YG  ++  +++    +   + L  + +F ++ Y+  RV++AR  V  
Sbjct: 248 EELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAVQR 307

Query: 284 YEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIK-SIPELQMTK 342
           +E       RNPF+   +    NS          ++++SML+ SL  L++  +P L+  K
Sbjct: 308 FEWETKYRPRNPFLCSHRAVPENS----------KKVYSMLENSLNELVQVDLPRLESRK 357

Query: 343 QDARRKAEQKRDERLQELRDK 363
             A   A ++RD +L ELR K
Sbjct: 358 AAAIAHAVEQRDAKLAELRAK 378

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 119/224 (53%), Gaps = 41/224 (18%)

Query: 33  ILSKAVALQLKPMKADIS--KFAFEHLMILIDDQLNDMIGQLHRFSNVQRRESIAKGDVH 90
           +L +AV +QL+ +  D++  + A + L++  +DQLN ++  LHR S +QRR+SIA  D+ 
Sbjct: 37  LLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLE 96

Query: 91  LFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLHSLKETFTDAVVDEDNGSEDVIN--- 147
           ++++GYNL P+DL    + S++  + Y    D+    K+   D  ++   G  ++ N   
Sbjct: 97  IWMRGYNLLPSDLYMTAEESKFIRENYRN--DTSVVFKDINIDNPMESALGRINIQNKEN 154

Query: 148 ----------------ELV----------------RPNNPLIRYIPKWMPAFPPDHTYKF 175
                           EL+                R  N  +RY P W+P FPPDHTYK+
Sbjct: 155 IEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGRGRN--LRYKPGWLPDFPPDHTYKY 212

Query: 176 TPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSD 219
           TP Y   +  ET IR+++V+EG+ SE AL+ L+ N++  + + D
Sbjct: 213 TPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDSISTTKD 256

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 65/109 (59%), Gaps = 8/109 (7%)

Query: 263 NFSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHS 322
           +F +E YAR R+EIAR+KVV++E  Q+ L+ NP ++ +K+   ++ +         E   
Sbjct: 397 DFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESD----FETEYQK 452

Query: 323 MLQRSLQHLIKSIPELQMTKQDARRKAEQKRDE----RLQELRDKKAQK 367
            ++R++    ++IP ++  ++  R+++ +++DE    RL  +++ K +K
Sbjct: 453 CIKRTMDRFKRNIPIIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKK 501

>NDAI0A06780 Chr1 complement(1545760..1547622) [1863 bp, 620 aa]
           {ON} Anc_3.154
          Length = 620

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 289 MKLQRNPFI----KYSKIALSNSSDK-----SGRRQATREIHSMLQRSLQHLIKSIPELQ 339
           M++ + PFI    K  +I +S S D      SG         +  ++ L+  IK+  ELQ
Sbjct: 1   MQIWQLPFIHRAVKGIRIVMSKSKDTVKTSISGANDDNNNKSTEFEKHLEKEIKTAKELQ 60

Query: 340 MTKQDARRKAEQKRDERLQELRDKKAQKLK 369
           + KQ  RRK E  R  +  ELRDK   KL+
Sbjct: 61  INKQ-KRRKVENSRAAKTVELRDKNGFKLR 89

>KLLA0B05841g Chr2 complement(522241..527877) [5637 bp, 1878 aa]
           {ON} highly similar to uniprot|P38631 Saccharomyces
           cerevisiae YLR342W FKS1 Catalytic subunit of 1 3-beta-D-
           glucan synthase functionally redundant with alternate
           catalytic subunit Gsc2p binds to regulatory subunit
           Rho1p involved in cell wall synthesis and maintenance
           localizes to sites of cell wall remodeling or
           uniprot|P40989 Saccharomyces cerevisiae YGR032W GSC2
          Length = 1878

 Score = 37.0 bits (84), Expect = 0.14,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y++ I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 838 MPTFT-----VLTPHYSERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 885

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA  GNE+   K+    S
Sbjct: 886 FVKDTKILAEETAAFEGNEEDSEKEGGMKS 915

>KAFR0F03830 Chr6 (750178..755715) [5538 bp, 1845 aa] {ON} Anc_4.173
           YLR342W
          Length = 1845

 Score = 37.0 bits (84), Expect = 0.17,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 816 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 863

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSSSDLL 256
              D  ++ EETAA  G EQ+  K +A S  D L
Sbjct: 864 FVKDTKILAEETAAYEGVEQELEKDDAKSEIDDL 897

>NCAS0A02040 Chr1 (387566..393079) [5514 bp, 1837 aa] {ON} Anc_4.173
          Length = 1837

 Score = 35.8 bits (81), Expect = 0.38,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y++ I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 804 MPTFT-----VLTPHYSERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----LEWDC 851

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETA   GNE++  K +A  S
Sbjct: 852 FVKDTKILAEETAIYEGNEEETDKDDAMKS 881

>YLR342W Chr12 (809997..815627) [5631 bp, 1876 aa] {ON}
           FKS1Catalytic subunit of 1,3-beta-D-glucan synthase,
           functionally redundant with alternate catalytic subunit
           Gsc2p; binds to regulatory subunit Rho1p; involved in
           cell wall synthesis and maintenance; localizes to sites
           of cell wall remodeling
          Length = 1876

 Score = 35.4 bits (80), Expect = 0.50,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + + 
Sbjct: 839 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWEC 886

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA  GNE +  K++A  S
Sbjct: 887 FVKDTKILAEETAAYEGNENEAEKEDALKS 916

>Kpol_499.12 s499 complement(30272..35971) [5700 bp, 1899 aa] {ON}
           complement(30272..35971) [5700 nt, 1900 aa]
          Length = 1899

 Score = 34.7 bits (78), Expect = 0.79,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + + 
Sbjct: 859 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWEC 906

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA  GN++   K NA  S
Sbjct: 907 FVKDTKILAEETAAYDGNDEDPEKANALKS 936

>Smik_12.429 Chr12 (748638..754274) [5637 bp, 1878 aa] {ON} YLR342W
           (REAL)
          Length = 1878

 Score = 34.3 bits (77), Expect = 1.0,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + + 
Sbjct: 841 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWEC 888

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA  GNE    K++A  S
Sbjct: 889 FVKDTKILAEETAAYEGNEDDPEKEDALKS 918

>YGR032W Chr7 (548264..553951) [5688 bp, 1895 aa] {ON}
           GSC2Catalytic subunit of 1,3-beta-glucan synthase,
           involved in formation of the inner layer of the spore
           wall; activity positively regulated by Rho1p and
           negatively by Smk1p; has similarity to an alternate
           catalytic subunit, Fks1p (Gsc1p)
          Length = 1895

 Score = 33.9 bits (76), Expect = 1.2,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 858 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 905

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA   NE +  K++A  S
Sbjct: 906 FVKDTKILAEETAAYENNEDEPEKEDALKS 935

>Skud_12.427 Chr12 (750276..755927) [5652 bp, 1883 aa] {ON} YLR342W
           (REAL)
          Length = 1883

 Score = 33.9 bits (76), Expect = 1.4,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + + 
Sbjct: 846 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWEC 893

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA  GNE    K++A  S
Sbjct: 894 FVKDTKILAEETAAYEGNENDIEKEDALKS 923

>ZYRO0A12518g Chr1 (992718..998369) [5652 bp, 1883 aa] {ON} highly
           similar to uniprot|P38631 Saccharomyces cerevisiae
           YLR342W FKS1 Catalytic subunit of 1 3-beta-D- glucan
           synthase functionally redundant with alternate catalytic
           subunit Gsc2p binds to regulatory subunit Rho1p involved
           in cell wall synthesis and maintenance localizes to
           sites of cell wall remodeling or uniprot|P40989
           Saccharomyces cerevisiae YGR032W GSC2
          Length = 1883

 Score = 33.9 bits (76), Expect = 1.5,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 167 FPPDHTYKFT---PQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
            P D+   FT   P Y++ I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 840 LPVDNMPTFTVMTPHYSERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 892

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSSSDL 255
              D  ++ EETAA  GN++    K  +  S +
Sbjct: 893 FVKDTKILAEETAAYEGNDEDVENKEDALKSQI 925

>Kwal_YGOB_14.1365 s14 (293772..295589,295591..298827) [5055 bp,
           1685 aa] {ON} ANNOTATED BY YGOB - Edited to add a
           ribosomal frameshift. Undefined sequence at stop codon.
          Length = 1685

 Score = 33.5 bits (75), Expect = 1.7,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 13/90 (14%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y++ I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 866 MPTFT-----VLTPHYSERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 913

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSS 252
              D  ++ EETAA  G E+   K+    S
Sbjct: 914 FVKDTKILSEETAAYEGGEEDSEKEGGLKS 943

>SAKL0B04158g Chr2 (370872..376583) [5712 bp, 1903 aa] {ON} highly
           similar to uniprot|P38631 Saccharomyces cerevisiae
           YLR342W FKS1 Catalytic subunit of 1 3-beta-D- glucan
           synthase functionally redundant with alternate catalytic
           subunit Gsc2p binds to regulatory subunit Rho1p involved
           in cell wall synthesis and maintenance localizes to
           sites of cell wall remodeling
          Length = 1903

 Score = 33.1 bits (74), Expect = 2.1,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 41/94 (43%), Gaps = 13/94 (13%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 863 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 910

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSSSDLL 256
              D  ++ EETA   GNE  +++    S  D L
Sbjct: 911 FVKDTKILAEETAVYEGNEDPEKEDGLKSQIDDL 944

>KNAG0D03920 Chr4 (710373..716012) [5640 bp, 1879 aa] {ON} Anc_4.173
           YLR342W
          Length = 1879

 Score = 33.1 bits (74), Expect = 2.2,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 13/94 (13%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y++ I    +  R I+ E  Q S V LL  LK ++P     + + 
Sbjct: 846 MPTFT-----VLTPHYSERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWEC 893

Query: 223 ASYDEALVREETAAIYGNEQKKRKKNASSSSDLL 256
              D  ++ +ETAA  G E++++   ASS  D L
Sbjct: 894 FVKDTKILADETAAFEGIEEQEKGDLASSDVDDL 927

>NCAS0J00760 Chr10 complement(118763..124375) [5613 bp, 1870 aa]
           {ON} Anc_4.173
          Length = 1870

 Score = 33.1 bits (74), Expect = 2.6,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 37/84 (44%), Gaps = 13/84 (15%)

Query: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQ-SEVALLHLLKNMNPPTPSSDADG 222
           MP F        TP Y + I    +  R I+ E  Q S V LL  LK ++P     + D 
Sbjct: 833 MPTFT-----VLTPHYAERIL---LSLREIIREDDQFSRVTLLEYLKQLHP----VEWDC 880

Query: 223 ASYDEALVREETAAIYGNEQKKRK 246
              D  ++ EETAA  GNE    K
Sbjct: 881 FVKDTKILAEETAAYEGNEDDGEK 904

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 215 TPSSDADGASYDEALVREETAAIYGNEQKKRKKNASSSSDLLSKLPQ 261
           TP SDA  A +     +   AA+ G E K+RK + S++  LL++ PQ
Sbjct: 602 TPPSDASPAPFS----KNTGAAVEGTEPKRRKPSTSATKSLLAQSPQ 644

>Smik_15.130 Chr15 (222948..225233) [2286 bp, 761 aa] {ON} YOL036W
           (REAL)
          Length = 761

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 255 LLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKL 291
           ++S LPQ N SIE     +   +RK  V +EER  KL
Sbjct: 326 IISGLPQNNSSIERNLSRKSNRSRKTTVTFEERLQKL 362

>SAKL0G00704g Chr7 complement(64152..67577) [3426 bp, 1141 aa] {ON}
            similar to uniprot|P36161 Saccharomyces cerevisiae
            YKR082W NUP133 Subunit of the Nup84p subcomplex of the
            nuclear pore complex (NPC) localizes to both sides of the
            NPC required to establish a normal nucleocytoplasmic
            concentration gradient of the GTPase Gsp1p
          Length = 1141

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 88   DVHLFLQGYNLTPAD--LDKQHQASQYYSKTYGKEFDSLHSLKETF 131
            D  LFL G  L   +  LDK     +Y+S  YGK  D++  L+E F
Sbjct: 1051 DEELFLSGCALPEWNILLDKSILTQEYFSAAYGKFCDNIEGLEEAF 1096

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,898,340
Number of extensions: 2472209
Number of successful extensions: 14628
Number of sequences better than 10.0: 214
Number of HSP's gapped: 15042
Number of HSP's successfully gapped: 231
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)