Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005708.840ON63063033050.0
YMR278W (PGM3)8.840ON62261821160.0
Suva_13.4668.840ON62262020680.0
Smik_13.4918.840ON62261920680.0
Skud_13.4508.840ON62262020530.0
NCAS0C004108.840ON62561820450.0
Kpol_1068.88.840ON63262819810.0
NDAI0K004108.840ON62661919660.0
SAKL0D01474g8.840ON62462319640.0
KNAG0J002708.840ON62562019570.0
ZYRO0G14190g8.840ON61061719460.0
KAFR0B039208.840ON62461419110.0
TPHA0I002508.840ON62962519010.0
CAGL0M02981g8.840ON61761518590.0
Kwal_27.102588.840ON62062618450.0
TBLA0B032508.840ON64364518220.0
KLTH0C03872g8.840ON62162317980.0
ABL126W8.840ON62463017960.0
KLLA0D01573g8.840ON60762717840.0
Ecym_46118.840ON63062617690.0
TBLA0G009806.11ON5581321010.001
KLTH0C11506g6.11ON54491970.004
CAGL0B03597g6.11ON54046970.004
NCAS0F002006.11ON54932960.006
Kpol_1032.26.11ON53930940.009
TDEL0G046006.11ON52831940.010
KNAG0E009406.11ON538119930.012
TBLA0B090102.445ON569302930.014
Smik_5.296.11ON55573920.015
YEL058W (PCM1)6.11ON55773920.017
KAFR0L003406.11ON54031920.019
ACR015W6.11ON55299910.020
Skud_5.316.11ON55744900.029
SAKL0E00902g6.11ON544101900.032
Suva_5.106.11ON55344900.032
NDAI0K028906.11ON56130900.033
ZYRO0F00506g6.11ON55046880.050
Kpol_1033.542.445ON570128880.055
Kwal_56.223556.11ON54127870.069
CAGL0K07480g2.445ON567578860.099
NCAS0F014702.445ON569299850.13
KLLA0D00858g6.11ON54119830.22
TPHA0M002106.11ON54530830.22
SAKL0E03630g2.445ON571303800.42
Suva_1.1083.176ON27072780.54
Ecym_30146.11ON55122790.58
Smik_11.1122.445ON570126780.92
KNAG0A062802.445ON570130771.2
Skud_11.1022.445ON570125761.2
YMR105C (PGM2)2.445ON569127761.4
Smik_13.2912.445ON569127761.4
KAFR0D030102.445ON569146761.5
TBLA0I013802.445ON571298751.6
NDAI0H023502.445ON569299751.7
NCAS0A043502.445ON569127742.5
ZYRO0G09702g4.90ON81458733.8
Skud_13.2632.445ON569127723.9
Kwal_26.76282.445ON570127724.2
Ecym_47137.361ON215490724.6
YKL127W (PGM1)2.445ON570128714.8
ZYRO0G02508g2.445ON569291715.2
KNAG0E023902.445ON569127715.6
ABL029W2.445ON568294707.6
TPHA0G024702.445ON569129707.7
Kpol_526.355.629ON65576698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00570
         (630 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...  1277   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   819   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   801   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   801   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   795   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   792   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   767   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   761   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   761   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   758   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   754   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   740   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   736   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   720   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   715   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   706   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   697   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   696   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   691   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   686   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    44   0.001
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    42   0.004
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    42   0.004
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    42   0.006
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    41   0.009
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    41   0.010
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    40   0.012
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    40   0.014
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    40   0.015
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    40   0.017
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    40   0.019
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    40   0.020
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    39   0.029
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    39   0.032
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    39   0.032
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.033
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    39   0.050
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    39   0.055
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    38   0.069
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    38   0.099
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    37   0.13 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    37   0.22 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    37   0.22 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    35   0.42 
Suva_1.108 Chr1 (168573..169385) [813 bp, 270 aa] {ON} YAR035W (...    35   0.54 
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    35   0.58 
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    35   0.92 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               34   1.2  
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    34   1.2  
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    34   1.4  
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    34   1.4  
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    34   1.5  
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    33   1.6  
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    33   1.7  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    33   2.5  
ZYRO0G09702g Chr7 complement(769394..771838) [2445 bp, 814 aa] {...    33   3.8  
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    32   3.9  
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    32   4.2  
Ecym_4713 Chr4 complement(1394882..1401346) [6465 bp, 2154 aa] {...    32   4.6  
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    32   4.8  
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    32   5.2  
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    32   5.6  
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    32   7.6  
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    32   7.7  
Kpol_526.35 s526 complement(84706..86673) [1968 bp, 655 aa] {ON}...    31   8.8  

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 1277 bits (3305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/630 (97%), Positives = 614/630 (97%)

Query: 1   MTGRIIQSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTR 60
           MTGRIIQSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTR
Sbjct: 1   MTGRIIQSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTR 60

Query: 61  ILFGTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFAL 120
           ILFGTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFAL
Sbjct: 61  ILFGTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFAL 120

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYS 180
           ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYS
Sbjct: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYS 180

Query: 181 NGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQ 240
           NGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQ
Sbjct: 181 NGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQ 240

Query: 241 SLVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSF 300
           SLVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSF
Sbjct: 241 SLVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSF 300

Query: 301 PTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIG 360
           PTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIG
Sbjct: 301 PTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIG 360

Query: 361 ALFAFXXXXXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNR 420
           ALFAF                HPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNR
Sbjct: 361 ALFAFYEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNR 420

Query: 421 TLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLED 480
           TLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLED
Sbjct: 421 TLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLED 480

Query: 481 IFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLG 540
           IFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLG
Sbjct: 481 IFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLG 540

Query: 541 YQSDTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSE 600
           YQSDTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSE
Sbjct: 541 YQSDTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSE 600

Query: 601 ERASELAQLTWRVLKREWFRPDVTGLTTTF 630
           ERASELAQLTWRVLKREWFRPDVTGLTTTF
Sbjct: 601 ERASELAQLTWRVLKREWFRPDVTGLTTTF 630

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/618 (62%), Positives = 471/618 (76%)

Query: 13  VINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRM 72
           ++ +VP+DL   ++ W  QD N +T  E+  LCK  DW ELHKR D+RI FGTAGLRS+M
Sbjct: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64

Query: 73  EAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFK 132
           +AGFSRMNTLVV+QA+QGLA ++++QFPD L AVVGHDHRF+S+EFA AT A FL  GFK
Sbjct: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124

Query: 133 VIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSE 192
           V +LN   +FVHTP+VPF V+++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184

Query: 193 IAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEK 252
           I+ SI+ NL  W   W +D++L + L    L+Y+ EEM++ Y +++ ++LV+   +  E 
Sbjct: 185 ISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV 244

Query: 253 EGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKG 312
           + KPWFVYTP+HGVG+DIF  I ++T+ L+ G+DYLCV EQQ PDPSFPTV FPNPEEKG
Sbjct: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKG 304

Query: 313 ALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXXX 372
           ALD+ I++A+K+ I L++ANDPDADRFS AVKD ++G WRQLTGNEIG LFAF       
Sbjct: 305 ALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYK 364

Query: 373 XXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVP 432
                    HPLAMLNSTVSSQ+I KMAEIE FHY DTLTGFKWIGNR + LE   YYVP
Sbjct: 365 SMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVP 424

Query: 433 FGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYN 492
           FGFEEAIGYMFP MEHDKDGISA+ VFLQ Y KW +      L VLE+ F+KYGVFKEYN
Sbjct: 425 FGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYN 484

Query: 493 GYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDL 552
           GYY V +P V K++FD+IRN Y+     YPS IGEE++V  +RDLT GYQSDT+N +P L
Sbjct: 485 GYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTL 544

Query: 553 PVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWR 612
           PVDP SQMIT   + +     E +RFTIRGSGTEPKLKVYIEAC+  E+RAS LA+LTW 
Sbjct: 545 PVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTWN 604

Query: 613 VLKREWFRPDVTGLTTTF 630
           VL+REWFRPD   + T F
Sbjct: 605 VLRREWFRPDEMNIVTKF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/620 (61%), Positives = 468/620 (75%)

Query: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70
           ++++ +VP+DL   ++ W  QD N +T  E+  LCK  DW ELHKR DTRI FGTAGLRS
Sbjct: 3   QQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRS 62

Query: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130
            M+AGFSRMNTLV++QATQGLA +IK+QFPD L  VVGHDHRF+S+EFA AT   FL  G
Sbjct: 63  EMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKG 122

Query: 131 FKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190
           FKV +LN   +FVHTP+VPF V+++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISA 250
             I+ SI+ NL  W   WK+ ++L + L    L+Y+ EEM+  Y+K++ ++LV+   +  
Sbjct: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKL 242

Query: 251 EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEE 310
           E + KPWFVYTP+HGVG++IF  I ++TM+L+ G DYLCV EQQ PDPSFPTV FPNPEE
Sbjct: 243 EIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 311 KGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXX 370
           KGALD+ + +A+++ I+L++ANDPDADRFS AVKD ++  WRQLTGNEIG LFAF     
Sbjct: 303 KGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQR 362

Query: 371 XXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYY 430
                      HPLAML+STVSSQ+I KMAE+E F Y DTLTGFKWIGNR + LE   YY
Sbjct: 363 YKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYY 422

Query: 431 VPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKE 490
           VPFGFEEAIGYMFP MEHDKDGISAA V LQ Y KW + S    + +LE+ F+KYGVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKE 482

Query: 491 YNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRP 550
           YNGYY V  P V  E+F++IRN Y+ T  PYP  IGEE++V  +RDLT GYQSDT + +P
Sbjct: 483 YNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKP 542

Query: 551 DLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLT 610
            LPVDP SQMIT   K +     E +RFTIRGSGTEPKLKVYIEAC+ +E+RAS LA+LT
Sbjct: 543 VLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLT 602

Query: 611 WRVLKREWFRPDVTGLTTTF 630
           W VL+R WFRP++  +TT F
Sbjct: 603 WDVLRRGWFRPEIMNITTDF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/619 (60%), Positives = 471/619 (76%)

Query: 12  EVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSR 71
           + + +VP++L + ++ W  QD N +T  E+  LCK  DW ELH+R D+RI FGTAGLRS+
Sbjct: 4   QFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQ 63

Query: 72  MEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGF 131
           M+AGF+RMNTLV++QA+QGLA + K+QFP+ L AVVGHDHRF+S+EFA AT   FL  GF
Sbjct: 64  MQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGF 123

Query: 132 KVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191
           KV +LN   +FVHTP+VPF V+++ ASVGVM+TASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 124 KVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251
            I+ SI+ NL  W   W +D++L +GL    L+Y+ EE+++ Y  ++ ++LV    +  E
Sbjct: 184 AISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFE 243

Query: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311
            + KPWFVYTP+HGVG+DIF  I ++TM+L+ G+DYLCV EQQ PDPSFPTV FPNPEEK
Sbjct: 244 VKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEK 303

Query: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXX 371
           GALD+ I++A+ +GI+L++ANDPDADRFS A+KD ++G WRQLTGNEIG LFA       
Sbjct: 304 GALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKF 363

Query: 372 XXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431
                     HPLAML+STVSSQ+I KMAE+E FHY +TLTGFKWIGNR + LE   YYV
Sbjct: 364 KSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYV 423

Query: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491
           PFGFEEAIGYMFP MEHDKDG+SA+ VFLQ Y +W +      +++LED F+KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEY 483

Query: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551
           NGYY V+ P V  E+FD+IRN Y+     YPS IG+E++V  +RDLT+GYQSDT N +P 
Sbjct: 484 NGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPT 543

Query: 552 LPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTW 611
           LP+DP+SQMIT   K +     E +RFTIRGSGTEPK+KVYIEAC+  E+RA+ LA+LTW
Sbjct: 544 LPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTW 603

Query: 612 RVLKREWFRPDVTGLTTTF 630
            VLKREWFRP+   + T F
Sbjct: 604 NVLKREWFRPEKMDIVTHF 622

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/620 (60%), Positives = 473/620 (76%)

Query: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70
           ++ + ++P+DL   ++ W  QD + +T  E+  LCK  DW ELHKR DTRI FGTAGLRS
Sbjct: 3   QQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRS 62

Query: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130
           +M+AGFSRMN LV++QA+QGLA +I++QFP+ L AVVGHDHRF+S++FA AT   FL  G
Sbjct: 63  QMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKG 122

Query: 131 FKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190
           FKV +LN G +FVHTP+VPF V+E+ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 123 FKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISA 250
             I+ +I+ NL  W  AW +D++L + L    L+Y+ EEM++ Y +K+  +LV+ T +  
Sbjct: 183 QAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKL 242

Query: 251 EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEE 310
           E   KPWFVYTP+HGVG+DIF  I +++M L+ G+DYLCV EQQ PDPSFPTV FPNPEE
Sbjct: 243 EVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 311 KGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXX 370
           KGAL++ + +A+K+ ISL++ANDPDADRFS A+KD ++G W+QLTGNEIG LFAF     
Sbjct: 303 KGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEK 362

Query: 371 XXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYY 430
                      HPLAML+STVSSQ+I +MAE+E FHY DTLTGFKWIGNR + LE   YY
Sbjct: 363 FKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYY 422

Query: 431 VPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKE 490
           VPFGFEEAIGYMFP MEHDKDGISA+ VFLQ Y KW + +    + VLE+ F+KYGVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKE 482

Query: 491 YNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRP 550
           YNGYY V +P V KE+F +IR+ Y+  + PYP  IGEE++V  +RDLT GYQSDT++ +P
Sbjct: 483 YNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKP 542

Query: 551 DLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLT 610
            LPVDP SQMIT + + N +   E +RFTIRGSGTEPKLKVYIE  +  E RAS LA+LT
Sbjct: 543 TLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLT 602

Query: 611 WRVLKREWFRPDVTGLTTTF 630
           W VL+REWFRP+ T +TT F
Sbjct: 603 WDVLRREWFRPEKTNITTNF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/618 (60%), Positives = 468/618 (75%), Gaps = 1/618 (0%)

Query: 14  INSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRME 73
           +++ P +L + +  WL  D N++TR E+L LC+ K+W ELH+R DTRI+FGTAGLRSRME
Sbjct: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67

Query: 74  AGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKV 133
           AGFSRMN+L++LQ+TQGLA +IK+QFP+ LTAVVGHDHRF+S+EFA+ T + FL+AGFKV
Sbjct: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127

Query: 134 IFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEI 193
            +L   D+FVHTP+VPF+V  + ASVGVMITASHNPKMDNGYKVYY N CQIIPPHD  I
Sbjct: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187

Query: 194 AQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKE 253
           A+ I++NL  W  +W WD   K+GL+T  LV+  + M E+Y  +M + L+  + +S +  
Sbjct: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247

Query: 254 GKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGA 313
             P+FVYTP+HGVG +IF +++ E +NL    DYL V EQ+LPDPSFPTV FPNPEEKGA
Sbjct: 248 KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGA 307

Query: 314 LDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXXXX 373
           L +AI +A +NG+SLV+ANDPDADRFSAAV + KTG WRQLTGNEIG L  +        
Sbjct: 308 LSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQ 367

Query: 374 XXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPF 433
                   HPLAM+NSTVSSQ+I +MA++  FHY DTLTGFKWIGN+ +DL    YYVPF
Sbjct: 368 QDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPF 427

Query: 434 GFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNG 493
           GFEEAIGYMFP ME DKDGISAA+VFLQ Y  W+   + +   ++E+ F K+GVFKEYNG
Sbjct: 428 GFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNG 487

Query: 494 YYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLP 553
           YY + D  + K VFDFIR++Y  T+  YPS IG EL V  FRDLT+GYQS+T +  P+LP
Sbjct: 488 YYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLP 547

Query: 554 VDPNSQMITAWTKVNGAKPYE-SVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWR 612
           VDP SQMIT   K +     E +VR T+RGSGTEPKLKVYIEACSKSEE A+ LA+ TW 
Sbjct: 548 VDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWD 607

Query: 613 VLKREWFRPDVTGLTTTF 630
           +LKREWFRP+VTGLTT+F
Sbjct: 608 ILKREWFRPEVTGLTTSF 625

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/628 (58%), Positives = 467/628 (74%), Gaps = 4/628 (0%)

Query: 7   QSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTA 66
            S+   V+ ++P DL   V +WL+QD N +T  E++ LCKA    ELHKR D RILFGTA
Sbjct: 5   NSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTA 64

Query: 67  GLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATF 126
           GLRS+MEAGFSRMNTLVVLQATQGLA +IK+QFP  L AV+GHDHR++S+EFA    + F
Sbjct: 65  GLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVF 124

Query: 127 LQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186
           L AGF V  LN    FVHTP+VPFTV+++GASVGVMITASHNPKMDNGYKVYYSNGCQII
Sbjct: 125 LSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQII 184

Query: 187 PPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRT 246
           PP D+ IA+ I+ENL  W  +W   + ++ GL  K L+Y   EM+  Y+ K+  +++D+ 
Sbjct: 185 PPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKK 244

Query: 247 TISA-EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPF 305
           TI   ++  KPWFVYTP+HGVGY+IF  +  E +NL   RDYL VKEQ +PDP+FPT+ F
Sbjct: 245 TIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISF 304

Query: 306 PNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAF 365
           PNPEEKGALDMAI++A +N ISLV+ANDPDADRFSAA+ ++ +G W+QLTGNEIG LF +
Sbjct: 305 PNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGY 364

Query: 366 XXXXXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLE 425
                           HPLAMLNSTVSS+++  MA+ E F +IDTLTGFKWIGN+ +DL+
Sbjct: 365 YLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLK 424

Query: 426 AMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKY 485
              Y+V FG+EEAIGYMFP MEHDKDGI+A+ VFLQ Y +W   SK T++ +LE   EKY
Sbjct: 425 KEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKY 484

Query: 486 GVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDT 545
           G FKEYNGYY V++P+V  ++F +IRN+Y +  + YP  IG  L+V  FRDLT G+QSDT
Sbjct: 485 GAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDT 544

Query: 546 VNQRPDLPVDPNSQMITAWTKVNGAKPYES---VRFTIRGSGTEPKLKVYIEACSKSEER 602
           V+  P LPVDP+SQMIT   K+   +  +S   VRFT+RGSGTEPKLK+YIE  SK    
Sbjct: 545 VDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIA 604

Query: 603 ASELAQLTWRVLKREWFRPDVTGLTTTF 630
           AS++A+LTW VLK+EW RP+VTG+TT++
Sbjct: 605 ASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/619 (59%), Positives = 449/619 (72%), Gaps = 1/619 (0%)

Query: 13  VINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRM 72
           + +  P +L + +  WL QD  ++TR E++ LCK  +W+ELHKR D+RI+FGTAGLRSRM
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 73  EAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFK 132
           EAGFSRMN LV+LQA+QGLA++IK QFP  LTAVVGHDHRF+S++FA+ T + FL+ GFK
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 133 VIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSE 192
           V +LN  D FVHTP+VPF+VN + AS+GVMITASHNPKMDNGYKVYYSNGCQIIPPHD  
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 193 IAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEK 252
           IA +I+ENL  W   W WD   ++ L  K LVY  EEM  +Y + M   LV  +      
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 253 EG-KPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311
            G KPWFVYTP+HGVGY+IF +I++  ++     DY  VKEQ  PDP+FPTV FPNPEEK
Sbjct: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307

Query: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXX 371
           GAL +A  +A++N ISLV+ANDPDADRFS A K+ KTG W+QL+GNEIG LFA       
Sbjct: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367

Query: 372 XXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431
                     HPLAM+NSTVSSQ+I KMA++E FHY DTLTGFKWIGNR LDL+   YYV
Sbjct: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427

Query: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491
           PFGFEEAIGYMFP M  DKDG+SAA VFL  Y  WL         +LE  F+K+G FKEY
Sbjct: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEY 487

Query: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551
           NGYY  +DPK  K++FDF+R  Y  + +PYP  IG+E K+  FRDLT GYQS+T++  P+
Sbjct: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547

Query: 552 LPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTW 611
           LPVDP+S+MIT             VRFT+RGSGTEPKLK+YIEA + +E+ A +LA   W
Sbjct: 548 LPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMW 607

Query: 612 RVLKREWFRPDVTGLTTTF 630
            VLK+EW RPDVTGLTTTF
Sbjct: 608 NVLKKEWIRPDVTGLTTTF 626

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/623 (60%), Positives = 453/623 (72%), Gaps = 13/623 (2%)

Query: 16  SVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAG 75
           +VP DL + V  WL+ D N +TR E+LNL + K W ELH RLD RI FGTAGLRSRMEAG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 76  FSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIF 135
           FSRMNTL VLQA+QGLA +IK QFP+ L+ +VGHDHR++S EFA  TV  FLQ GFKV +
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 136 LNDGDK-----FVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190
           LN   K     FVHTP+VPFT+N++ AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISA 250
             I+++I++NL  W KAW  DE++K  +++  L    E++  +Y K +   LV    +  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPMLDC 246

Query: 251 EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEE 310
           +K   PWFVYTP+HGVG++IF QIA   + L  G+ Y+CV EQ+ PDP+FPTV FPNPEE
Sbjct: 247 DK---PWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 311 KGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXX 370
           KGALD++I++A++  I LV+ANDPDADRFS AVK+     W QLTGNEIG LFA+     
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDR--WSQLTGNEIGFLFAYYQWQD 361

Query: 371 XXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYY 430
                      HPLAM+NSTVSSQ+I  +AE E+FHY DTLTGFKW+GNR  +LE   YY
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 431 VPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKE 490
           VPF +EEAIGYMFP +EHDKDGISAA VFLQMY +WL   + T L VL++ F KYGVFKE
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 491 YNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRP 550
           YNGYY V    + KEVFD+IR DY+ +   YP  IG E  V  FRDLT GYQSDT++  P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 551 DLPVDPNSQMITAWTKVNGAKPY---ESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607
           +LPVD +SQMITA  + +  K     E VRFTIRGSGTEPKLKVYIEA S  E+RA  LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 608 QLTWRVLKREWFRPDVTGLTTTF 630
           + TW+VL+REWFRP+ TGL T F
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/620 (58%), Positives = 446/620 (71%), Gaps = 2/620 (0%)

Query: 12  EVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSR 71
            ++ + P  L   +  WL  D N++TR E+L+LC+ +DW EL+ R   RILFGTAGLRSR
Sbjct: 7   HILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66

Query: 72  MEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGF 131
           MEAG +R+N+LV+LQATQGLA++I  QFP    AVVGHDHRF+S+EFA  T A FL+AGF
Sbjct: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126

Query: 132 KVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191
           KV++LN GD  VHTP+VPFTV+ + ASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD 
Sbjct: 127 KVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDL 186

Query: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251
            IA+SI++NL  W  +W W  +++       +VY  ++M + YTK     L+    +   
Sbjct: 187 NIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRN 246

Query: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311
               PWFVYTP+HGVG +IF +I+E+ + +    DYLCV EQ+ PDPSFPTV FPNPEEK
Sbjct: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306

Query: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXX 371
           GALD AI +A +NGI+LV+ANDPDADRFS AV D+KT  WRQLTGNEIG LFA+      
Sbjct: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366

Query: 372 XXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431
                     HPL +LNSTVSSQ+I KMAE+E FHY DTLTGFKWIGNR  DLE   ++ 
Sbjct: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426

Query: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491
           PFG+EEAIGYMF  MEHDKDGISA+ +FL  Y  W+  + K  L +LED ++KYGVFKEY
Sbjct: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486

Query: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551
           NGYY V++PK++KE FD+IRND  +    YP  IG E +V  FRDLTLG+QSDT +  P 
Sbjct: 487 NGYYIVDNPKIMKETFDYIRND-RKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545

Query: 552 LPVDPNSQMITAWTK-VNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLT 610
           LPVDPNSQMIT   K  +     + VRFTIRGSGTEPKLKVYIEACS SE  A +LA+  
Sbjct: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605

Query: 611 WRVLKREWFRPDVTGLTTTF 630
           W  L+  WFRP  TGL T F
Sbjct: 606 WDTLQEVWFRPQTTGLVTDF 625

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/617 (60%), Positives = 456/617 (73%), Gaps = 10/617 (1%)

Query: 15  NSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEA 74
           +++P +L Q ++ WL+QD N++T  EI  LC A++W ELH+RL++R+ FGTAGLR+RMEA
Sbjct: 3   SNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEA 62

Query: 75  GFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVI 134
           GFSRMNTLVV+QATQGLAQ+IKKQFPD L AVVGHDHRFNS +FA AT    L+AGF+V 
Sbjct: 63  GFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122

Query: 135 FLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIA 194
           +LN GD +VHTP+VPFTV+ V ASVGVMITASHNPK+DNGYKVYY+NGCQIIPPHDS IA
Sbjct: 123 YLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIA 182

Query: 195 QSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEG 254
           +SIE NL      W WD+ +++  D   L+Y  ++M+E+Y   +  S V  T + +  +G
Sbjct: 183 RSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV--TELDSLPKG 240

Query: 255 KPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGAL 314
           KPWFVYTP+HGVGY +F QIA + + L   RD+L V EQ  PDP FPTV FPNPEEKGAL
Sbjct: 241 KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL 300

Query: 315 DMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXXXXX 374
           D+AI +A+ +GI LV+A+DPDADRFS A K      W+QL+GN+IG LFA+         
Sbjct: 301 DLAIKLAENHGIKLVIASDPDADRFSVAFKGPH--GWQQLSGNDIGFLFAYYELQKYRGF 358

Query: 375 XXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFG 434
                  HPLAMLNSTVSSQ+I  MA +E FH+ DTLTGFKWIGNR L+LEA  YYVPFG
Sbjct: 359 DAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFG 418

Query: 435 FEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGY 494
           FEEAIGYMFP  EHDKDGISAA VFLQ Y  W +   K+ L +L++   KYGVF+EYNGY
Sbjct: 419 FEEAIGYMFPATEHDKDGISAAVVFLQAYHSW-ISQGKSPLDILDEASAKYGVFREYNGY 477

Query: 495 YSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPV 554
           Y V++P +  + F +IR DY+   + YP  IG +L+V  FRDLT GYQSDT N  P+L V
Sbjct: 478 YLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHV 536

Query: 555 DPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVL 614
           DP+SQMIT   +  G    E VRFT+RGSGTEPKLKVYIEA ++S+ RA ELA+ TW +L
Sbjct: 537 DPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDIL 596

Query: 615 KREWF-RPDVTGLTTTF 630
           + EWF RP   GLTT F
Sbjct: 597 REEWFNRP---GLTTKF 610

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/614 (58%), Positives = 445/614 (72%), Gaps = 4/614 (0%)

Query: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76
           VP  L      WL  D N++TR EIL +   KDW EL  RL+ RI FGTAGLR RMEAGF
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136
           +RMN+LV+LQ +QGLAQ+I ++FP  L+ VVGHDHR++S+EFA  TVATFL AGFKV +L
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 137 NDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQS 196
           N  ++FVHTP+VP++V+++ ++ GVMITASHNPK DNGYKVYYSNGCQIIPPHD  IA +
Sbjct: 135 NTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALT 194

Query: 197 IEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKP 256
           IE+NLT W K W W +L         L + G +M   Y + + + +    +    K GKP
Sbjct: 195 IEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGS-PMLKTGKP 253

Query: 257 WFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDM 316
           WFVYTP+HGVG+ IF QIA++ + L    DY  V EQ  PDPSFPTV FPNPEEKGALDM
Sbjct: 254 WFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDM 313

Query: 317 AISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXXXXXXX 376
           AI +A++ G++L++ANDPDADRFSAAVKD ++  WRQL+GNEIG+LFA            
Sbjct: 314 AIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHKEKAA 373

Query: 377 XXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFE 436
                 PLAMLNSTVSSQ++ KMA++E FHY +TLTGFKWIGNR L LE   Y V FG+E
Sbjct: 374 SRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYE 430

Query: 437 EAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGYYS 496
           EAIGYMFP MEHDKDGI A+ VFL MY KWL       L VL+  FEKYGVF EYNGYY+
Sbjct: 431 EAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYT 490

Query: 497 VNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDP 556
           V +P +I+ VF +IR++Y     PYP ++G E  +  FRDLTLGYQSDT++ +P LPVD 
Sbjct: 491 VEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDA 550

Query: 557 NSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLKR 616
           +SQMITA  K      +E +RFTIRGSGTEPKLKVYIE+ + ++E A+ LA LTW VL+R
Sbjct: 551 SSQMITATLKPERTVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVLRR 610

Query: 617 EWFRPDVTGLTTTF 630
           EWFRP++TGL T+F
Sbjct: 611 EWFRPEITGLKTSF 624

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/625 (58%), Positives = 450/625 (72%), Gaps = 9/625 (1%)

Query: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70
           + +++S+P DL + +  W   D N++T  E+  LC  K   ELHKR D RI+FGTAGLRS
Sbjct: 9   ENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRS 68

Query: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130
           RMEAGF+RMN L VLQ+TQGLA +IK QFP  LTAVVGHDHR++S+EFA  T A FL AG
Sbjct: 69  RMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAG 128

Query: 131 FKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 190
           FKV +LN  D+FVHTP+VPF +N   AS+GVMITASHNP+MDNGYKVYY+NGCQIIPPHD
Sbjct: 129 FKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHD 188

Query: 191 SEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDR----- 245
             IA+ IE+NL      W  + ++ + ++   L+Y+ E+++++Y   + + ++ +     
Sbjct: 189 KNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISLG 248

Query: 246 TTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPF 305
           TTI   K  KPWFVYTP+HGVGY IF +I+   +NL+   DY+CVKEQ +PDPSFPTV F
Sbjct: 249 TTI---KGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSF 305

Query: 306 PNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAF 365
           PNPEEKGALD+ I  A K+ I LV+ANDPDADRFS AV++  T  ++QLTGNEIG LFA+
Sbjct: 306 PNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAY 365

Query: 366 XXXXXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLE 425
                            PLAM+NSTVSSQ+I KMAE+E F+Y DTLTGFKWIGN+  +LE
Sbjct: 366 FLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELE 425

Query: 426 AMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKY 485
              YYVPFGFEEAIGYMFP ME DKDGI+A  VFLQ Y  W + +K++L  ++E  F+KY
Sbjct: 426 KEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKY 485

Query: 486 GVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDT 545
           GVFKEYNGYY VND  + K +FD IR + ++  + Y S IG E KV  FRDLTLGYQSDT
Sbjct: 486 GVFKEYNGYYIVNDLSLTKIIFDNIRENKND-KEKYVSHIGTEFKVITFRDLTLGYQSDT 544

Query: 546 VNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASE 605
           +   P LPVDP+SQMIT            SVRFTIRGSGTEPKLKVYIEA +K+E  A+ 
Sbjct: 545 IGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANR 604

Query: 606 LAQLTWRVLKREWFRPDVTGLTTTF 630
           LA+LTW VLKREWF  + TGLTT F
Sbjct: 605 LAKLTWDVLKREWFSSEKTGLTTNF 629

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/615 (56%), Positives = 436/615 (70%), Gaps = 4/615 (0%)

Query: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76
           +P +L   + SWL  D N++TR E++ LC  ++W ELHKR D+RI+FGTAGLR+RMEAG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136
           +R+N LV+LQA+QGLA +IK +FP  LTAVVGHDHR++SQEFA  T ATF++AGFKV +L
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 137 NDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQS 196
           N  D+FVHTP+VP++V+ + ASVGVMITASHNPKMDNGYKVYY+NGCQIIPPHD  IA++
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 197 IEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKP 256
           I  NL  W   W + ++L        + Y  + M+  Y   +   L+ R    A  + KP
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRDF--AAPDEKP 243

Query: 257 WFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDM 316
           WFVYTP+HGVG+ IF  I  E++NL +  DY+ V EQ+ PDPSF TV FPNPEEKGAL++
Sbjct: 244 WFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNL 303

Query: 317 AISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXXXXXXX 376
           AI++A+ NGI LVLANDP+ADRFS AV+D+    W+QLTGNEIG LFAF           
Sbjct: 304 AITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAAD 363

Query: 377 XXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFE 436
                 PLAMLNSTVS+Q+I +MAE E F Y DTLTGFKWIGN    LE   Y+VPFG+E
Sbjct: 364 KGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYE 423

Query: 437 EAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNGYYS 496
           EAIGYMFP MEHDKDG+SAA VFLQ Y  WL  S    + ++ + ++KYGV  EYNGYY 
Sbjct: 424 EAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNP-IDIIHECYDKYGVSAEYNGYYI 482

Query: 497 VNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDP 556
           V+DP    +VF+ IR+ Y+     +P  IGE  +V +FRDLT+G+ S T +++P LPVD 
Sbjct: 483 VSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDK 542

Query: 557 NSQMITAWTKVNGAKPY-ESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLK 615
           NSQMIT     +GA    ESVRFTIRGSGTEPKLKVYIE  S +E RA  LA+  W  LK
Sbjct: 543 NSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLK 602

Query: 616 REWFRPDVTGLTTTF 630
            EWF+P   GL+T F
Sbjct: 603 HEWFKPSSNGLSTDF 617

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/626 (57%), Positives = 430/626 (68%), Gaps = 25/626 (3%)

Query: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76
           +P DL   V SW   D N++TR EIL L   ++W ELHKRLD RI FGTAGLRS+MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136
           SRMNTL VLQA+QGLA++I ++FP+  T  VGHDHRFNS++FA  T   FLQ  FKV  L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 137 N-----DGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191
                   D FVHTP+VPF ++ +GAS GVMITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251
            IAQSI +NL  W +AW    ++ E  +    V   + M++ Y K++   LV   +    
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLV---SSDIG 244

Query: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311
              KPWFVYTP+HGVG++IF +IA E + L+ GRDY CV E + PDP+FPTV FPNPEE 
Sbjct: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEA 304

Query: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXX 371
           GALD+AI++ADKNGIS VL NDPDADRFSAAVK    G WRQLTGNEIG LFA       
Sbjct: 305 GALDLAIALADKNGISFVLGNDPDADRFSAAVKHQ--GKWRQLTGNEIGFLFAQFVWEKY 362

Query: 372 XXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431
                     +PLA++NSTVSSQ+I K+A +E+FHY DTLTGFKW+GNR   LE+  YYV
Sbjct: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422

Query: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLT---VLEDIFEKYGVF 488
           PF +EEAIG+MF  + HDKDG+SAA VFLQM   W    KK  L+   VL+  F KYGVF
Sbjct: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSW----KKQALSPIDVLQSAFGKYGVF 478

Query: 489 KEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQ 548
           KEYNGYY+V D  +   +F  IR+ Y    D YP  IG +  V  F DLT G+QSDT + 
Sbjct: 479 KEYNGYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADN 534

Query: 549 RPDLPVDPNSQMITAW----TKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERAS 604
            P LPVDP+SQMI A     T      P E VRFT RGSGTEPKLKVYIEA S  E RAS
Sbjct: 535 TPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRAS 594

Query: 605 ELAQLTWRVLKREWFRPDVTGLTTTF 630
           +LA+ TW VL+ EWF+P  TGL+T F
Sbjct: 595 DLARTTWNVLRDEWFKPKETGLSTKF 620

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/645 (55%), Positives = 443/645 (68%), Gaps = 25/645 (3%)

Query: 8   SDEKE---VINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFG 64
           SDE++   +I   P DL + V  WL QD +  TR EI++LCK+ +  ELH+R D+RI FG
Sbjct: 2   SDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFG 61

Query: 65  TAGLRSRMEAGFSRMNTLVVLQATQGLAQHIK---KQFPDALTAVVGHDHRFNSQEFALA 121
           TAGLRS MEAGFSRMNTL VLQA+QGLA ++K   K     L AV+GHDHR++S+EFA  
Sbjct: 62  TAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKI 121

Query: 122 TVATFLQAGFKVIFLNDG-------DKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNG 174
               FL AGFKV +LND        +KFVHTP+VPFTV  + ASVGVM+TASHNPKMDNG
Sbjct: 122 AATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNG 181

Query: 175 YKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERY 234
           YKVYYSNGCQIIPPHDS I+Q I+ NL  W  +W + E++        L+Y  + M+  Y
Sbjct: 182 YKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDY 241

Query: 235 TKKMGQSLVDRTTISAEKE----GKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCV 290
             ++ + L  +  I   K+     KPWFVYTP+HGVGY+IF +I+ E +++  G D++ V
Sbjct: 242 ITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVV 301

Query: 291 KEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKT-G 349
           +EQ+ PDP FPTV FPNPEEKGA+DM I +A+ NGISLV+ANDPDADRFS AVK   + G
Sbjct: 302 EEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQG 361

Query: 350 TWRQLTGNEIGALFAFXXXXXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYID 409
           TW Q TGNEIG LFA+                H L M+NSTVSSQ+I KMAEIE F+Y +
Sbjct: 362 TWHQFTGNEIGYLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYEE 418

Query: 410 TLTGFKWIGNRTLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVG 469
           TLTGFKWIGNR +DL      VPFG+EEAIGYMFP ME DKDGI+A  +F+Q +  W   
Sbjct: 419 TLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQI 478

Query: 470 SKKTLLTVLEDIFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDY----SETHDPYPSRI 525
            K     +++  F+KYGVF EYNGYY   D  + K++FD++R DY    SE +  YP  I
Sbjct: 479 DKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHI 538

Query: 526 GEELKVNKFRDLTLGYQSDTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGT 585
           GEE K+ K+RDLT GYQSDT + +P LPVDP+SQMIT        +   S+R TIRGSGT
Sbjct: 539 GEEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGT 598

Query: 586 EPKLKVYIEACSKSEERASELAQLTWRVLKREWFRPDVTGLTTTF 630
           EPKLKVYIEACS+S   AS LA+  W VLKREW RP+ TG+TT F
Sbjct: 599 EPKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/623 (57%), Positives = 435/623 (69%), Gaps = 19/623 (3%)

Query: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76
           VP DL   V +WL  D N+QTR +I+ L + K W EL  RL+ RI FGTAGLRSRMEAGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVI-- 134
           +RMNTL VLQA+QGLA++I   FPD L+ VVGHDHRFNS++FA  T+  FLQ GFKV   
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 135 -FLNDG--DKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191
            F  D   D  VHTP+VPF ++ + AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188

Query: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251
            I+QSI  NL  W +AW    +  E + ++ L+ A + ++++Y   + +SLV  T ++  
Sbjct: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV-ITNVNHT 247

Query: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311
           K   PWFVYTP+HGVG++IF +I      L  GRDYLCV+EQ+ PDP+FPTV FPNPEEK
Sbjct: 248 K--APWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305

Query: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXXXXX 371
           GALD AI +A+K+ I+ VL NDPDADRFS A K N  G WRQLTGNEIG LFA       
Sbjct: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAKHN--GQWRQLTGNEIGFLFAQYKWETY 363

Query: 372 XXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431
                     +PLAM+NSTVSSQ+I KMAE+E FHY DTLTGFKW+GNR  +LE   Y+V
Sbjct: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423

Query: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491
           PF +EEAIGYMF  + HDKDGISAA VFLQM   W      T   VL+  ++KYGVFKEY
Sbjct: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAYQKYGVFKEY 482

Query: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551
           NGYY V D  +  +VF  IR+ +S      P+ IG+E +V  + DLT GYQS+T +  P 
Sbjct: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538

Query: 552 LPVDPNSQMITAW---TKVNGAKPY-ESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607
           LPVDP+SQMITA    T   G + + ESVRFT RGSGTEPKLKVYIEA S SEE AS LA
Sbjct: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALA 598

Query: 608 QLTWRVLKREWFRPDVTGLTTTF 630
           +  W VL+REWF+P+ TGL T F
Sbjct: 599 KKAWDVLRREWFKPEQTGLATNF 621

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/630 (56%), Positives = 432/630 (68%), Gaps = 17/630 (2%)

Query: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70
           KE  ++VP+ L   +  WL+ D N +T+ EI  L     W EL KRL  RI FGTAGLR+
Sbjct: 2   KENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRA 61

Query: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130
           RMEAGFSRMNTL V+QA+QGLA++IK QFPD L  V+GHDHRF+S+EFA AT+A FLQ  
Sbjct: 62  RMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLD 121

Query: 131 FKVIFLN------DGDKFVHTPIVPFTVNEVGA---SVGVMITASHNPKMDNGYKVYYSN 181
           + + +LN      D D FVHTP+VPF +N V     S GVMITASHNPKMDNGYKVYY+N
Sbjct: 122 YDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYAN 181

Query: 182 GCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQS 241
           GCQIIPPHD  I + I+ NL  W +AW    L++E + +  L    +EM+++Y   +   
Sbjct: 182 GCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTM 241

Query: 242 LVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFP 301
           LV ++ +     G PWFVYTP+HGVGY+ F++     + +   +DY+ V EQ+ PDP FP
Sbjct: 242 LVKQSNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFP 299

Query: 302 TVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGA 361
           TV FPNPEE+GALDMA+ VAD NGI++VLANDPDADRFS AVK +  G W QLTGN+IG 
Sbjct: 300 TVSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYH--GEWNQLTGNQIGI 357

Query: 362 LFAFXXXXXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRT 421
           LFA                   LAML S VSSQL+ KMAE E F  ++TLTGFKW+GNR 
Sbjct: 358 LFA--QAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRA 415

Query: 422 LDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDI 481
            +LE   YYVPF +EEAIGYMF  + HDKDGI+AA+VFLQM  +W   +K +   VL++ 
Sbjct: 416 RELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSS-QEVLQEC 474

Query: 482 FEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGY 541
           +EKYG F +YNGYY  + P V KEVFD+ RN+Y+    PYPS IG E +V   RDLT+GY
Sbjct: 475 YEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGY 534

Query: 542 QSDTVNQRPDLPVDPNSQMITAWTK-VNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSE 600
           QSDT    PDLPVD NSQMIT   K V      ESVRFT RGSGTEPKLKVYIE+C+ + 
Sbjct: 535 QSDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANH 594

Query: 601 ERASELAQLTWRVLKREWFRPDVTGLTTTF 630
           +RAS L+ L W VLKREWFRP  TGL T F
Sbjct: 595 QRASHLSHLAWDVLKREWFRPTETGLQTNF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/627 (57%), Positives = 435/627 (69%), Gaps = 29/627 (4%)

Query: 10  EKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLR 69
           E EVI S+P+DL   V +WL  D  ++TR EIL LC   D  ELHKRLDT I FGTAGLR
Sbjct: 3   ETEVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLR 62

Query: 70  SRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQA 129
            RMEAGF+RMN L V QA+QGLA++IKKQFP+ LT VVGHDHR NS+ F   TV TFLQ 
Sbjct: 63  GRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQL 122

Query: 130 GFKVIFLNDGDK--FVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIP 187
           GFKV  LN  ++   VHTP+VPFTVN  GASVG+MITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 123 GFKVFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIP 182

Query: 188 PHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTT 247
           PHD  IA+SI  NL  +               T  ++   E+M ++Y   +G +L+D   
Sbjct: 183 PHDKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGAV 231

Query: 248 ISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPN 307
              +K  +PWFVYTP+HGVG++IF  I+++ ++L  G+DYL V+EQ+ PD  FPTV FPN
Sbjct: 232 --NKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPN 289

Query: 308 PEEKGALDMAISVADKNG-ISLVLANDPDADRFSAAVKDNKTGT---WRQLTGNEIGALF 363
           PEEKGALD+A+    KN  + L++ANDPDADRFS AV+DN   T   WRQLTGNEIG LF
Sbjct: 290 PEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLF 349

Query: 364 AFXXXXXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLD 423
           A+                 PLAMLNSTVSSQ+I +MAEIE FHY DTLTGFKW+GNR L+
Sbjct: 350 AY----YEWERYKHSPIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALE 405

Query: 424 LEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFE 483
           LE   YY PF +EEAIGYMF  + HDKDGISAA VFLQ Y KW   S +T+L +L     
Sbjct: 406 LEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWR-ASGQTVLDILATASL 464

Query: 484 KYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQS 543
           KYG FKE+NGYY V D  + K+VFD IR+       PYP ++G   ++ KFRDLT GYQS
Sbjct: 465 KYGHFKEFNGYYIVPDLAITKQVFDAIRS----IESPYPKKLGSSFEIIKFRDLTNGYQS 520

Query: 544 DTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERA 603
           DT +  P+L  DP+SQMIT    +   +P   VRFTIRGSGTEPKLKVYIEA + +E  +
Sbjct: 521 DTPDHIPELASDPSSQMITCEMLLV-EQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNS 579

Query: 604 SELAQLTWRVLKREWFRPDVTGLTTTF 630
             LA+ TW VL++EWF+P++TGL T F
Sbjct: 580 IALAKFTWDVLRQEWFKPELTGLLTPF 606

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/626 (55%), Positives = 429/626 (68%), Gaps = 20/626 (3%)

Query: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76
           +P DL   +  W   D N QT  EI +L  +++W EL  RL  RI FGTAGLR+RMEAGF
Sbjct: 13  IPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGF 72

Query: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVIFL 136
           +RMNTL V+QA+QGLA +IK QFP+ L  VVGHDHR+NS+ FA   +A FLQ GF+V +L
Sbjct: 73  ARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYL 132

Query: 137 N------DGDKFVHTPIVPFTVNEV--GASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 188
           N      D + +VHTP+VPFTV+ +  GAS G+MITASHNPKMDNGYKVYYSNGCQI PP
Sbjct: 133 NYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPP 192

Query: 189 HDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTI 248
           HD +IA  I+ NL  W +AW   +L+++  +   L    +E+I+ Y +++  SLV  TT 
Sbjct: 193 HDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLV--TTN 250

Query: 249 SAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNP 308
           S    GK WFVYTP+HGVGY+IF  I   T++L     YL V  Q+ PDP F TV FPNP
Sbjct: 251 SLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNP 310

Query: 309 EEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFXXX 368
           EE+GAL++AI +A ++G  LVLANDPDADRFSAAVKD     W+QLTGN++G LFA    
Sbjct: 311 EEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGN--KWKQLTGNQLGYLFAV--- 365

Query: 369 XXXXXXXXXXXXXHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMN 428
                         PLAML STVSSQ+I KMA++E F +++TLTGFKW+ NR +DLE   
Sbjct: 366 GQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425

Query: 429 YYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVF 488
           +YVPF +EEAIGYMF  + HDKDG+SAA+ FLQM  +W     KT L VL   +EKYG F
Sbjct: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARW-KKEGKTPLDVLNAGYEKYGNF 484

Query: 489 KEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQ 548
            EYNGYYSV D  +I +VF +IRN  +    PYPS IG E  V  FRDLT+GYQSDT N 
Sbjct: 485 VEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNH 544

Query: 549 RPDLPVDPNSQMITA----WTKVNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERAS 604
            P+LPV P S MIT       K       + VRFTIRGSGTEPKLKVYIE+ +  +E A+
Sbjct: 545 IPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYAT 604

Query: 605 ELAQLTWRVLKREWFRPDVTGLTTTF 630
           +LA+LTW VLKREWFRP+VTGL T F
Sbjct: 605 KLAKLTWDVLKREWFRPEVTGLQTKF 630

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 58/132 (43%), Gaps = 30/132 (22%)

Query: 123 VATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEV---------GASVGVMITASHNPKMDN 173
           V T+  AGF+       DK      V FT   V         G +VGVM+TASHNP +DN
Sbjct: 24  VYTYGTAGFR-------DKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNPPVDN 76

Query: 174 GYKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIER 233
           G K        I+ P+ S ++Q  E      P A     L  +G   + + +   ++IE 
Sbjct: 77  GVK--------IVEPNGSMLSQDWE------PIATDLANLASQGKIDELVQFVNAKLIEL 122

Query: 234 YTKKMGQSLVDR 245
            + K+   +V R
Sbjct: 123 NSNKVPTLIVGR 134

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNG---CQIIPPHDSEIAQSIEENLTLWPKAWKWDE 212
           G +VGVMITASHNP  DNG K+    G    Q    + +++A S  ++ T +  A+  + 
Sbjct: 55  GRTVGVMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAF-LAYLQNL 113

Query: 213 LLKEGLDTKCLVYAGEEMIERYTKKMGQSLV 243
           + + GLDT  L   G   + R +++ G  L+
Sbjct: 114 VSELGLDTDAL---GSLAVARDSRESGPRLL 141

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 157 ASVGVMITASHNPKMDNGYKVYYSNGCQII---PPHDSEIAQSIEE 199
           A VGVMITASHNP  DNG K+  S+G  ++    P  + +A S+ +
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSVAD 97

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (65%)

Query: 155 VGASVGVMITASHNPKMDNGYKVYYSNGCQII 186
            G  VGVM+TASHNP +DNG KV    G  +I
Sbjct: 56  CGTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQI 185
           G +VGVMITASHNP  DNG K+   NG  +
Sbjct: 51  GKAVGVMITASHNPPEDNGVKIVEPNGAML 80

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 577 RFTIRGSGTEPKLKVYIEACSKSEERASELAQLTWRVLKR 616
           R  +R SGTE  ++VY EA   S+E A EL  L  +++K 
Sbjct: 500 RSFVRASGTEDAVRVYAEA--SSQEEAKELNALVTKLVKE 537

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (67%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQII 186
           G  VGVMITASHNP  DNG KV   +G  +I
Sbjct: 54  GKPVGVMITASHNPSGDNGVKVVEPDGSMLI 84

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 52/119 (43%), Gaps = 19/119 (15%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQSIEENLT---LWPKAWK-WD 211
           GA VGVM+TASHNP  DNG KV    G  +  P   E   +   NL     + + W+ W 
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKVVDPEGGML--PEQWEPLATRLANLAANGTFDQWWEYWT 112

Query: 212 ELLKEGLDTK----CLVYAGEEMIERYTKKMGQSLV----DRTTISAEKEGKPWFVYTP 262
            L++EG  T     C+ +   E   R  K +  + +       TIS     KPW    P
Sbjct: 113 SLVEEGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITIS-----KPWITNHP 166

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 112/302 (37%), Gaps = 52/302 (17%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +      N       T+   Q I    P+     T VVG D RF +     
Sbjct: 19  GTSGLRKKTKVFMDEPNY------TENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASV--GVMITASHN---PKMDNGY 175
              A     G K + +   +  + TP     +      V  G+++TASHN   P  D G 
Sbjct: 73  KIAAIGAANGVKKLIIGQ-NGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 176 KVYYSNGCQIIPPHDSEIAQSI-----------------EENLTLWPKAWKWDELLKEGL 218
           K    NG     P    +  +I                 E +L    +  K+  LL + +
Sbjct: 132 KYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDII 187

Query: 219 DTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKPW-FVYTPIHGVGYDIFRQIAEE 277
           D+        E   +Y K++    + +  I +++E K W  ++  ++GV     + I  +
Sbjct: 188 DS-------TEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFAD 240

Query: 278 TMNLINGRDYLCVKEQQLPDPSFPTV-PFPNPEEKGALDMAISVADKNGISLVLANDPDA 336
              L        V +  +P P F  + P PN      L   +S  DK  I    A+D D 
Sbjct: 241 EFGLPADE----VLQNYVPKPDFGGLHPDPNLTYAKTL---VSRVDKEKIEFGAASDGDG 293

Query: 337 DR 338
           DR
Sbjct: 294 DR 295

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 129 AGFKVIFLNDGDKFVHTPIVPF--TVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186
           AGF+ +  N       T I+    ++   G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 28  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

Query: 187 P---PHDSEIAQS 196
               P+  ++A +
Sbjct: 88  ATWEPYAMQLANT 100

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 129 AGFKVIFLNDGDKFVHTPIVPF--TVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186
           AGF+ +  N       T I+    ++   G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 28  AGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

Query: 187 P---PHDSEIAQS 196
               P+  ++A +
Sbjct: 88  ATWEPYAMQLANA 100

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQII 186
           G  +GVMITASHNP  DNG K+   +G  +I
Sbjct: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 566 KVNGA-KPYESVRFTIRGSGTEPKLKVYIEACSKSEERA--SELAQL 609
           K++ A   Y+S R  +R SGTE  +++Y EA +K+E  A   E+ QL
Sbjct: 490 KIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQL 536

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 21/99 (21%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWK--WDEL 213
           GA VGVM+TASHNP  DNG K        ++ PH   +A   E++ T           EL
Sbjct: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANCASQGQQEL 106

Query: 214 L--------KEGLDTKCLVYAGEEMIERYTKKMGQSLVD 244
           L        + GLD   L      ++ R ++  G  L+D
Sbjct: 107 LDALHMLVDRLGLD---LALRARVVVARDSRASGPQLLD 142

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 573 YESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607
           Y+S R  +R SGTE  +++Y EA   S+++A ELA
Sbjct: 502 YDSGRSFVRASGTEDAVRIYAEA--ASQQQADELA 534

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDSEIAQS 196
           G  VGVMITASHNP  DNG K+   +G  ++    P+  ++A +
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANA 100

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 13/101 (12%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNG---CQIIPPHDSEIAQSIEENLTLWPKAWKWDE 212
           G  VGVMITASHNP  DNG K+    G    Q   P  +E+A S  +      KA   D+
Sbjct: 55  GQYVGVMITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKA--LDK 112

Query: 213 LL-KEGLDTKCLVYAGEEMIERYTKKMG----QSLVDRTTI 248
           L+ K G+D      + +  I R +++ G    Q+++D T +
Sbjct: 113 LITKLGIDD---TESAKITISRDSRESGPRLLQAVIDGTKV 150

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDSEIAQS 196
           G  VGVMITASHNP  DNG K+   +G  ++    P+  ++A +
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANA 100

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 157 ASVGVMITASHNPKMDNGYKVYYSNGCQII 186
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 5/46 (10%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIP----PHDSEIAQSI 197
           G  +GVM+TASHNP +DNG KV   +G  ++P    P  +E+A ++
Sbjct: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTL 100

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 16/128 (12%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR + +   S  N       T+   Q I    P+ +   T VVG D RF +     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASV---GVMITASHN---PKMDNG 174
             +      G + + +   +  + TP   + +     S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIGQ-NGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 175 YKVYYSNG 182
            K   SNG
Sbjct: 132 IKYNLSNG 139

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNG 182
           G +VGVMITASHNP  DNG K+    G
Sbjct: 55  GKTVGVMITASHNPPEDNGVKIVDPKG 81

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 124/578 (21%), Positives = 217/578 (37%), Gaps = 91/578 (15%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR + +      N       T+   Q I    P+       VVG D RF +     
Sbjct: 17  GTSGLRKKTKVFMEEPNY------TENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVG--ASVGVMITASHN---PKMDNGY 175
              A     G + + +   +  + TP     +       + G+++TASHN   P+ D G 
Sbjct: 71  KIAAIGAANGVRKLIIGQ-NGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 176 KVYYSNGCQIIPPHDSEIAQSIEENLTLWP--KAWKWDELLKEGLDTKC--LVYAGEEMI 231
           K   +NG     P  +++ + + + LT +   K +   +  K G D +   L+    +  
Sbjct: 130 KYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188

Query: 232 ERYTKKMGQSL---VDRTTISAEKEGKPW-FVYTPIHGVGYDIFRQIAEETMNLINGRDY 287
           E Y K M +     + +  I  ++E K W  ++  ++G+     + I  +  +L      
Sbjct: 189 EDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLPADE-- 246

Query: 288 LCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNK 347
             V +   P P F  +  P+P    A  + +   D+  I    A+D D DR         
Sbjct: 247 --VLQNWHPQPDFGGL-HPDPNLTYAHTL-VERVDREKIEFGAASDGDGDR--------- 293

Query: 348 TGTWRQLTGNEI-GALFAFXXXXXXXXXXXXXXXXHP-------LAMLNSTVSSQLIMKM 399
                    N I GA  AF                 P         +  S  +S  I ++
Sbjct: 294 ---------NMIYGAGPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRV 344

Query: 400 AEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVF 459
           A+ +  +  +  TG+K+      D + ++      F     ++      +KDG+ A   +
Sbjct: 345 AKAQGLNCYEVPTGWKFF-CALFDAKKLSICGEESFGTGSNHI-----REKDGVWAICAW 398

Query: 460 LQ---MYRKWLVGSKKTLLTVLEDIFEKYG--VFKEYNGYYSVNDPKVIK--EVFDFIRN 512
           L    +Y K     + ++ T+ E+ + KYG   F  Y+ Y  +   K  K  ++ D   N
Sbjct: 399 LNILALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYD-YEGITTEKANKVVDLLDKFVN 457

Query: 513 DYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLPVDPNSQMITAWTKVNGAKP 572
           D    + P+P    E L V+   D +      +V+    L V  +          NGA  
Sbjct: 458 DPKSKNAPFPGD--ESLTVSDCGDFSYTDLDGSVSDHQGLFVKLS----------NGA-- 503

Query: 573 YESVRFTIRGSGTEPK---LKVYIEACSKSEERASELA 607
               RF +R SGT      +++YIE  S  +   ++ A
Sbjct: 504 ----RFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSA 537

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 115/299 (38%), Gaps = 46/299 (15%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +      N       T+   Q I    P+     T VVG D R+ +     
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHNP---KMDNGY 175
              A     G K + +      + TP     +   E     G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQ-RGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 176 KVYYSNGCQIIPPHDS---EIAQSI----------EENLTLWPKAWKWDELLKEGLD-TK 221
           K   SNG     P  +   EI++ +          E  L    K  K+  LL + +D TK
Sbjct: 132 KFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTTK 191

Query: 222 CLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKPW-FVYTPIHGVGYDIFRQIAEETMN 280
             V         + K++    + +  +  +++ K W  ++  ++GV     + I  + + 
Sbjct: 192 AYV--------EFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELG 243

Query: 281 LINGRDYLCVKEQQLPDPSFPTV-PFPNPEEKGALDMAISVADKNGISLVLANDPDADR 338
           L        V +Q  P P F  V P PN     AL   +   D+  I    A+D D DR
Sbjct: 244 LPADE----VLQQWHPSPDFGGVHPDPNLTYAKAL---VDRVDRENIEFGAASDGDGDR 295

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 159 VGVMITASHNPKMDNGYKV 177
           VGVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQI 185
           G +VGVMITASHN   DNG K+   +G  +
Sbjct: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 122/303 (40%), Gaps = 53/303 (17%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +      N       T+   Q +    P+     T VVG D RF +     
Sbjct: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 121 ATVATFLQAGF-KVIFLNDGDKFVHTPIVPFTVN---EVGASVGVMITASHNP---KMDN 173
              A     G  K++   +G   + TP     +        + G+++TASHNP   K D 
Sbjct: 73  KIAAIGAANGVHKLVIGQNG--ILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDF 130

Query: 174 GYKVYYSNGCQIIPPHDSEIAQSIEEN--LTLWPKAWKWDE--LLKEGLDTKC--LVYAG 227
           G K   SNG    P  +S   +  E++  LT +     + +  L K+G D +   L+   
Sbjct: 131 GIKYNLSNGG---PAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDI 187

Query: 228 EEMIERYTKKMGQSLVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGR-- 285
            +  E Y K M +S+ D   I         F+ T    VG+ +      +++N + G   
Sbjct: 188 IDSTEAYVKLM-KSIFDFDLIKK-------FIKTQKETVGFKLLF----DSLNGVTGPYG 235

Query: 286 -----DYLCVKEQQ-----LPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPD 335
                D L +  ++     +P P F  +  P+P    A  + +   DK+ I+   A+D D
Sbjct: 236 KALFVDELGLSAEESLQNYVPKPDFGGL-HPDPNLTYAHTL-VERVDKDKIAFGAASDGD 293

Query: 336 ADR 338
            DR
Sbjct: 294 GDR 296

>Suva_1.108 Chr1 (168573..169385) [813 bp, 270 aa] {ON} YAR035W
           (REAL)
          Length = 270

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 4   RIIQSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILN-LCKAKDWL----ELHKRLD 58
           +  Q+   E I SV     Q V S L QD + QT++++L+  C A   +    E H+R+ 
Sbjct: 93  KAFQNGRTEAIRSVTLQSKQFVKSLLDQDASDQTKIDLLHAACAAHSKITAECEDHRRVL 152

Query: 59  TRILFGTAGLRS 70
            R   G   LR+
Sbjct: 153 PRARPGPPPLRA 164

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 156 GASVGVMITASHNPKMDNGYKV 177
           G  VG MITASHNP  DNG K+
Sbjct: 55  GQYVGAMITASHNPPQDNGVKL 76

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 571 KPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607
           K Y++ R  +R SGTE  +++Y EA +K  E+A +L+
Sbjct: 503 KSYDNARSFVRASGTEDAVRIYAEAATK--EQADDLS 537

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 55/126 (43%), Gaps = 12/126 (9%)

Query: 64  GTAGLRSRMEAGFSRMN-TLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALAT 122
           GT+GLR +       ++ T   +QAT    + I    P  +T VVG D RF +       
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT---IESIPNG-PGGVTLVVGGDGRFYNDVIMNKI 74

Query: 123 VATFLQAGFKVIFLNDGDKFVHTPI---VPFTVNEVGASVGVMITASHN---PKMDNGYK 176
            A     G + + +  G   + TP    V  T  +  +  G+++TASHN   P+ D G K
Sbjct: 75  AAVGAANGVRKLVIGQGG-LLSTPAASHVIRTYEDKCSGGGIILTASHNPGGPENDLGIK 133

Query: 177 VYYSNG 182
               NG
Sbjct: 134 YNLPNG 139

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 21/130 (16%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQA---TQGLAQHIKKQFPDAL---TAVVGHDHRFNSQE 117
           GT+GLR +         T V ++    T+   Q I +  P+     T V+G D RF +  
Sbjct: 20  GTSGLRKK---------TAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 118 FALATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVG--ASVGVMITASHN---PKMD 172
                 A     G + + +   +  + TP   + +      A+ G+++TASHN   P+ D
Sbjct: 71  VINKIAAISAANGVRKLVIGQ-NGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPEND 129

Query: 173 NGYKVYYSNG 182
            G K   +NG
Sbjct: 130 MGIKYNLANG 139

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 51/125 (40%), Gaps = 10/125 (8%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATV 123
           GT+GLR + +   +  +        Q + + I    PD  T VVG D RF +        
Sbjct: 19  GTSGLRKKTKVFMNEPH--YTENFIQAMMESIPNG-PDGATLVVGGDGRFYNDVIMNKIA 75

Query: 124 ATFLQAGFKVIFLNDGDKFVHTPIVPF---TVNEVGASVGVMITASHN---PKMDNGYKV 177
           A     G + + +  G   + TP       T  +     G+++TASHN   P+ D G K 
Sbjct: 76  AVGAANGIRKLIIGQGG-LLSTPAASHIIRTYEDRCNGGGIILTASHNPGGPENDLGIKY 134

Query: 178 YYSNG 182
              NG
Sbjct: 135 NLRNG 139

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 15/127 (11%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +      N       T+   Q I +  P+     T VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHN---PKMDNGY 175
              A     G K + +      + TP     +   E   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIGQ-HGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 176 KVYYSNG 182
           K   SNG
Sbjct: 132 KYNLSNG 138

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +    + N       T+   Q I +  P+     T VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHN---PKMDNGY 175
              A     G K + +      + TP     +   E   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQ-HGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 176 KVYYSNG 182
           K   SNG
Sbjct: 132 KYNLSNG 138

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 59/146 (40%), Gaps = 21/146 (14%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFP---DALTAVVGHDHRFNSQEFAL 120
           GT+GLR +        N       T+   Q I +  P   D  T VVG D R+   +  L
Sbjct: 19  GTSGLRKKTVIFKDEPNY------TENFIQAIMESIPEGSDGATLVVGGDGRY-YNDVIL 71

Query: 121 ATVATFLQA-GFKVIFLNDGDKFVHTPIVPFTVNEVGASV--GVMITASHN---PKMDNG 174
             +A    A G K + +   +  + TP     +      V  G+++TASHN   PK D G
Sbjct: 72  EKIAKIGAANGVKKLVVGQ-NGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMG 130

Query: 175 YKVYYSNGCQIIPPHDSEIAQSIEEN 200
            K   +NG     P    +   I EN
Sbjct: 131 IKYNLANGG----PAPESVTDKIWEN 152

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 113/298 (37%), Gaps = 43/298 (14%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR +  A F +         T+   Q I +  P+     T VVG D R+ +     
Sbjct: 20  GTSGLRKKT-AIFEKEPNY-----TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGA---SVGVMITASHN---PKMDNG 174
              A     G K + +   +  + TP     +        + G+++TASHN   PK D G
Sbjct: 74  NIAAIGAANGVKKLIVGQ-NGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 175 YKVYYSNGCQIIPPHDSEIAQSI-------------EENLTLWPKAWKWDELLKEGLDTK 221
            K    NG     P    I ++              E  L    K  ++  LL + +DT 
Sbjct: 133 IKYNIQNGAPAPEPVTEAIWEASKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVIDT- 191

Query: 222 CLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKPW-FVYTPIHGVGYDIFRQIAEETMN 280
           C  Y       ++ K++    + +  +  +++ K W  ++  ++GV     + I  + + 
Sbjct: 192 CEAYV------QFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELG 245

Query: 281 LINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADR 338
           L        V +   P P F     P+P    A  +   V DK  I    A+D D DR
Sbjct: 246 LPADE----VLKDWHPSPDFGG-HHPDPNLTYAKSLVDRV-DKEKIEFGAASDGDGDR 297

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 111/299 (37%), Gaps = 46/299 (15%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR +      + +       T+   Q I    P+     T VVG D R+ +     
Sbjct: 19  GTSGLRKKTRVFKDKPHY------TENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHNP---KMDNGY 175
              A     G K + +      + TP     +   E   + G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKLVVGQ-HGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 176 KVYYSNGCQIIPP-------------HDSEIAQSIEENLTLWPKAWKWDELLKEGLD-TK 221
           K   SNG     P             H   I    E  L    K  K+  LL + +D TK
Sbjct: 132 KYNLSNGGPAPEPVTNKIWEISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDITK 191

Query: 222 CLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKPW-FVYTPIHGVGYDIFRQIAEETMN 280
             V         + K++    + +  I  ++E K W  ++  ++GV     + I  +   
Sbjct: 192 AYV--------DFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFG 243

Query: 281 LINGRDYLCVKEQQLPDPSFPTV-PFPNPEEKGALDMAISVADKNGISLVLANDPDADR 338
           L        V +Q  P P F  V P PN     AL   +   ++  I    A+D D DR
Sbjct: 244 LPADE----VLQQWHPQPDFGGVHPDPNLTYAKAL---VDRVNREKIEFGAASDGDGDR 295

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 52/127 (40%), Gaps = 15/127 (11%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR +     +  N       T+   Q +    P+     T VVG D RF +     
Sbjct: 19  GTSGLRKKTAIFMNEPNY------TENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHN---PKMDNGY 175
              A     G K + +   +  + TP     +   E   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAISAANGVKKLIIGQ-NGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131

Query: 176 KVYYSNG 182
           K   +NG
Sbjct: 132 KYNLANG 138

>ZYRO0G09702g Chr7 complement(769394..771838) [2445 bp, 814 aa] {ON}
           similar to uniprot|P53008 Saccharomyces cerevisiae
           YGL027C CWH41 Processing alpha glucosidase I involved in
           assembly of cell wall beta 1 6 glucan and asparagine-
           linked protein glycosylation ER type II integral
           membrane N-glycoprotein disruption leads to a K1 killer
           toxin- resistant phenotype
          Length = 814

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 272 RQIAEETM-NLINGRDY-----LCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADK 323
           R+ A ET+ NL+ G  Y     L  +  +L + +F  VPF +P+E+G L +  SV  +
Sbjct: 345 RKFAMETLSNLLGGIGYFHGKQLVDRTTELDEDTFREVPFTHPQEEGPLSLFTSVPSR 402

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +    + N       T+   Q I +  P+     T VVG D R+ +     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHN---PKMDNGY 175
              A     G K + +      + TP     +   E   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIGQYG-LLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 176 KVYYSNG 182
           K   SNG
Sbjct: 132 KYNLSNG 138

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +      +       T+   Q I +  P+     T VVG D R+ + E   
Sbjct: 19  GTSGLRKKTKVFKDEPHY------TENFIQAILEAIPEGSENATLVVGGDGRYYNNEVMQ 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEV--GASVGVMITASHN---PKMDNGY 175
              A     G + + L   +  + TP     +       + G+++TASHN   P+ D G 
Sbjct: 73  IIGAIAAANGVRKMILGQ-NGILSTPAASHIIRSYPEKCTGGIILTASHNPGGPENDFGI 131

Query: 176 KVYYSNG 182
           K   SNG
Sbjct: 132 KYNLSNG 138

>Ecym_4713 Chr4 complement(1394882..1401346) [6465 bp, 2154 aa] {ON}
           similar to Ashbya gossypii ADR290W
          Length = 2154

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 15/90 (16%)

Query: 493 GYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRD-LTLGYQSDTVNQRPD 551
           G+  VNDP  I  + D +RN   E  D Y  +  E ++    R  L L Y+S T      
Sbjct: 875 GFKHVNDPTAIAALQDSVRNKNEEAWDLYVKKETEAIRGCTLRGLLELDYESST-----P 929

Query: 552 LPVDPNSQMITAWTKV-----NGAKPYESV 576
           +P+    + +  WT++      GA  Y S+
Sbjct: 930 IPL----EQVEPWTEIARRFATGAMSYGSI 955

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 50/128 (39%), Gaps = 16/128 (12%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +      +       T+   Q   +  P+     T VVG D RF +     
Sbjct: 19  GTSGLRKKTKVFMDEPHY------TENFIQATMQSIPNGSEGTTLVVGGDGRFYNDVIMN 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPF---TVNEVGASVGVMITASHN---PKMDNG 174
              A     G + + +  G   + TP       T  E     G+++TASHN   P+ D G
Sbjct: 73  KIAAVGAANGVRKLVIGQGG-LLSTPAASHIIRTYEEKCTGGGIILTASHNPGGPENDLG 131

Query: 175 YKVYYSNG 182
            K    NG
Sbjct: 132 IKYNLPNG 139

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 114/291 (39%), Gaps = 30/291 (10%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR R +      N       T+   Q I +  P+ +     +VG D R+ +     
Sbjct: 19  GTSGLRKRTKVFAEEPNY------TENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTV---NEVGASVGVMITASHNPKMDN---G 174
              A     G K + +   +  + TP     +   ++   + G+++TASHNP   N   G
Sbjct: 73  KIAAIGAANGVKRLVVGQ-NGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 175 YKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIER- 233
            K   +NG    P + +       + LT +     +  +    L  K       ++I+  
Sbjct: 132 IKYNLANGGP-APENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDST 190

Query: 234 -----YTKKMGQSLVDRTTISAEKEGKPW-FVYTPIHGVGYDIFRQIAEETMNLINGRDY 287
                + K +    + ++ ++ ++E K W  ++  ++GV     R I  + + L      
Sbjct: 191 KAYVDFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLPEDE-- 248

Query: 288 LCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADR 338
             V +   P P F  +  P+P    A  +   V D+  I+   A+D D DR
Sbjct: 249 --VLQNCHPKPDFGGL-HPDPNLTYARTLVDRV-DRENIAFGAASDGDGDR 295

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR +  A F+          T+   Q + +  P+     T VVG D R+ +     
Sbjct: 19  GTSGLRKKT-AVFTNEP-----HYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVN--EVGASVGVMITASHN---PKMDNGY 175
              A     G + + +   +  + TP     +   +   + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIGQ-NGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 176 KVYYSNG 182
           K   SNG
Sbjct: 132 KYNLSNG 138

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 117/294 (39%), Gaps = 37/294 (12%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDA---LTAVVGHDHRFNSQEFAL 120
           GT+GLR + +  F +         T+   Q I +  P+       V+G D R+ +     
Sbjct: 19  GTSGLRKKTKV-FEQTE-----HYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 121 ATVATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASV--GVMITASHNPKM-DNGYKV 177
                    G + + +   +  + TP     +      V  G+++TASHNP   DN + +
Sbjct: 73  KIAEVGSANGVRKLIIGQ-NGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDNDFGI 131

Query: 178 YY--SNGCQIIPPHDSEIAQSIEE---NLTLWPKAWKWDEL----LKEGLDTKCLVYAGE 228
            Y  +NG     P   ++  S+ E   NLT +       +L    + E      L+    
Sbjct: 132 KYNLANGA----PAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLLVDVI 187

Query: 229 EMIERYTKKMGQ----SLVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLING 284
           +  E Y + M +     L+ +    A+KE     ++  ++G+     + I  + + L   
Sbjct: 188 DPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDELGL--S 245

Query: 285 RDYLCVKEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADR 338
            D L   +  +P P F  +  P+P    A  + +S  D+  I+   A+D D DR
Sbjct: 246 EDSL---QNFVPKPDFGGL-HPDPNLTYAHTL-VSRVDRENIAFGAASDGDGDR 294

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 54/129 (41%), Gaps = 17/129 (13%)

Query: 64  GTAGLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDAL---TAVVGHDHRFNSQEFAL 120
           GT+GLR + +   +  N       T+   Q I    P+     T VVG D RF   +  L
Sbjct: 19  GTSGLRKKTKIFMNEPNY------TENFIQAILDAIPEGSEDSTLVVGGDGRF-YNDVIL 71

Query: 121 ATVATFLQA-GFKVIFLNDGDKFVHTPIVPFTVNEVGASV--GVMITASHN---PKMDNG 174
             +A    A G + + +      + TP     +      V  G+++TASHN   P+ D G
Sbjct: 72  QLIAEIGAANGVRKLIIGQA-GILSTPATSHVIRTYHEEVTGGIILTASHNPGGPENDIG 130

Query: 175 YKVYYSNGC 183
            K   +NG 
Sbjct: 131 IKYNLANGA 139

>Kpol_526.35 s526 complement(84706..86673) [1968 bp, 655 aa] {ON}
           complement(84706..86673) [1968 nt, 656 aa]
          Length = 655

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 10/76 (13%)

Query: 222 CLVYAGEEMIERYTKKMGQSLVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNL 281
           CL+   +  + ++T+ +     D   IS   E          +G+ +    QIAEET++L
Sbjct: 104 CLICRTDNELVKFTEDVDAQFDDVKNISETSEK---------YGIAFAT-NQIAEETLSL 153

Query: 282 INGRDYLCVKEQQLPD 297
           +  +  +C+K+Q  PD
Sbjct: 154 LKFQCPICLKKQDSPD 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,463,460
Number of extensions: 2883257
Number of successful extensions: 7483
Number of sequences better than 10.0: 78
Number of HSP's gapped: 7565
Number of HSP's successfully gapped: 82
Length of query: 630
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 514
Effective length of database: 40,180,143
Effective search space: 20652593502
Effective search space used: 20652593502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)