Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005808.839ON71371335500.0
ZYRO0G14168g8.839ON76463426540.0
CAGL0M02959g8.839ON75863924970.0
KAFR0B039108.839ON72464224630.0
Kpol_1068.98.839ON74563924120.0
NCAS0C004208.839ON72563624120.0
TBLA0D032608.839ON76867823540.0
NDAI0K004208.839ON77869123120.0
TPHA0I002408.839ON73264622860.0
YMR277W (FCP1)8.839ON73274422660.0
Smik_13.4908.839ON73274022410.0
Skud_13.4498.839ON73464822350.0
Suva_13.4658.839ON73273722280.0
KNAG0J002808.839ON74274221700.0
SAKL0D01496g8.839ON68863221400.0
Kwal_27.102638.839ON74363320870.0
Ecym_46108.839ON75164120700.0
KLTH0C03894g8.839ON74560120640.0
ABL127W8.839ON72863620410.0
KLLA0D01595g8.839ON71962119330.0
Kpol_1010.615.94ON932961111e-04
TPHA0H010705.94ON1015881010.002
YLR019W (PSR2)5.202ON39745980.003
SAKL0G12870g5.202ON39960970.004
NDAI0D018605.202ON51451980.004
TPHA0E030705.202ON494121970.005
NCAS0A068005.202ON47351960.006
Smik_12.825.202ON39245960.006
NDAI0C032305.94ON103479940.015
Skud_12.875.202ON39245920.018
YLL010C (PSR1)5.202ON42742890.040
Smik_12.535.202ON41442890.042
Ecym_20665.94ON880115890.048
ZYRO0B10428g5.202ON48240890.049
Suva_10.655.202ON41542880.051
Suva_10.995.202ON38545870.077
Skud_12.5457.514ON700115870.084
Skud_8.492.530ON447106860.093
KAFR0E021405.94ON95187870.094
KNAG0M017405.202ON48145850.11
NDAI0I021705.202ON39145840.15
Skud_12.575.202ON41540840.16
TPHA0N006705.202ON45241840.18
TBLA0C060905.202ON484122830.24
AAL158W5.202ON47840820.33
SAKL0G15620g5.94ON87995820.33
NCAS0D027405.202ON39845810.36
Kpol_2002.1005.202ON47745810.36
TBLA0I014602.530ON393103810.37
KNAG0C058502.530ON443107810.39
Ecym_44607.111ON731102810.45
YHR004C (NEM1)2.530ON446106790.63
KLLA0F15620g5.202ON41445790.65
Kpol_478.165.202ON35094790.65
TDEL0E042705.202ON45340780.76
CAGL0D03234g5.202ON41045780.83
Ecym_71045.202ON49240771.1
KAFR0J009905.202ON48345771.2
CAGL0D05610g5.202ON44740771.2
KAFR0A065604.156ON55570761.5
TBLA0H019905.202ON68840761.5
NCAS0J008804.156ON56655761.8
KNAG0B018301.276ON75266752.0
Ecym_50527.46ON87395752.1
KLLA0F14300g1.276ON66936752.3
SAKL0H20592g4.156ON50835752.4
Suva_16.2498.527ON480171742.4
TPHA0A051105.94ON106560733.7
NDAI0G055201.276ON83251733.8
AFR095C1.276ON67040734.2
Smik_16.1728.527ON477100724.3
Ecym_72764.156ON59354724.4
Suva_8.4007.46ON985125726.0
YOR346W (REV1)7.46ON985113716.3
ADR369C7.46ON827119716.8
YPL063W (TIM50)8.527ON476171707.0
Skud_10.3201.114ON655126717.2
Kpol_367.97.46ON880117717.7
KLLA0C06116g6.32ON78570709.7
Kpol_1050.635.94ON105869709.8
KLLA0E15621g5.94ON891175709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00580
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...  1372   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...  1026   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   966   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   953   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   933   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   933   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   911   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   895   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   885   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   877   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   867   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   865   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   862   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   840   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   828   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   808   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   801   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   799   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   790   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   749   0.0  
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    47   1e-04
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    44   0.002
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    42   0.003
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    42   0.004
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     42   0.004
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    42   0.005
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    42   0.006
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    42   0.006
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    41   0.015
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    40   0.018
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    39   0.040
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    39   0.042
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    39   0.048
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    39   0.049
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    39   0.051
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    38   0.077
Skud_12.545 Chr12 complement(973113..975215) [2103 bp, 700 aa] {...    38   0.084
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    38   0.093
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    38   0.094
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    37   0.11 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.15 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    37   0.16 
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    37   0.18 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.24 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    36   0.33 
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    36   0.33 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    36   0.36 
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    36   0.36 
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    36   0.37 
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    36   0.39 
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    36   0.45 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    35   0.63 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    35   0.65 
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    35   0.65 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    35   0.76 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    35   0.83 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    34   1.1  
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    34   1.2  
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    34   1.2  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    34   1.5  
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    34   1.5  
NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {...    34   1.8  
KNAG0B01830 Chr2 complement(341951..344209) [2259 bp, 752 aa] {O...    33   2.0  
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    33   2.1  
KLLA0F14300g Chr6 complement(1325862..1327871) [2010 bp, 669 aa]...    33   2.3  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    33   2.4  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    33   2.4  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    33   3.7  
NDAI0G05520 Chr7 complement(1356809..1359307) [2499 bp, 832 aa] ...    33   3.8  
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    33   4.2  
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    32   4.3  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    32   4.4  
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    32   6.0  
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    32   6.3  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    32   6.8  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    32   7.0  
Skud_10.320 Chr10 complement(570536..572503) [1968 bp, 655 aa] {...    32   7.2  
Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON} ...    32   7.7  
KLLA0C06116g Chr3 complement(536524..538881) [2358 bp, 785 aa] {...    32   9.7  
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    32   9.8  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    32   9.9  

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score = 1372 bits (3550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/713 (93%), Positives = 667/713 (93%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60
           MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60

Query: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120
           VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE
Sbjct: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120

Query: 121 SEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTI 180
           SEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTI
Sbjct: 121 SEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTI 180

Query: 181 GEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKV 240
           GEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKV
Sbjct: 181 GEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKV 240

Query: 241 APLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMV 300
           APLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMV
Sbjct: 241 APLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMV 300

Query: 301 VVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQESDEL 360
           VVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQESDEL
Sbjct: 301 VVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQESDEL 360

Query: 361 ITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASLEVQQQ 420
           ITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASLEVQQQ
Sbjct: 361 ITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASLEVQQQ 420

Query: 421 NRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMK 480
           NRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMK
Sbjct: 421 NRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMK 480

Query: 481 SKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARI 540
           SKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARI
Sbjct: 481 SKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARI 540

Query: 541 AKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRXXXXXX 600
           AKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARR      
Sbjct: 541 AKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRSSALAE 600

Query: 601 XXXXXXXXXXKNGTINLFAGGTSWLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNQV 660
                     KNGTINLFAGGTSWLN                              QNQV
Sbjct: 601 QEMELAMESAKNGTINLFAGGTSWLNDDDDDEMPDGLDDSDDEDDDDEQEEEKTEDQNQV 660

Query: 661 VDGHTSQPKRSLENDHDSLGDSSPYKKSHVDELKQDNDSDSEIEEELLNALDE 713
           VDGHTSQPKRSLENDHDSLGDSSPYKKSHVDELKQDNDSDSEIEEELLNALDE
Sbjct: 661 VDGHTSQPKRSLENDHDSLGDSSPYKKSHVDELKQDNDSDSEIEEELLNALDE 713

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/634 (76%), Positives = 549/634 (86%), Gaps = 8/634 (1%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGG----H 56
           M TPV +PE LPYPITIDQLIAPIGS V+KGQRLFA+KFWYMVEIASSPDEN+G     H
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116
            KKTVRESIEFFE+PFEGDL+SW VD GDEV +  Q ICEI RPCNHD+VYGGLCT+CGK
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 117 EVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGV 176
           EVDE++Q   NLAISHTD NLKVSRKEA D+E+ LK RLR+SKKLVLVVDLDQTVIHCGV
Sbjct: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180

Query: 177 DPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEF 236
           DPTIGEWK+D SNPNYE LKDVQ F+L+EEPI+P +YMGP+ P RKCWY+VKVRPGL+EF
Sbjct: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240

Query: 237 FDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTD 296
           F ++APL+EMHIYTMATR YALEIAKIIDPDGSLFGDRILSRDENGS+TQKSLERLFPTD
Sbjct: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300

Query: 297 QSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQE 356
           QSMV+VIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQ+ +LQLGR   KK QE
Sbjct: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360

Query: 357 SDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASLE 416
           SDEL+TDIMDTEK+LQEKIDEEVKRQEEKL+HQ+ + +E    ESK+QL KKLEYSASLE
Sbjct: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEYSASLE 420

Query: 417 VQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLL 476
           VQQQNRPLATLQKHMHNQRLLVDDDDEL YL++ LAK+H +YYK L + +E  ADI++L+
Sbjct: 421 VQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSADIQSLV 480

Query: 477 PLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTY 536
           P MK +VF+DC+FVFSGLIPLGTNI RADIVLWT MFGA +S EID++TTHVIT+TPGTY
Sbjct: 481 PTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGTY 540

Query: 537 KARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARR-- 594
           KARIAK FNEN+KVVHPDWVFECLV+W HVDEKPYELI++  AT+EE+ D+K+K+ +R  
Sbjct: 541 KARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRKIEQRHL 600

Query: 595 --XXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
                             ++ T+NLFAGGTSWLN
Sbjct: 601 IEEQRREQFESEALMKTAQDSTLNLFAGGTSWLN 634

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 3/47 (6%)

Query: 669 KRSLEN-DHDSLGDSSPYKKSHVDELK--QDNDSDSEIEEELLNALD 712
           KR+L+N D  S  D    KK H++  K  +++DS+S++EEELLNALD
Sbjct: 717 KRALQNSDSQSSEDQPSQKKVHLENSKGNREDDSESDLEEELLNALD 763

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/639 (71%), Positives = 539/639 (84%), Gaps = 13/639 (2%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHR--- 57
           M+TPV +P  LPYPIT+D+L+ PIGS+VEKGQRLFA+KFWYMVEIA+SPD+N+  +    
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 58  ----KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113
               K+ VRESIEF+EAPFEGDL+SWNVD  DE+  PN A+CEI RPCNHDIVYGGLCT+
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 114 CGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173
           CGKEVDE +Q + NL ISHTD NL+VSRKEA D++  + TRL+  KKLVLVVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233
           CGVDPTIGEWK D SNPNYE LKDV+ F+L+EEPILPL+YMGPKPPVR CWYYVK+RPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293
           KEFF+K+APL+EMHIYTMATRAYALEIAKIIDPD SLFGDRILSRDENGS+TQKSL RLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353
           PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+QQ TMLQLGR  R+K
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360

Query: 354 TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSA 413
            +ES+EL+TDIMDTEKKLQEKIDEEVKRQEEKLNHQMA+ EE    ESK+++AKKLE+SA
Sbjct: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKKLEFSA 420

Query: 414 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEK-KADI 472
           SLEVQQQNRPLA LQKH+H+QRLL+DDDDEL YL++ LA +H E+Y  L   S++ +ADI
Sbjct: 421 SLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEADI 480

Query: 473 KTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRT 532
             LLP +K KVF++CHFVFSGLIPLGT+I RADIV+WT++FGA+S+ +ID+ TTHV+T+T
Sbjct: 481 TMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTKT 540

Query: 533 PGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLA 592
           PGTYKAR+AKAFN +IKVVHPDW+FECL SWK +DEKPY LIVEQ  +++EL ++K+KL 
Sbjct: 541 PGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLE 600

Query: 593 RRXXXXXXXXXXXXXXXXKNG-----TINLFAGGTSWLN 626
           ++                +       T+ LF G TSWLN
Sbjct: 601 QKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLN 639

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/642 (70%), Positives = 526/642 (81%), Gaps = 16/642 (2%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDEN-------E 53
           MTTPV +PE LPYPITID+LI PIG+++EKG RLFA+KFWYMVEIASSPD+N       +
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 54  GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113
             H KK +RESIEFF+APFEG L+SWN+DVGDE+ + +Q ICEI RPCNHDIVYGGLCT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 114 CGKEVDESEQ--FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTV 171
           CGKEVDESEQ  F  N  +SHTD NLK+SRKEA DI  + K RLR  KKLVLVVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 172 IHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRP 231
           IHCGVDPTIGEWK D +NPNY+ LKDVQ FAL+EEP+LP +YMGPKP  RKCWYYVKVRP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 232 GLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLER 291
           GLKEFF KVAPLFEMHIYTMATRAYALEI KIIDP G LFG+RILSRDENGS+T KSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 292 LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGAR 351
           LFPTDQSMV++IDDRGDVWNW PNLIKVVPY+FFVGVGDINSNFLP+QQ TMLQLGR +R
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 352 KKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEY 411
           +K +E+DEL+TDIMDTEKKLQEKIDEEVKRQE+ L+HQ+   EE  + E+K++  KKLE+
Sbjct: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKKLEH 420

Query: 412 SASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDS--EKK 469
           SAS+EVQQQNRPLA LQ+H+HNQRLL+DDDDEL +L++ LAKVH+EYY  L   S  E  
Sbjct: 421 SASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDESG 480

Query: 470 ADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVI 529
           ADIK ++P +K  VFE CHFVFSGLIPL T+I RADIV+WT+MFGA+SS EI++ TTHVI
Sbjct: 481 ADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHVI 540

Query: 530 TRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQ 589
           T+TPGT+KAR+AK+FN +IK+VHPDWVFECL+ W HVDEKPY LIVE+  +D EL  +++
Sbjct: 541 TKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFRE 600

Query: 590 -----KLARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
                KL  R                 + T++LFA GTSWLN
Sbjct: 601 DLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWLN 642

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/639 (69%), Positives = 522/639 (81%), Gaps = 16/639 (2%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGG----H 56
           M+TPV +P  LPYPITI +LIA IGSHVEKGQRLFA+KFWY+VEIA SPDEN+ G    H
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116
            KK++RESIEFF++PFEGDL+SWNVDVGDE+V PNQ ICEI RPCNHDIVY G+CT+CGK
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 117 EVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGV 176
           EVDES+Q + NL ISHTD NLKVSR+EA DI   +K RL   KKL+LVVDLDQTVIHCGV
Sbjct: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCGV 180

Query: 177 DPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEF 236
           DPTI EWK D +NPN+E L+DV+SF L+EEPILP +YMGPKPP  KCWYYVK+RPGLKEF
Sbjct: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240

Query: 237 FDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTD 296
           F++V+ L+EMHIYTMATR+YA EIAKIIDPDG+LF DRILSR+ENGS+T KSLERLFPTD
Sbjct: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300

Query: 297 QSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQE 356
           QSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLPRQQ TMLQLGR   KKT++
Sbjct: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360

Query: 357 SDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMAS-GEEVPAPESKDQLAKKLEYSASL 415
           +DEL+TDIMDTEKKLQEKIDEEVKRQEE L+HQ A+ GEE+ +   K+ + KK+E+SASL
Sbjct: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420

Query: 416 EVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTL 475
           EVQQQNRPLA LQKHMHNQ+LL DDDDEL YL++IL  V  +YY+ L  D  K+  I+TL
Sbjct: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTD--KEIQIQTL 478

Query: 476 LPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGT 535
           +P +K KV E C+FVFSGLIPLGTNI +ADIVLWTNMFGAQSS +I + TTHVIT+TP T
Sbjct: 479 MPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHT 538

Query: 536 YKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARR- 594
           YKA+IAKAF  +IKV+HPDWVFECL++WK++ E PYE  +  TATD+EL ++K+ L RR 
Sbjct: 539 YKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRK 598

Query: 595 --------XXXXXXXXXXXXXXXXKNGTINLFAGGTSWL 625
                                   +  +++LFA G SWL
Sbjct: 599 KKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/636 (68%), Positives = 528/636 (83%), Gaps = 10/636 (1%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGH---- 56
           M+T + +P  LPYPITIDQLI  +G  V+KG RL A+KFW++V++ASSPD+N+       
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116
            KK++RESIEFFE+P++G L+SWNVD+GDE+ +PNQ + EI RPCNHD+VYGGLCTLCG+
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 117 EVDESEQ----FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVI 172
           EVDE +        NL ISHTD NLK+S +EA DI  N++TRLR+ KKLVLVVDLDQTVI
Sbjct: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180

Query: 173 HCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPG 232
           HCGVDPTIGEWK D  NPN+E LKDV+ F+L+EEPILP LYMGPKPP+RKCWYYVKVRPG
Sbjct: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240

Query: 233 LKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERL 292
           LKEF +K+APLFEMHIYTMATRAYA EIAKIIDP+G LFGDRILSRDENGS+T KSLERL
Sbjct: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300

Query: 293 FPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARK 352
           FPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFLP+QQ TMLQLGR +R+
Sbjct: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360

Query: 353 KTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVP--APESKDQLAKKLE 410
           K++++++L+ DIMD+EKKL+EKID+EVKRQEE+L+HQ A+ EE P  A E+K++++KK+E
Sbjct: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420

Query: 411 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKA 470
           YSASLEVQQQNRPLA LQKH H+QRLL+DDDDEL +L++ L ++HD+YY  L +D E KA
Sbjct: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480

Query: 471 DIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVIT 530
           DIK ++P MK  V ++C FVFSGLIPLGT+I RADIV+WTN FGA S+ +ID+ TTHVIT
Sbjct: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540

Query: 531 RTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQK 590
           +TPGTYKAR+AK+FN  IK++HPDWVFECL SWKHVDEKPYELIVEQ  ++ EL ++K+K
Sbjct: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600

Query: 591 LARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
           LA+R                 +  + LF+GG SWL+
Sbjct: 601 LAKRQLLATANENLSPANGTNSAELELFSGGMSWLD 636

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/678 (64%), Positives = 524/678 (77%), Gaps = 55/678 (8%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENE------- 53
           M+TPV SP  LP+PITIDQLI PIGSHVEKGQRLFA+KFWYMVEIA SPD N+       
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 54  ---------------GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEIS 98
                            H+KK++RESIEFFE+PFEGDL+ WNVD GDE+++ NQ +C+I 
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 99  RPCNHDIVYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRES 158
           RPCNHDIVY G+CT CGKEVD+S+  + +L+ISHTD NLK+SRKEA DI+ +  +RL++ 
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 159 KKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKP 218
           KKL+LVVDLDQTVIHCGVDPTIGEWK D  NPNYE LKDV+SF+LDEEPILP  YMGP+P
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 219 PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSR 278
           PVRKCWYYVKVRPGLKEFF K+APL+EMHIYTMATRAYALEIAKIIDPDGSLFG RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 279 DENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 338
           DENGS+TQKSLERLFPTDQSMV++IDDRGDVWNWC NLIKV+PYNFFVG+GDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 339 QQNTMLQLGRGARKKTQ----------------------ESDELITDIMDTEKKLQEKID 376
           QQ+TMLQLG  + KK                        +++EL+TDIMDTEKKLQ+KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 377 EEVKRQEEKL-NHQMASGEEVPAPESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQR 435
           EEV+RQE+KL   +M   + +    S ++L+KK+E+SASLEVQQQNRPLATLQ+H  NQR
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 436 LLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLI 495
           LL+DDDDEL YL++IL +VHD +Y+ L +D  +   I+TL+P +K  VF   +FVFSGLI
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540

Query: 496 PLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDW 555
           PLGT+I RADIVLWTNMFGA S+ +ID++TTHVIT+T GTYKAR+AKAFN  IKVVHPDW
Sbjct: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600

Query: 556 VFECLVSWKHVDEKPYELIVEQTAT-------DEELGDYKQKLARRXXXXXXXXXXXXXX 608
           +FECLVSWK + EKPYELI+EQ A+        ++L    + L +R              
Sbjct: 601 IFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKR---EMETEAQFEAL 657

Query: 609 XXKNGTINLFAGGTSWLN 626
             ++  I+LFA GTSWLN
Sbjct: 658 NTRDPAIDLFASGTSWLN 675

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/691 (63%), Positives = 532/691 (76%), Gaps = 66/691 (9%)

Query: 1   MTTP--VFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENE----- 53
           M TP  + +P  LPYPITID+L+ PIG+ + K  RL A+KFWY+VEIA+SPDE E     
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 54  ---------------GGHR--------------------------KKTVRESIEFFEAPF 72
                           G+                           KKTVRESIEFF+ P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 73  EGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDESE--QFNG-NLA 129
           +G L SW V+ GD++V PNQ +CEI RPCNHD++YGGLCTLCGKEVDE++    +G NL 
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 130 ISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSN 189
           ISHTD NLK+S +EA DI  ++K RLR+ KKL+LVVDLDQTVIHCGVDPTIGEWKRD +N
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 190 PNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIY 249
           PN+E LKDV+ FAL+EEPILPL+YMGPKPP RKCWYYVKVRPGLK+FF KVAPLFEMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 250 TMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMVVVIDDRGDV 309
           TMATRAYA EIAKIIDP G LFG+RILSRDENGS+T KSLERLFPTDQSMV++IDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 310 WNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARK-----KTQESDELITDI 364
           WNW PNLIKV+PYNFFVGVGDINSNFLP+QQ TMLQLGR + +      T+E+D+L+TDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 365 MDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVP--APESKDQLAKKLEYSASLEVQQQNR 422
           MDTEK LQ KI+EEVKRQEEKLNHQ+A+ EE P  A E+K++++KK+EYSASLEVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 423 PLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKK----ADIKTLLPL 478
           PLATLQKH H+QRLL+DDD+EL +L++ L+K+H +YY+ L + +E K     DIK ++P 
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 479 MKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKA 538
           MK  V +DCHFVFSGLIPLGTNI ++DIV+WTNMFGA+S+ +ID++TTHVIT+TPGTYKA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 539 RIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRXXXX 598
           R+AK+++ +IK+VHPDWVFECL+ WKHV+EKPYEL+VEQ  +D+EL D+ +KL RR    
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 599 XXXXXXXXXXXXKNGT----INLFAGGTSWL 625
                               +NLFAGGTSWL
Sbjct: 661 ELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/646 (66%), Positives = 511/646 (79%), Gaps = 22/646 (3%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDE-------NE 53
           M TPV  P+ +PYPITI +LIAP+GS++ KG RLFA+KFWY+VEIA SPDE        +
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 54  GGHRKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTL 113
           G   KKT+RESI+FF+APFEG ++ WNVDVGDE+V P + +CE+ RPC+HDIVY G+CT+
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 114 CGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173
           CGKEVDE +Q + NL ISHTD NLKVSR+EA +I    K+RL  SKKL+LVVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233
           CGVDPTI EWK D SNPNYE L++V+SF L+EE ILP +YMGPKPPV KC YYVKVRPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293
           KEFF+KVAP++EMHIYTMATRAYA EIAKIIDPDGSLFG+RILSRDENGS+T KSLERLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353
           PTDQSMVV+IDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLPRQQ TMLQ+GR     
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 354 --TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMAS-GEEVPAPESKDQLAKKLE 410
              +ES+EL+TDI+DTEKKLQEKID+EVKRQE  L H+ A+ GEE  A      + KK+E
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 411 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKA 470
           +SASLEVQQQNRPLA LQKHMHNQ+LL DDDDEL+YL+EILA V  E+YK L   +    
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 471 D--IKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHV 528
           D  I+ L+P +K  VF+DC+FVFSGLIPLGT+I +ADIVLWT MFGA S+  I ++TTHV
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 529 ITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYK 588
           IT+TPGT KARIAK+FN +IKVVHPDWVFECL +WKHVDEK +EL V+Q A++ EL ++K
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERELEEFK 600

Query: 589 QKLARRXXXXXXXXXXXXXXXXKNGT---------INLFAGGTSWL 625
           + L +R                 NGT         ++LFAGG+SWL
Sbjct: 601 KNLEKR-NKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/744 (59%), Positives = 534/744 (71%), Gaps = 43/744 (5%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP--DENE----- 53
           MTT + SP+ LPYPI ID+LI  +GS++ +G RL  +KFWY+VE AS    D+NE     
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 54  GGHR--------KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDI 105
           GG           K +RESIEFFE+P+EGDL+SWNVDVGDEV   NQ ICEI RPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 106 VYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVV 165
           VYGGLCT CGKEV  ++ F+G       DV+L++S  EA      LK  LR  KKL+LVV
Sbjct: 121 VYGGLCTQCGKEV-SADAFDGVPLDVVGDVDLQISETEAIRTGKALKEHLRRDKKLILVV 179

Query: 166 DLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPK------PP 219
           DLDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM         PP
Sbjct: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRPPP 239

Query: 220 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRD 279
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+IAKI+DP G LFGDRILSRD
Sbjct: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRD 299

Query: 280 ENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQ 339
           ENGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q
Sbjct: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359

Query: 340 QNTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAP 399
              MLQLGR  R+K+QES EL+TDIMD EKKLQEKID+EVKRQEEKLNHQ+A+ EE PA 
Sbjct: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419

Query: 400 ESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYY 459
           ESK++L KKLEYSASLEVQQQNRPLA LQKH+H+Q+LLVDDDDEL YL   L+ +H  YY
Sbjct: 420 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHKTYY 479

Query: 460 KTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSP 519
             L Q +E + ++  ++P +K KVF++C+FVFSGLIPLGT+I R+DIV+WT+ FGA S+P
Sbjct: 480 DMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTP 539

Query: 520 EIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTA 579
           +ID  TTH+IT+ P TYKAR+AK FN  IK+VHPDW+FECLV+WK VDEKPY LIV+   
Sbjct: 540 DIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599

Query: 580 TDEELGDYKQKLARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLNXXXXXXXXXXXXX 639
           +DEEL +++ +L +R                +   +NLFA GTSWLN             
Sbjct: 600 SDEELQNFQTQLQKRQEYLEETQEQQHMLTSQEN-LNLFAAGTSWLNNDDDEDIPDTASD 658

Query: 640 XXXXXXXXXXXXXXXXXQNQVVDGHTSQPKRSLENDHDSLGDSSPYKK----------SH 689
                            +   +D      KRS+E++HD   D+S  K            H
Sbjct: 659 DDEDDDHDDESDDENNSEG--IDR-----KRSIEDNHD---DTSQKKTKAEPSQDGPVQH 708

Query: 690 VDELKQDNDSDSEIEEELLNALDE 713
             E   + DSDS++EEEL++ LD+
Sbjct: 709 KGEGDDNEDSDSQLEEELMDMLDD 732

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/740 (59%), Positives = 534/740 (72%), Gaps = 37/740 (5%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP--DENE----- 53
           MTT + SPE LPYPI ID+LI  +GS++ +G RL  +KFWY+VE AS    D+NE     
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 54  GGHR--------KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDI 105
           GG           K +RESIEFFE+P+EGDL+SWNVDVGDEV   NQ ICEI RPCNHDI
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 106 VYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVV 165
           VYGGLCT CGKEV  ++ F+G       D++L++S  EA      LK  LR  KKL+LVV
Sbjct: 121 VYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRTGKALKEHLRRDKKLILVV 179

Query: 166 DLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPK------PP 219
           DLDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM         PP
Sbjct: 180 DLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLRPPP 239

Query: 220 VRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRD 279
           VRKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+IAKI+DP G LFGDRILSRD
Sbjct: 240 VRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRILSRD 299

Query: 280 ENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQ 339
           ENGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q
Sbjct: 300 ENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQ 359

Query: 340 QNTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAP 399
              MLQLGR  R+K+QES EL+TDIMD EKKLQEKID+EVKRQEEKLNHQ+A+ EE PA 
Sbjct: 360 STGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPPAN 419

Query: 400 ESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYY 459
           ESK++L KKLEYSASLEVQQQNRPLA LQKH+H+Q+LLVDDDDEL YL   L+ +H  YY
Sbjct: 420 ESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHMTYY 479

Query: 460 KTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSP 519
           + L Q++E + ++  ++P +K KVF++C FVFSGLIPLGT+I R+DIV+WT+ FGA S+ 
Sbjct: 480 QMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTFGATSTS 539

Query: 520 EIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTA 579
           +ID  TTH+IT+ P TYKAR+AK FN  IK+VHPDW+FECLV+WK VDEKPY LIV+   
Sbjct: 540 DIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTLIVDSPI 599

Query: 580 TDEELGDYKQKLARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLNXXXXXXXXXXXXX 639
           +DEEL +++ +L +R                +   +NLFA GTSWLN             
Sbjct: 600 SDEELQNFQSQLQKRQEYLEENQEQQHMLTSQEN-LNLFATGTSWLNNDDDDDIPDTASD 658

Query: 640 XXXXXXXXXXXXXXXXXQNQVVDGHTSQPKRSLENDHDSLGD----SSPYKKSHVDELKQ 695
                            +   +D      KRS+E++H+        + P +   V + ++
Sbjct: 659 DDEDDEHNDESDEENHPEG--IDR-----KRSIEDNHEDTSQKKTKAEPLQDGPVQQKRE 711

Query: 696 ---DNDSDSEIEEELLNALD 712
              + DSDS++EEEL++ LD
Sbjct: 712 GDDNEDSDSQLEEELMDMLD 731

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/648 (64%), Positives = 500/648 (77%), Gaps = 24/648 (3%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP---DENEGGHR 57
           MTT + SPE LPYPI ID+L+  +GS++ +G RL  +KFWY+VE AS     D+NE    
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 58  -------------KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHD 104
                         K +RESIEFFE+P+EGDL+SWNVDVGDE+   NQ ICEI RPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 105 IVYGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLV 164
           IVYGGLCT CGKEV  ++ F+G       D++L++S  EA      LK  LR  KKL+LV
Sbjct: 121 IVYGGLCTQCGKEV-SADAFDGVPLDVVGDMDLQISETEAIRSGEALKEHLRRDKKLILV 179

Query: 165 VDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG------PKP 218
           VDLDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM         P
Sbjct: 180 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLKPP 239

Query: 219 PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSR 278
           PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA++IAKI+DP G LFGDRILSR
Sbjct: 240 PVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRILSR 299

Query: 279 DENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPR 338
           DENGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+
Sbjct: 300 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 359

Query: 339 QQNTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPA 398
           Q   MLQLGR  R+K+QES EL+TDIMD EKKLQEKID+EVKRQEEKLNHQ+A+ EE  A
Sbjct: 360 QSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEEPSA 419

Query: 399 PESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEY 458
            ESK++L KKLEYSASLEVQQQNRPLA LQKH+H+Q+LLVDDDDEL YL   L+ +H+ Y
Sbjct: 420 NESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHNTY 479

Query: 459 YKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSS 518
           Y+ + Q +E + ++  ++P +K KVF++CHFVFSGLIPLGT+I R+DIV+WT+ FGA S+
Sbjct: 480 YQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGATST 539

Query: 519 PEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQT 578
            +ID  TTH+IT+ P TYKAR+AK FN  IK++HPDW+FECLV+WK VDEKPY LIV+  
Sbjct: 540 SDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIVDSP 599

Query: 579 ATDEELGDYKQKLARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
            +DEEL +++++L +R                +   +NLFA GTSWLN
Sbjct: 600 ISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQEN-LNLFAAGTSWLN 646

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/737 (58%), Positives = 528/737 (71%), Gaps = 31/737 (4%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRK-- 58
           MTT + SPE LPYPI ID+LI  +GS +++G RL  +KFWY+VE  S   +++  H    
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 59  ------------KTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIV 106
                       K +RESIEFFE+P+EGDL+SWNVDVGDE+   NQ ICEI RPCNHDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 107 YGGLCTLCGKEVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVD 166
           YGGLCT CGKEV  ++ F+G       D++L++S  EA      LK  LR  KKL+LVVD
Sbjct: 121 YGGLCTQCGKEVS-ADAFDGVPLDVVGDMDLQISETEAIRTGRALKEHLRRDKKLILVVD 179

Query: 167 LDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG-----PKPP-V 220
           LDQT+IHCGVDPTI EWK D +NPN+E L+DV+SF LDEE +LPL+YM      PKPP V
Sbjct: 180 LDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPPPV 239

Query: 221 RKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDE 280
           RKCWYYVKVRPGLKEFF KVAPLFEMHIYTMATRAYAL+IAKI+DP G LFGDRILSRDE
Sbjct: 240 RKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSRDE 299

Query: 281 NGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQ 340
           NGS+T KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP+Q 
Sbjct: 300 NGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQS 359

Query: 341 NTMLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPE 400
             MLQLGR  R+K+QES ELITDIMD EKKLQEKID EVKRQEE+LNHQ+A+ EE  A E
Sbjct: 360 TGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEPSANE 419

Query: 401 SKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYK 460
           SK++L KKLEYSASLEVQQQNRPLA LQKH+H+Q+LLVDDDDEL+YL   L  +H  YY+
Sbjct: 420 SKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKTYYQ 479

Query: 461 TLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPE 520
            L Q  E + ++  ++P +K KVF++C+FVFSGLIPLGT+I R+DIV+WT+ FGA S+ +
Sbjct: 480 MLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATSTSD 539

Query: 521 IDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTAT 580
           I+  TTH+IT+ PGTYKAR+AK FN  IKVVHPDW+FECLV+WK VDEKPY LIV+   +
Sbjct: 540 INYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDSPIS 599

Query: 581 DEELGDYKQKLARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLNXXXXXXXXXXXXXX 640
           D+EL  ++++L ++                +   INLFA GTSWLN              
Sbjct: 600 DDELQSFQKQLQKKQEYLDEHHEQQHMLMPQEN-INLFAAGTSWLNDDDDEDIPDTASDD 658

Query: 641 XXXXXXXXXXXXXXXX-----QNQVVDGHTSQPKRSLENDHDSLGDSSPYKKSHVDELKQ 695
                                +  + DG    P++  + +H    +  P +  H +E + 
Sbjct: 659 DDDNDDNSESDDERDSGDIDRKRSIEDGQDEAPQKKTKAEHSQ--EDGPAQ--HEEEGEN 714

Query: 696 DNDSDSEIEEELLNALD 712
           + DSDS++EEEL+  LD
Sbjct: 715 NEDSDSQLEEELMGMLD 731

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/742 (57%), Positives = 530/742 (71%), Gaps = 37/742 (4%)

Query: 3   TPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGH------ 56
           TPV S   LPYP+T+D+LI  +G  V +G RLFA+KFWY+VE+A      EG        
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116
            KK+VRES+EFFE+PFEG ++SW+VD GDE+  P   +C + RPCNHD+VY GLCTLCG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 117 EVDESE---------QFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDL 167
           EVDE E             NL +SH D NL++SR EA  ++  L+ RLR ++KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 168 DQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPV-RKCWYY 226
           DQTV+HCGVDPTIGEWKRD  NPNYEAL+DVQSFAL+EEPILP LY+G K P  RKCWYY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 227 VKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQ 286
           VKVRPGLK+FF ++APLFEMHIYTMATRAYALEIAKIIDPD SLFGDRILSRDENGS+T 
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 287 KSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQL 346
           KSLERLFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINSNFLP+QQ TMLQ+
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 347 G-------RGARKKTQESDE----LITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEE 395
           G       RG   K Q+ D     L+TDIM+TEK+LQEKID+EVKRQE KLN   A+G+E
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 396 VPAP-ESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKV 454
              P +SK++  KKLE+SAS+EVQQ+NRPLATLQKH+HNQ+LLVD+DDEL YL++ LA +
Sbjct: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486

Query: 455 HDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFG 514
           H  YY TL +++ +  +I++++  +K++VF+DCHFVFSGLIPL TN+  ADIV+WTN FG
Sbjct: 487 HKRYYSTL-KENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFG 545

Query: 515 AQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELI 574
           A ++ ++D++TTH+IT+TPGT KAR+AKAFN +IK+VHPDW+FECL+ W+ VD KPY LI
Sbjct: 546 ATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605

Query: 575 VEQTATDEELGDYKQKLAR---RXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLNXXXXX 631
           VE   ++ ++ ++K+KL R   R                    I+LFAGG SWLN     
Sbjct: 606 VEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWLNDEDDE 665

Query: 632 XXXXXXXXXXXXXXXXXXXXXXXXXQNQVVDGHTSQPKRSLENDHDSLGDSSPYKKSHVD 691
                                      +   G T   +   EN      D    KK  + 
Sbjct: 666 EIPKEDEESEDDEDENDENNTTMLDDGEPETGGTPDKRSLFEN-----PDQPAEKKPRIQ 720

Query: 692 ELKQDNDSDSEIEEELLNALDE 713
           + +  ++SDSE+E+ELLN LD+
Sbjct: 721 DAEPSSESDSELEDELLNVLDD 742

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/632 (63%), Positives = 491/632 (77%), Gaps = 13/632 (2%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60
           MTT +  P+ LPYPITI QL A  G  ++KGQRLFA+K+W   ++ +SP++     +K+ 
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60

Query: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120
           V + I  F++P EG L+S+N+ +GDE V  N  + EI + C HD+ YGGLC +CGK V+E
Sbjct: 61  V-DLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEE 119

Query: 121 ------SEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHC 174
                 S+     L +SHT+ N+K+S ++A  IE   + +LR+ KKLVLVVDLDQTVIHC
Sbjct: 120 YSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHC 179

Query: 175 GVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLK 234
           GVDPTIGEW RD  NPNYEALKD++SFAL EEPILP  YMGPKPP RKCWYYVK+RPGLK
Sbjct: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239

Query: 235 EFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFP 294
           EFF+K+AP FE+HIYTMATRAYALEIAKIIDPDG LFGDRILSRDENGSIT KSLERLFP
Sbjct: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299

Query: 295 TDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKT 354
            DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLPRQQN+ML LGR  RKK 
Sbjct: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359

Query: 355 QESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSAS 414
           +E +EL+TDI+DTEKKLQEKIDEEVKRQEEKL+ +M   ++     SK+ LAKKLE+SAS
Sbjct: 360 EE-EELLTDILDTEKKLQEKIDEEVKRQEEKLS-KMTEEKQPEDTNSKEDLAKKLEHSAS 417

Query: 415 LEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKT 474
           LEVQQQNRPLA LQKH+HNQ+LL+DDDDEL +L  IL +VH +YY+ L + S    +IK 
Sbjct: 418 LEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHS-SPPNIKN 476

Query: 475 LLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPG 534
           L+P +K +VF  C FVFSGLIPLGT++ +ADI LWT+MFGA+++ +ID++TTH+IT+TPG
Sbjct: 477 LMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPG 536

Query: 535 TYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARR 594
           T+KAR+AKAFN  IKVVHPDW+FECLV+WK VDEK YEL++EQ  ++EEL D+K+KL   
Sbjct: 537 TFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENE 596

Query: 595 XXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
                            +  INL AG  SWL+
Sbjct: 597 KKDAQIQEEVDRVS---SDEINLLAGNDSWLD 625

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/633 (61%), Positives = 482/633 (76%), Gaps = 14/633 (2%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60
           MTTP+  P  LP+PITI +L    G  V KGQRLF +K+W + ++ ++P  NE   +KK 
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAP--NEEASKKKR 58

Query: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120
             + I  F++P EG L+S  V VGDE V  +  I E+ +PC+H++ YG LC +CGK VDE
Sbjct: 59  RVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDE 118

Query: 121 SEQ-------FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173
            +         NG L ++H + N+KVS ++A  IE   +  LRE KKLVLVVDLDQTVIH
Sbjct: 119 DDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIH 178

Query: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233
           CGVDPTI EW  D SNPNY+ALK+V++F+LDE+PILP  YMGP+PP R+C YYVK+RPGL
Sbjct: 179 CGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGL 238

Query: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293
           +EFFDKVAP FE+HIYTMATRAYALEIAKIIDP  +LFGDRILSRDENGS+T KSLERLF
Sbjct: 239 QEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLF 298

Query: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353
           P DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQN+ML +GR  RKK
Sbjct: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKK 358

Query: 354 TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSA 413
            +E +EL+TDIMDTEKKLQEKID+EVK+QEEK N +++   +     SK+ L KKLE++A
Sbjct: 359 AEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KISEENQPDRSMSKEDLTKKLEHNA 416

Query: 414 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIK 473
           SLEVQQQNRPLA LQKHM+NQ+LL+DDDDEL +L EIL  VH  YY+ L + +E   DIK
Sbjct: 417 SLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-TEVFPDIK 475

Query: 474 TLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTP 533
            L+P MK+KVF  CHFVFSGLIPLGTNI  ADIVLWTNMFGAQ+S +ID++TTHVIT+TP
Sbjct: 476 LLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTP 535

Query: 534 GTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLAR 593
           GT+KAR+AK++N +IK+VHPDW+FECLV W   DEKPYELI+EQ  + +EL ++++ L +
Sbjct: 536 GTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKK 595

Query: 594 RXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
           R                +   +NL AG   WL+
Sbjct: 596 RQMAEKAARESLQQETGEE--LNLLAGNDMWLD 626

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/641 (60%), Positives = 489/641 (76%), Gaps = 18/641 (2%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSP-DENEGGHRKK 59
           M+TP+  P+ LPYPIT+ QL    G  VE+GQRLFA+K+W   +I +SP DE+ GG  K+
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 60  TVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVD 119
              + +  F++P  G ++S N+ +GDE V     + EI +PC HD+ YGGLC  CG+ V 
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTV- 119

Query: 120 ESEQFNGNL-------AISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVI 172
           E EQ +G+L        +SHT++N+++S K+A  +E + + +LRE++KLVLVVDLDQTVI
Sbjct: 120 EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVI 179

Query: 173 HCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPG 232
           HCGVDPTIGEW +D  NPNYE+LKDV+SF+L EEP+LP  YMGPKPP RKCWYYVK+RPG
Sbjct: 180 HCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPG 239

Query: 233 LKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERL 292
           L++FF  +AP FE+HIYTMATR YALEIAKIIDPDG+LFGDRILSRDENGS+TQKSLERL
Sbjct: 240 LQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERL 299

Query: 293 FPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARK 352
           FP DQSMVV+IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLPRQQN+ML LGR  RK
Sbjct: 300 FPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRK 359

Query: 353 KTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVP-APESKDQLAKKLEY 411
           K ++ +EL+TDI+DTEKKL+ KI EEVKRQEE++  Q  S E++P    SK+ +AKKLE+
Sbjct: 360 KLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM--QKLSEEKIPDHTTSKEDIAKKLEH 417

Query: 412 SASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQD----SE 467
           +ASLEVQQQNRPLA LQKH+HN+RLL+DDDDEL +L +IL +VH  YY  L ++    +E
Sbjct: 418 NASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATE 477

Query: 468 KKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTH 527
              DIK L+P +K  VF+ C+FVFSGLIPL TNI+RADIVLWTN FGA+++  ID +TTH
Sbjct: 478 LSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTH 537

Query: 528 VITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDY 587
           +IT+TPGT KAR+A +FN +IK+VHPDW+FEC+V+WK VDEKPYELIVE+  + E L ++
Sbjct: 538 LITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENF 597

Query: 588 KQKL--ARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
           K++L    +                 N  + L  G  SWL+
Sbjct: 598 KKELEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD 638

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/601 (63%), Positives = 472/601 (78%), Gaps = 12/601 (1%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60
           MTTP+  P  LP+P+TI +L    G  V+KGQRLF +K+W + +I ++P  NE   +KK 
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAP--NEEAPKKKR 58

Query: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120
             + I  F++P EG L+S N+ +GDE V     I E+++ C+H++ YGGLC +CGK V+E
Sbjct: 59  RVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEE 118

Query: 121 SEQ-------FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173
            +Q        N  L ++H + N+KVS ++A  IE   +  LRE KKLVLVVDLDQTVIH
Sbjct: 119 DDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIH 178

Query: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233
           CGVDPTI EW  D SNPNY+ALK+V++F+LDE+PILP  YMGP+PP RKC YYVK+RPGL
Sbjct: 179 CGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGL 238

Query: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293
           +EFFDK+AP FE+HIYTMATRAYALEIAKIIDP G LFGDRILSRDENGS+T KSLERLF
Sbjct: 239 QEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLF 298

Query: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353
           P DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQN+ML LGR  RKK
Sbjct: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKK 358

Query: 354 TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSA 413
            +E +EL+TDIMDTEKKLQEKID+EVK+QEEK N ++    +   P SK+ L KKLE++A
Sbjct: 359 AEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEENQPERPISKEDLTKKLEHNA 416

Query: 414 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIK 473
           SLEVQQQNRPLA LQKHM+NQ+LL DDDDEL +L  IL  VH  YY  L +  +   DIK
Sbjct: 417 SLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ-PPDIK 475

Query: 474 TLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTP 533
           TL+P MKS+VF+ CHFVFSGLIPLGTN+ +ADIVLWT+MFGA +S ++D++TTHVIT+TP
Sbjct: 476 TLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTP 535

Query: 534 GTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLAR 593
           GT+KAR+AK +N NIKV+HPDW+FECLV W  V+EKPYEL  EQ  + EEL ++K++L +
Sbjct: 536 GTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDK 595

Query: 594 R 594
           +
Sbjct: 596 K 596

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/636 (61%), Positives = 480/636 (75%), Gaps = 23/636 (3%)

Query: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60
           M+TP+  P+ LPYPITI QL    G  VEKGQRL A+K+W +V++ ++P E E G  +K 
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60

Query: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEV-D 119
             + +  F++P  G ++S +V VGDE V   + + EI + C HD+ YGGLC  CG+ V D
Sbjct: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120

Query: 120 ESEQFNG----NLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCG 175
           E+   +G     L +SHT+ +++VS ++A  +  + + +LRE++KLVLVVDLDQTVIHCG
Sbjct: 121 EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG 180

Query: 176 VDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKE 235
           VDPTIGEW +D +NPNYEALKDVQSF+LDEEP+LP  YMGPKPP RKCWYYVK+RPGLKE
Sbjct: 181 VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE 240

Query: 236 FFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPT 295
           FF K+AP FE+HIYTMATRAYALEIAKIIDPDG LFGDRILSRDENGS+TQKSLERLFP 
Sbjct: 241 FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM 300

Query: 296 DQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQ 355
           DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQN+ML LGR  RKK +
Sbjct: 301 DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK 360

Query: 356 ESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASL 415
           + +EL+TDI+DTEKKL+EKI+EEVKRQE+++ H++   +    P+++D +AKKLE++ASL
Sbjct: 361 QEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDEK---LPDTRD-IAKKLEHNASL 415

Query: 416 EVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTL-----GQDSEKKA 470
           EVQQQNRPLA LQKHM N+RLL DDDDEL +L  IL KVH  YY  L     G+D     
Sbjct: 416 EVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDP--IP 473

Query: 471 DIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVIT 530
           DIK L+P +K  VFE C FVFSGLIPL TNI RADIVLWTNMFGA ++  +D +TTH+IT
Sbjct: 474 DIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLIT 533

Query: 531 RTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQK 590
           RTPGT KAR+AK+FN  IK+VHPDW+FECLV W+ V+E PYELIVE+   +E L ++K+ 
Sbjct: 534 RTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRD 593

Query: 591 LARRXXXXXXXXXXXXXXXXKNGTINLFAGGTSWLN 626
           LA                     ++ L  G  SWL+
Sbjct: 594 LAE------AQKKVDPPAQDSRSSLLLLDGNGSWLD 623

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/621 (58%), Positives = 458/621 (73%), Gaps = 11/621 (1%)

Query: 11  LPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKTVRESIEFFEA 70
           LPYPIT+ QL    G HVEKGQRLFA+++W   ++    +E      KK   + +  F++
Sbjct: 13  LPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEK----TKKQRVDRVATFDS 68

Query: 71  PFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDESEQFNGNLAI 130
           P  G +  W+  V DE  + N  +  I + CNHDI YGGLC  CG  VDE E  + NL I
Sbjct: 69  PVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDE-EDNSKNLTI 127

Query: 131 SHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNP 190
           SH + N+KVS ++A  +E +  TRLRE KKLVLVVDLDQTVIHCGVDPTIGEW RD  NP
Sbjct: 128 SHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGVDPTIGEWMRDPKNP 187

Query: 191 NYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYT 250
           NY+AL+DV+SF L++EPI+P  Y GPKPP RK WYYVK+RPGLKEFF+ V+P FEMHIYT
Sbjct: 188 NYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEFFEAVSPHFEMHIYT 247

Query: 251 MATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTDQSMVVVIDDRGDVW 310
           MATR+YA EIAKIIDP G LFGDRILSRDENGS+T KSLERLFP DQSMVVVIDDRGDVW
Sbjct: 248 MATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMDQSMVVVIDDRGDVW 307

Query: 311 NWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQESDELITDIMDTEKK 370
           NW  NLIKVVPY+FFVG+GDINSNFLPRQQN++L LGR  R+K QE ++LI+DI+D EKK
Sbjct: 308 NWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK-QEEEKLISDIIDNEKK 366

Query: 371 LQEKIDEEVKRQEEKLNH-QMASGEEVPAPESKDQLAKKLEYSASLEVQQQNRPLATLQK 429
           L+EKIDEEVKRQEE ++H    +  +   P +K+ ++KKLE+SASLEVQQQNRPLA LQK
Sbjct: 367 LKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQK 426

Query: 430 HMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHF 489
           H+HNQ LL+DDDDEL +L +IL +VH EY+    +  +   DIK LLP MK KVF+ CHF
Sbjct: 427 HLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHF 486

Query: 490 VFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIK 549
           VFSGLIPL T++ +ADIVLWT+MFGA +S +I+  TTH+IT T  T+KAR+AK+FN +IK
Sbjct: 487 VFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIK 546

Query: 550 VVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRXXXXXXXXXXXXXXX 609
           +VHPDW+FECLV W+ V E PYEL+++    ++++ ++K+KL ++               
Sbjct: 547 IVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKKISNPSSSVNPFEDGN 606

Query: 610 XKNGTI----NLFAGGTSWLN 626
                +    +L AG  SWL+
Sbjct: 607 EDEEVLGDEFHLLAGNDSWLD 627

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 10/96 (10%)

Query: 483 VFEDCHFVFSGLIPLGTNINRADIVLWT---NMFGAQSSPEIDDSTTHVITRTPG--TYK 537
           + +DC    S  +      NR + +L++   N  G   S  I + TTH+I+  P      
Sbjct: 122 ILKDCTIYVSRTV-----FNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALI 176

Query: 538 ARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYEL 573
           A +A   +  IK V+P W+ +C +  K+VDEK + L
Sbjct: 177 AIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFIL 212

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 501 INRADIVLWT---NMFGAQSSPEIDDSTTHVITRTPG--TYKARIAKAFNENIKVVHPDW 555
            N+ +++ ++   N  G  +   I   TTH+IT  P      A IA    +NI  V+P W
Sbjct: 132 FNKTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTW 191

Query: 556 VFECLVSWKHVDEKPYELIVEQTATDEE 583
           + +C  S   V+E  + + ++ +A D +
Sbjct: 192 LCQCFKSMTLVNESDHLINIQSSAEDSK 219

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF ++V+ L+E+ ++T +   YA  +   +DP+G++
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGS----LFGDRILSRDEN 281
           YV  RPG+ EF ++V  L+E+ ++T +   Y   +  I+DP G+    LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRIL 276
           YV  RPG+ EF +KV  LFE+ I+T +   Y   +   +DP G     R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 28/121 (23%)

Query: 156 RESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMG 215
           R  +K  L++DLD+T++H                    + K V S       ++P+    
Sbjct: 319 RFGRKKCLILDLDETLVHS-------------------SFKYVDSADF----VIPVTIDN 355

Query: 216 PKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRI 275
               V     YV  RPG+ EF  +V+ L+E+ ++T +   Y   +  I+DP  ++   R+
Sbjct: 356 QTHHV-----YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRL 410

Query: 276 L 276
            
Sbjct: 411 F 411

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRIL 276
           YV  RPG++EF  +V  LFE+ ++T +   Y   +  I+DP   L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V  L+E+ ++T +   YA  +   +DP+G++
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 511 NMFGAQSSPEIDDSTTHVITRT---PGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVD 567
           N  G   +  I++ TTH+I      P     +     N  IK V+P W+ +C    K++D
Sbjct: 158 NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYID 217

Query: 568 EKPYELIVEQTATDEELGD 586
           E P+ LI E     E L D
Sbjct: 218 ESPH-LITEDQNNSEHLDD 235

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 48/114 (42%), Gaps = 13/114 (11%)

Query: 475 LLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPG 534
           L    K K+F+    + +     G    R+ I   T M G  S+ E+    TH+++R P 
Sbjct: 348 LFEPFKKKIFKSSELILTYTNYFGRQ--RSYIQRLTEMLGGISTTELSKRNTHLVSRMPV 405

Query: 535 TYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYK 588
             K   AK + +  +V++  W+           E+ Y+  ++Q     E  D+K
Sbjct: 406 GKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDFK 448

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V+ ++E+ ++T +   YA  +   +DP+G++
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPD 267
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPD 267
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD 323

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 480 KSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMF---GAQSSPEIDDSTTHVITRTPGTY 536
           K+   +DC+   S         + A+  L+T+M    G      +    TH+IT  P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 537 KARIAKAFNE-NIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQK 590
              + K FN+  +  V   W+ EC V  ++V E  Y  +V    ++EE+    +K
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY--LVGSEMSNEEVTALAEK 222

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG+ EF  KV  LFE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPD 267
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 324

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V+ L+E+ ++T +   YA  +   +DP+ ++
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>Skud_12.545 Chr12 complement(973113..975215) [2103 bp, 700 aa] {ON}
           YLR452C (REAL)
          Length = 700

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 27  HVEKGQRLFAF--KFWYMVEIASSPDENEGGHRKKTVRESIEFFEAPFEGDLMSWNVDVG 84
           HV++   L A   K   +V +   P   +   +K  +  S  F  +    DL+SW     
Sbjct: 314 HVKEAVSLAALFLKMGLIVPVLLQPSRTDK--KKFQISRSSFFTLSELGWDLVSWKSCKS 371

Query: 85  DEVVAPNQAICEISRPCNHDIVYGGLCTLCG--KEVDESEQFNGNLAISHTDVNL 137
           + V+APN      SRP   D  + G  T+    K +DE+E F  ++ IS TD +L
Sbjct: 372 NNVLAPN------SRPMGLDFTFTGHVTVRDERKTLDENESFPQDILISSTDHSL 420

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 22/106 (20%)

Query: 152 KTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPL 211
           K+ L   KK  LV+DLD+T+IH     T        SN +   L +V+ F +   P L  
Sbjct: 243 KSILNTQKKKKLVIDLDETLIHSASRSTT------HSNSSQGHLVEVK-FGISGIPTL-- 293

Query: 212 LYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA 257
                        Y++  RP    F  KV+  +++ I+T + + YA
Sbjct: 294 -------------YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 38.1 bits (87), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 504 ADIVLWTNM---FGAQSSPEIDDSTTHVITRTPGTYKARIAKA-FNENIKVVHPDWVFEC 559
           ++ +L+T +    G      I++ TTH+IT  P      I K     +IK ++P W+  C
Sbjct: 140 SEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIYPTWLIHC 199

Query: 560 LVSWKHVDEKPYELIVEQTATDEELGD 586
           +   + +DE  +E IV  T   E+L D
Sbjct: 200 VKESQLIDESEHE-IVPFTDDTEKLND 225

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D D S+
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +VA L+E+ ++T +   Y   +  I+D   S+
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG++EF ++V  LFE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDP 266
           YV  RPG+ EF   V  L+E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 29/122 (23%)

Query: 156 RESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPL-LYM 214
           ++  K  L++DLD+T++H           +  +NP++               ILP+ +  
Sbjct: 308 KDKHKKCLILDLDETLVHSSF--------KFINNPDF---------------ILPIEIED 344

Query: 215 GPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDR 274
           G    V     YV  RPG+  F  +V   +E+ I+T +   YA  +  ++D D +L   R
Sbjct: 345 GQIHNV-----YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHR 399

Query: 275 IL 276
           + 
Sbjct: 400 LF 401

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG+ EF  +V  LFE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 2/95 (2%)

Query: 473 KTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRT 532
           K LL  ++ K+F     + S    LG    R  I       G  S+ E+    THV++  
Sbjct: 330 KLLLSPLRPKIFHKNELLLSYTNYLGQQ--RFYIQKLVEALGGASTTELSKKNTHVLSCM 387

Query: 533 PGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVD 567
           P   K + A  +++  KVV+  W+ EC    K +D
Sbjct: 388 PYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLD 422

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D   S+
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  I+D   S+
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 155 LRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYM 214
           L+ +K+  L++DLD+T+IH     ++      S+  NY  ++             P    
Sbjct: 187 LKTNKRKKLILDLDETLIH-----SMSRNISSSTISNYHLIE----VKFPTPTSAPTSAP 237

Query: 215 GPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA 257
           GP  P+    YYV  RP    F + V+  +++ I+T + + YA
Sbjct: 238 GPSLPLSSL-YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYA 279

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 24/107 (22%)

Query: 152 KTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQ-SFALDEEPILP 210
           K+ L   KK  LV+DLD+T+IH           R +++PN      V+  F++     L 
Sbjct: 241 KSILNREKKKTLVMDLDETLIHS--------VSRGTTHPNSSQGHIVEVKFSISGVSTL- 291

Query: 211 LLYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA 257
                         YYV  RP    F  KV+  +++ I+T + + YA
Sbjct: 292 --------------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYA 324

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 10/102 (9%)

Query: 268 GSLFGDRILSRDENGSITQKSLERLFPTDQSMVVVIDDRGDVWNWCP---NLIKVVPYNF 324
           G L   R LS+ +   +    LER      S+V + D R +++N+ P   N+IK+  +NF
Sbjct: 90  GGLTSLRGLSKSKPNRLAH-GLERCLFEPMSIVPLKDRRSNIYNFKPFLENIIKLKDFNF 148

Query: 325 FVGVGDINSNFLPRQQNT-MLQLGRGARKKTQESDELITDIM 365
                D  + F+P   ++ +L+L R   KK   S   IT ++
Sbjct: 149 -----DAITGFVPPSLDSRLLELARKHSKKYVSSTSSITGML 185

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 22/106 (20%)

Query: 152 KTRLRESKKLVLVVDLDQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPL 211
           K+ L   KK  LV+DLD+T+IH     T        SN +   L +V+ F L     L  
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGLSGIRTL-- 293

Query: 212 LYMGPKPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYA 257
                        Y++  RP    F  KV+  +++ I+T + + YA
Sbjct: 294 -------------YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  ++  L+E+ ++T +   Y   +  I+D D ++
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDE----N 281
           YV  RPG+  F    + LFE+ I+T +   Y   +  I+D    L   R+  RD     N
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 282 GSITQKSLERLFPTDQSMVVVIDDRGDVWNWCPN 315
           G+  +   +   P   S ++++D+    + + PN
Sbjct: 276 GNYIKNLAQLGRPL--SDIIILDNSPTSYLFHPN 307

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D   S+
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSL 270
           YV  RPG+ EF  +V  +FE+ ++T +   Y   +  ++D   S+
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI 395

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG+ EF  +V  L+E+ ++T +   Y   +  ++D
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 5/70 (7%)

Query: 500 NINRADIVLWTNMFGA---QSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWV 556
           NI+   I     + GA   Q    ID  TTH I        A + +A N NI +V P+W+
Sbjct: 186 NISEEQIEKCLQVIGAKPLQKHVSID--TTHFICNDEEEEDAELIRAKNSNIPIVRPEWI 243

Query: 557 FECLVSWKHV 566
             C V  + V
Sbjct: 244 RACAVEKRIV 253

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 226 YVKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIID 265
           YV  RPG+ +F + V+ +FE+ ++T +   Y   +  ++D
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {ON}
           Anc_4.156 YLR330W
          Length = 566

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 534 GTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYK 588
           G     + KA N NI +V P+W+  C V  + V  + + +  E T +D    DYK
Sbjct: 224 GEEDEELQKAKNNNIPIVKPEWIRACCVEKRIVGVRAFYVGAESTVSD----DYK 274

>KNAG0B01830 Chr2 complement(341951..344209) [2259 bp, 752 aa] {ON}
           Anc_1.276 YJL090C
          Length = 752

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 523 DSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYEL---IVEQTA 579
           + +++VI  +   +  RI  A  E+I +VHP W+ +C      ++  P+ L   ++ Q  
Sbjct: 162 NPSSNVIFISDTLHGVRIESAMAEDIPIVHPKWIMDCHRRHGTLEYDPFYLTKNVLNQ-- 219

Query: 580 TDEELG 585
           +DE++G
Sbjct: 220 SDEQIG 225

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 6/95 (6%)

Query: 482 KVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIA 541
           +VFE C    +G         R +IVL    F    + + D   TH++ +     K    
Sbjct: 89  RVFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQNLSAAKCIEF 146

Query: 542 KAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVE 576
           +    N KVV P W+  C+   K +  + Y +IV 
Sbjct: 147 R----NFKVVQPGWIGACVRIGKMLSWREYSVIVR 177

>KLLA0F14300g Chr6 complement(1325862..1327871) [2010 bp, 669 aa]
           {ON} similar to uniprot|P47027 Saccharomyces cerevisiae
           YJL090C DPB11 Essential BRCT repeat protein required on
           the prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 669

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 539 RIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELI 574
           R+  A  EN+ VVHP W+ +C+     +D + + L+
Sbjct: 169 RVQAALEENVPVVHPKWIIDCMDRSGTLDFQSFYLL 204

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 525 TTHVITRTPGTYKARIAKAFNENIKVVHPDWVFEC 559
           TTH I     +    + KA N NI VV P+WV  C
Sbjct: 211 TTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRAC 245

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 75/171 (43%), Gaps = 22/171 (12%)

Query: 230 RPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDP-----DGSLFGDRILSRDENGSI 284
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP       +LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 285 TQKSLERLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYNFFVGVGDIN-SNFLPRQQNT 342
             K L +L   D S V++ID   + +   P N I + P+N   G  D      +P  +  
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN---GEADDKLVRLIPFLEYL 335

Query: 343 MLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASG 393
             Q  +  R         I D    +K L  + D  VK+ ++K + + ++G
Sbjct: 336 ATQQTKDVRP--------ILDSFQDKKNLATEFDHRVKKLKDKFHGERSNG 378

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%)

Query: 513 FGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYE 572
            G +S+P +    TH+I   P   K   A++    I VV+  W+ +C++    V E  +E
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>NDAI0G05520 Chr7 complement(1356809..1359307) [2499 bp, 832 aa]
           {ON} Anc_1.276 YJL090C
          Length = 832

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 532 TPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKP---YELIVEQTA 579
           T   Y AR+  A +ENI +VH  WV +C +    ++  P    E +V++T 
Sbjct: 172 TDSIYGARVEAARDENIPIVHHKWVIDCHIRGAKLEFDPDYLLENVVDKTT 222

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 546 ENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELG 585
           + + VVHP WV +C+     V+ + YEL     A  EE+G
Sbjct: 176 QGVAVVHPKWVTDCVRRGAVVEMEEYELARWAGAAWEEVG 215

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 230 RPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDP-----DGSLFGDRILSRDENGSI 284
           RPG   F   ++  FE+ +++     Y+ +IA+ +DP       +LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 285 TQKSLERLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYN 323
             K L +L   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 525 TTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQT 578
           TTH +     +    +A+A N NI VV P+W+  C +  + V  + + L V+ +
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDSS 264

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 52/125 (41%), Gaps = 6/125 (4%)

Query: 464 QDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDD 523
           QD   K   K L+      +F++C    +G    G       IVL    F    S +   
Sbjct: 147 QDQILKNQYKGLISSQNGNLFKNCVIYINGYTKPGRLQLHEMIVLHGGKFLHHLSAK--K 204

Query: 524 STTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEE 583
             TH++  +    K RI  A   N KVV+PDW+ +C+   + +  + Y L  +     ++
Sbjct: 205 RVTHIVA-SNLPLKKRIEFA---NYKVVNPDWITDCIKERRLLPWQNYSLTAKLDEQQKK 260

Query: 584 LGDYK 588
           L + K
Sbjct: 261 LDNCK 265

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 8/113 (7%)

Query: 446 YLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRAD 505
           Y RE  A  H++ +    QD   K   K  +    SK+F++C    +G    G       
Sbjct: 130 YTRE--AYFHEKAHGQTLQDQILKDQYKDQISSQSSKIFKNCVIYINGYTKPGRLQLHEM 187

Query: 506 IVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFE 558
           IVL    F    S +   + TH++       K RI  A   N KVV PDW+ +
Sbjct: 188 IVLHGGKFLHYLSSK--KTVTHIVASNL-PLKKRIEFA---NYKVVSPDWIVD 234

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 10/119 (8%)

Query: 455 HDEYYKTLGQDSEKKADIKTLLPLMKSK--VFEDCHFVFSGLIPLGTNINRADIVLWTNM 512
           + EY+  +G+   +KA  + L  +  ++  +F  C    +G         R +IV+    
Sbjct: 15  YREYF--VGKQRLQKAQEEQLRGVCGARTPIFRGCRVHVNGHTDPDREELRREIVMHGGT 72

Query: 513 FGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPY 571
           F    +   D   TH++       K R+  A     KVV P WV  CL S + V  KPY
Sbjct: 73  FVHYLARPSD--VTHIVAEHVPVAKRRLWHA----CKVVRPAWVSACLCSGELVPWKPY 125

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 74/171 (43%), Gaps = 22/171 (12%)

Query: 230 RPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDP-----DGSLFGDRILSRDENGSI 284
           RPG   F   ++  +E+ +++     Y+ +IA+ +DP       +LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 285 TQKSLERLFPTDQSMVVVIDDRGDVWNWCP-NLIKVVPYNFFVGVGDIN-SNFLPRQQNT 342
             K L +L   D S V++ID   + +   P N I + P+N   G  D      +P  +  
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN---GEADDKLVRLIPFLEYL 330

Query: 343 MLQLGRGARKKTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASG 393
             Q  +  R         I +  + +K L E+ D  VK+ ++K      SG
Sbjct: 331 ATQQTKDVRP--------ILNSFEDKKNLAEEFDHRVKKLKDKFYGDHKSG 373

>Skud_10.320 Chr10 complement(570536..572503) [1968 bp, 655 aa] {ON}
           YJR098C (REAL)
          Length = 655

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 22/126 (17%)

Query: 376 DEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQR 435
           ++E+K Q+E +   M +   +   +   +L KKLE + +L+VQQ            ++ R
Sbjct: 286 EDELKTQKEIIPDGMVT--HIGPVDVSKRLIKKLEANPNLKVQQFG----------YDWR 333

Query: 436 LLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADI--KTLLPLMKSKVFEDCHFVFSG 493
           L +D   E  +LR  L  +++E      Q S+K   I   ++  L+  KV +DC  +  G
Sbjct: 334 LSLDISAE--HLRSKLQNIYNE------QKSKKGVYIIAHSMGGLVAHKVLQDCTHLIRG 385

Query: 494 LIPLGT 499
           +I +G+
Sbjct: 386 IIYVGS 391

>Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON}
           complement(31451..34093) [2643 nt, 881 aa]
          Length = 880

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 21/117 (17%)

Query: 480 KSKVFEDCHFVFSGLIPLGTNINRAD----IVLWTNMFGAQSSPEIDDSTTHVI-TRTPG 534
           K K+FE+C    +G     TN +R      IV+    F    S +   S TH++ ++ P 
Sbjct: 91  KLKIFENCTIYING----HTNPDRLKLHELIVIHGGKFLHFLSAK--GSATHIVASKLPL 144

Query: 535 TYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKL 591
             K   A     N KVV+PDW+   + + K +  + Y L+     +D   G  K KL
Sbjct: 145 KKKLEYA-----NYKVVNPDWIMNSINAGKLLPWQEYSLV-----SDVNFGQSKLKL 191

>KLLA0C06116g Chr3 complement(536524..538881) [2358 bp, 785 aa] {ON}
           similar to uniprot|P04786 Saccharomyces cerevisiae
           YOL006C TOP1 topoisomerase I
          Length = 785

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 338 RQQNTMLQLGRGARKKTQESDELITDIMDTE-----KKLQEKIDEEVKRQEEKLNHQMAS 392
           R +  +LQL +  RKK Q   + I D+   E     K++ E+  E+ KR+ E+ N +   
Sbjct: 602 RYKRAILQLDKSERKKNQNYFKEIDDLTKEEELTIHKRIIEREREKYKRKFERENEKRKF 661

Query: 393 GEEVPAPESK 402
            +E P P+S+
Sbjct: 662 SKEDPIPDSQ 671

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 32/69 (46%)

Query: 503 RADIVLWTNMFGAQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVS 562
           R  I   TN  G  ++  +      ++   P   K + A+ + + + +V P+W+ EC  +
Sbjct: 361 RTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYKA 420

Query: 563 WKHVDEKPY 571
            K +D K +
Sbjct: 421 NKKLDPKLF 429

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 70/175 (40%), Gaps = 24/175 (13%)

Query: 442 DELNYLREILAKVHDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDC-------------- 487
           D+  +L +   ++H    K++     + A    L+P++  K  + C              
Sbjct: 57  DKGQFLSQFSEQIHCIISKSIDFSFYRTAAFDFLIPVVDPKWIDHCLQFKRLMRTTCYSP 116

Query: 488 ---HFVFSGLIPLGT-NINRADIVLW---TNMFGAQSSPEIDDSTTHVITRTPGTYKARI 540
              HF+    I +   ++N  +  L+    ++FG      +    TH+IT        + 
Sbjct: 117 DPMHFLKDCYIYVSKHSLNVVEYQLYCAIVSVFGGTCMDYLSTKATHIITWDKNDVAIKA 176

Query: 541 AKAFNE-NIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARR 594
            + F++  +  + P+W+ +CL   +++ E  Y  ++     D  L +  QKL  R
Sbjct: 177 MQKFHKYTVIYLMPNWLVDCLCGLEYIKEDEY--LINVNEDDLALKEKSQKLWDR 229

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,797,400
Number of extensions: 3584078
Number of successful extensions: 19959
Number of sequences better than 10.0: 321
Number of HSP's gapped: 20424
Number of HSP's successfully gapped: 350
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)