Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005608.842ON50950926940.0
ZYRO0G14234g8.842ON50949619040.0
Suva_13.288.842ON53048118930.0
YML115C (VAN1)8.842ON53553118760.0
Smik_13.198.842ON53651718450.0
Skud_13.268.842ON53941717990.0
KAFR0A028308.842ON50746517950.0
NCAS0B003008.842ON52343017900.0
NDAI0E002908.842ON52252917860.0
KNAG0G034208.842ON51143117790.0
Kpol_541.158.842ON49850817540.0
SAKL0D01430g8.842ON44745617140.0
KLLA0D01529g8.842ON50147016610.0
TBLA0B032708.842ON52052116600.0
CAGL0B02321g8.842ON51242616310.0
KLTH0C03828g8.842ON40440416090.0
Ecym_46138.842ON52449615800.0
TPHA0C047808.842ON52551015720.0
ABL124W8.842ON48542415610.0
Kwal_27.102468.842ON33933814090.0
Ecym_35731.479ON4473629851e-129
CAGL0L01331g1.479ON4473629811e-128
NCAS0G041101.479ON4943629771e-127
KNAG0I003001.479ON4573649731e-127
SAKL0D11792g1.479ON4833629741e-126
AFR357W1.479ON4343639691e-126
YEL036C (ANP1)1.479ON5003549741e-126
KAFR0I027701.479ON4553629681e-126
KLTH0C03432g1.479ON4893639711e-126
TBLA0B021701.479ON5723629731e-125
Suva_5.331.479ON4953539661e-125
Smik_5.571.479ON4913539651e-125
NDAI0G003401.479ON5043539661e-125
Kwal_27.101571.479ON4763629611e-125
NDAI0B012501.479ON4463839571e-124
Skud_5.541.479ON4913539611e-124
KLLA0E22155g1.479ON4503649481e-123
TPHA0O004301.479ON5483539561e-123
Kpol_370.51.479ON6453539581e-122
TDEL0C026001.479ON4623629421e-122
ZYRO0F05170g1.479ON6083559261e-118
KLLA0E12849g8.500ON3923555212e-60
TPHA0L013708.500ON3923555003e-57
KNAG0A021508.500ON3963554933e-56
ZYRO0F08492g8.500ON3963554909e-56
NDAI0E030208.500ON3963554863e-55
CAGL0L12804g8.500ON3933574845e-55
YPL050C (MNN9)8.500ON3953554846e-55
NCAS0C023308.500ON3933554846e-55
TDEL0B013708.500ON3963584838e-55
KLTH0E11616g8.500ON3943494821e-54
KAFR0H013908.500ON3983554811e-54
TBLA0H033408.500ON3933554802e-54
Skud_16.2328.500ON3953554802e-54
Smik_16.1868.500ON3953554793e-54
Suva_16.2658.500ON3953554784e-54
SAKL0H11110g8.500ON3933494767e-54
Kwal_27.118648.500ON4533514737e-53
Kpol_1031.788.500ON3923554567e-51
Ecym_25508.500ON3903484522e-50
NCAS0B024408.500ON4003434498e-50
AGL259C8.500ON3893484286e-47
NDAI0C052508.500ON4023414225e-46
KNAG0A039908.500ON3573382572e-23
SAKL0H20438gsingletonON5652091563e-10
ZYRO0G12540g3.295ON95063800.44
Suva_14.3142.296ON28157750.97
TPHA0C034702.296ON26465751.0
KLTH0G10626g2.296ON30357751.1
Smik_14.2982.296ON28157751.1
Kpol_1003.452.296ON28059751.1
YNL032W (SIW14)2.296ON28157751.1
Skud_38.1singletonON28183722.2
TBLA0B054602.503ON27448712.9
KLTH0H01034g7.357ON449131714.2
NCAS0G036902.296ON34960696.4
Ecym_26753.295ON98688698.4
NDAI0G007702.296ON33959688.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00560
         (509 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...  1042   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   738   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   733   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   727   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   715   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   697   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   696   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   694   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   692   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   689   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   680   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   664   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   644   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   644   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   632   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   624   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   613   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   610   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   605   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   547   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   384   e-129
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   382   e-128
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    380   e-127
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   379   e-127
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   379   e-126
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   377   e-126
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   379   e-126
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   377   e-126
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   378   e-126
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   379   e-125
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   376   e-125
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   376   e-125
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   376   e-125
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   374   e-125
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   373   e-124
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   374   e-124
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   369   e-123
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   372   e-123
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   373   e-122
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   367   e-122
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   361   e-118
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   205   2e-60
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   197   3e-57
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   194   3e-56
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   193   9e-56
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   191   3e-55
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   191   5e-55
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   191   6e-55
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   191   6e-55
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   190   8e-55
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   190   1e-54
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   189   1e-54
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   189   2e-54
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   189   2e-54
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   189   3e-54
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   188   4e-54
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   187   7e-54
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   186   7e-53
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   180   7e-51
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   178   2e-50
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   177   8e-50
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   169   6e-47
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   167   5e-46
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...   103   2e-23
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    65   3e-10
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    35   0.44 
Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W...    33   0.97 
TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.29...    33   1.0  
KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar...    33   1.1  
Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W...    33   1.1  
Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON} (10663...    33   1.1  
YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyros...    33   1.1  
Skud_38.1 Chr38 (502..1347) [846 bp, 281 aa] {ON} YNL032W (REAL)       32   2.2  
TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {...    32   2.9  
KLTH0H01034g Chr8 complement(107338..108687) [1350 bp, 449 aa] {...    32   4.2  
NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296     31   6.4  
Ecym_2675 Chr2 complement(1304086..1307046) [2961 bp, 986 aa] {O...    31   8.4  
NDAI0G00770 Chr7 complement(162781..163800) [1020 bp, 339 aa] {O...    31   8.5  

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/509 (98%), Positives = 499/509 (98%)

Query: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF 60
           MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF
Sbjct: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF 60

Query: 61  KFLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKI 120
           KFLSTVILG          IWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKI
Sbjct: 61  KFLSTVILGSSESSSPLPSIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKI 120

Query: 121 TQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAEN 180
           TQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAEN
Sbjct: 121 TQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAEN 180

Query: 181 VLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMS 240
           VLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMS
Sbjct: 181 VLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMS 240

Query: 241 EKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSD 300
           EKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSD
Sbjct: 241 EKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSD 300

Query: 301 RHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMV 360
           RHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMV
Sbjct: 301 RHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMV 360

Query: 361 PNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRD 420
           PNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRD
Sbjct: 361 PNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRD 420

Query: 421 ANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 480
           ANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL
Sbjct: 421 ANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 480

Query: 481 PHYTLWHIYEPSDDDLKEIGNKEREKRRE 509
           PHYTLWHIYEPSDDDLKEIGNKEREKRRE
Sbjct: 481 PHYTLWHIYEPSDDDLKEIGNKEREKRRE 509

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/496 (71%), Positives = 406/496 (81%), Gaps = 9/496 (1%)

Query: 17  NYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMFKFLSTVILGXXXXXXX 76
            Y+LP S SKL+PK K +S  W     ++I +W +I+V+  +++K  S V+ G       
Sbjct: 20  GYKLPTSHSKLSPKGKRSS--WQN---RKIVSWVIITVMVLILYKAFSGVVRGGREVMKT 74

Query: 77  XXXIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKF 136
                T S D   L ++AYYDYDFE+IDP VI+KFD GV +Y ITQFG + +T ++   F
Sbjct: 75  VGSN-TSSNDGQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVF 133

Query: 137 EQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPH 196
           E+E  MLL STVE YD+  FRG+ N A N EHVLLCVPLRDAE VLPLMFKHLMN+TYPH
Sbjct: 134 EREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPH 193

Query: 197 ELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKER---KKGGENLYL 253
           ELIDLAFLVSDC+E D TLDALIAYSRQLQ+GTLSQVFA+++ +  E     KG E LYL
Sbjct: 194 ELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYL 253

Query: 254 QYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKL 313
           +YM+ DYL+ VK+SFSPPFHENYDK FRSVQ+FQKDFGQ IGQGFSDRHAVKVQG+RRKL
Sbjct: 254 KYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKL 313

Query: 314 MARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDG 373
           M RARNWLTANALKPYHSWVYWRDADVELCPGSVI+DLM+KDYDV VPNVWRPLP FLDG
Sbjct: 314 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDG 373

Query: 374 QQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDG 433
           +QPYDLNSW+ES EAL+LAKTLDEDDVIVEGYAEYPT+R HLAY RD   DPNE+++LDG
Sbjct: 374 EQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDG 433

Query: 434 VGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 493
           VGGVSILA+A LFR GI FPAFTFENHAETE FGKMAKKMG+RVGGLPHYTLWHIYEPSD
Sbjct: 434 VGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSD 493

Query: 494 DDLKEIGNKEREKRRE 509
           DDL+EI NKERE RRE
Sbjct: 494 DDLREIANKERESRRE 509

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/481 (71%), Positives = 402/481 (83%), Gaps = 4/481 (0%)

Query: 29  PKTKSASFTWNGSRVKRIANWALISVICFLMFKFLSTVILGXXXXXXXXXXIWTKSYDTI 88
           P++ S+ F      V  I+   +I +  +LM  FLS + LG          + +++Y TI
Sbjct: 53  PRSSSSKFQL---AVNVISLVIIIVLSLYLMILFLSEMKLGISIQNGNPL-LGSENYKTI 108

Query: 89  TLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTV 148
            L DE YY+YDFE+IDP+V+ KFD+GV +Y ITQFG E +T  +  K+++E+SMLLDSTV
Sbjct: 109 DLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTV 168

Query: 149 EKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDC 208
           EKYD+  F G  N  E ++H+LLC+PLR+A +VLPLMFKHLMN+TYPHELIDLAFLVSDC
Sbjct: 169 EKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDC 228

Query: 209 SEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSF 268
           SEGD TLDALIAYSRQLQNGTLS++F E++     + KG + LYL+YMD+DY+ RV  +F
Sbjct: 229 SEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAF 288

Query: 269 SPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKP 328
           SPPFH+NYDK FRSVQ+FQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKP
Sbjct: 289 SPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKP 348

Query: 329 YHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREA 388
           YHSWVYWRDADVELCPGSVIQDLM+K+YDV+VPNVWRPLP FL+ +QPYDLNSW+ES EA
Sbjct: 349 YHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEA 408

Query: 389 LDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRL 448
           LDLAKTLDEDDVIVEGYAEYPTWR HLAY RDA GDPNEVV+LDGVGGVSILA+A++FR 
Sbjct: 409 LDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRN 468

Query: 449 GIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508
           G+ FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDLKEI  +EREKRR
Sbjct: 469 GVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528

Query: 509 E 509
           +
Sbjct: 529 Q 529

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/531 (66%), Positives = 413/531 (77%), Gaps = 22/531 (4%)

Query: 1   MMFRWGSKREKRKDDDNYRLPVSR--SKLNPKTKSASFTWNGSRVK-------------- 44
           M F   S  +K+  D+   LP+SR  S  N K K +    N  + K              
Sbjct: 3   MFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKFQL 62

Query: 45  --RIANWALISVICFLMF-KFLSTVILGXXXXXXXXXXIWTKS---YDTITLSDEAYYDY 98
              I +  +I+V+   +F  FLS + +G            +KS   Y TI L DE YYDY
Sbjct: 63  TVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYYDY 122

Query: 99  DFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRG 158
           DFE+IDP+VI KFD+GV +Y I+QFG E +T ++  K+++E++ML DSTVE+YD+  F G
Sbjct: 123 DFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEG 182

Query: 159 TTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDAL 218
             N  E ++H+LLC+PLR+A +VLPLMFKHLMN+TYPHELIDLAFLVSDCSEGD TLDAL
Sbjct: 183 APNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDAL 242

Query: 219 IAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDK 278
           IAYSR LQNGTLSQ+F E++     + KG + LYL+YMD+ Y+ RV  +FSPPFHENYDK
Sbjct: 243 IAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDK 302

Query: 279 SFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDA 338
            FRSVQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDA
Sbjct: 303 PFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDA 362

Query: 339 DVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDED 398
           DVELCPGSVIQDLM+K+YDV+VPNVWRPLP FL  +QPYDLNSW+ES+EAL LAKTLDED
Sbjct: 363 DVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDED 422

Query: 399 DVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFE 458
           DVIVEGYAEYPTWR HLAY RDA GDPNE V+LDGVGGVSILA+A++FR G+ FPAFTFE
Sbjct: 423 DVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFE 482

Query: 459 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509
           NHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDLKEI ++EREKRR+
Sbjct: 483 NHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/517 (66%), Positives = 404/517 (78%), Gaps = 26/517 (5%)

Query: 7   SKREKRKDDDNYRLPVSRSK----------------------LNPKTKSASF--TWNGSR 42
           S R+++  D+   LP+SR+                         P++KS+ F  T N   
Sbjct: 9   SNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKFQMTVNAIS 68

Query: 43  VKRIANWALISVICFLMFKFLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFEN 102
           +  I   +L   I FL    +   I              + +Y TI L DE YYDYDFE+
Sbjct: 69  LIIITILSLYLSISFLTGMSIGVPIQNGRPLLGSSKS--SDNYKTIDLEDEEYYDYDFED 126

Query: 103 IDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNA 162
           IDP+V+ KFDNGV +Y I+QFG + +T ++  K++ E+SMLLDSTVEKYD+ +F G +N 
Sbjct: 127 IDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNG 186

Query: 163 AENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYS 222
            E ++H+LLCVPLR+A +VLPLMFKHLMN+TYPHELIDLAFLVSDCSE D TLDALIAYS
Sbjct: 187 VETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYS 246

Query: 223 RQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRS 282
           RQLQNGTLSQ+F E++     + KG + LYLQYMDQ+Y+ RV+ +FSPPFHENYDK FRS
Sbjct: 247 RQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRS 306

Query: 283 VQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVEL 342
           VQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVEL
Sbjct: 307 VQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 366

Query: 343 CPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIV 402
           CPGS+IQDLM+K+YDV+VPNVWRPLP FL+ +QPYDLNSW+ES+E L+LAKTLDEDDVIV
Sbjct: 367 CPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIV 426

Query: 403 EGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAE 462
           EGYAEYPTWR HLAY RDA GDPNEV++LDGVGGVSILA+A+LFR G+ FPAFTFENHAE
Sbjct: 427 EGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAE 486

Query: 463 TEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEI 499
           TEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDLKEI
Sbjct: 487 TEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/417 (76%), Positives = 367/417 (88%)

Query: 84  SYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSML 143
           +Y TI L DE YY+YDFE+IDP+VI KFD G  +Y I+QFG E +  E   ++++E++ML
Sbjct: 108 NYKTIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNML 167

Query: 144 LDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAF 203
           LDSTVEKYD+  F G  N  E ++H+LLC+PLR+A +VLPLMFKHLMN+TYPHELIDLAF
Sbjct: 168 LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227

Query: 204 LVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQR 263
           LVSDCSEGD TLDALIAYSRQLQNGTLSQ+F +++     + KG + LYL+YMD+DY+ R
Sbjct: 228 LVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINR 287

Query: 264 VKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTA 323
           V  +FSPPFH+NYDK FRSVQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTA
Sbjct: 288 VHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 347

Query: 324 NALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWI 383
           NALKPYHSWVYWRDADVELCPGSVI+DLM+K+YDV+VPNVWRPLP FL+ +Q YDLNSW+
Sbjct: 348 NALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWM 407

Query: 384 ESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARA 443
           ESREAL+LAKTLDEDDVIVEGYAEYPTWR HLAY RDA G+PNEVV+LDGVGGVSILA+A
Sbjct: 408 ESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKA 467

Query: 444 RLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
           ++FR G+ FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDLKEI 
Sbjct: 468 KIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/465 (69%), Positives = 384/465 (82%)

Query: 44  KRIANWALISVICFLMFKFLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFENI 103
           KR  N+A I    F+ F  L  ++            I   +  TI LSD+ YY++DFE+I
Sbjct: 43  KRRLNYAKIIFGFFVSFLILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDI 102

Query: 104 DPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAA 163
           DP VI+KFD G  +Y I+QFG + +T E+   +E+E++ML DST+E YD++ F G  N A
Sbjct: 103 DPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGA 162

Query: 164 ENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSR 223
           EN++HVLLC+PLRDA +VLPLMF+HLMN+TYPHELIDLAFLVSDCSE D+TLDALI +S+
Sbjct: 163 ENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSK 222

Query: 224 QLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSV 283
            LQNGTLSQV  E++   KE      NL+L+YMD +YL+RV+ +FSPPFHE+YDK FRSV
Sbjct: 223 NLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSV 282

Query: 284 QIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELC 343
           QIF+K+FGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDAD+ELC
Sbjct: 283 QIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELC 342

Query: 344 PGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVE 403
           PGSVI+DLMAKDYDV+VPNVWRPLP FL G+QPYDLNSW ES EAL LA+TLDEDDVIVE
Sbjct: 343 PGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVE 402

Query: 404 GYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAET 463
           GYAEYPTWR HLAY RD  G+P+EVV++DGVGGVSILA+A+LFR G+ FPAFTFENHAET
Sbjct: 403 GYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAET 462

Query: 464 EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508
           EAFGKMAKKMG++VGGLPHYTLWHIYEPSDDDLKE+ NKERE+RR
Sbjct: 463 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/430 (73%), Positives = 372/430 (86%), Gaps = 3/430 (0%)

Query: 82  TKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVS 141
           T SY T  L++  YYD+DFE+I+P V+KKFDNGV +Y I+Q+G + +T  +   + +E+ 
Sbjct: 93  TASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQ 152

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           M+LD++VEKYD+  F G++N A N++H+LLCVPLRDAE+VLPLMFKHLMN+TYPHELIDL
Sbjct: 153 MVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDL 212

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEV---EMSEKERKKGGENLYLQYMDQ 258
           AFLVSDCSEGD TLDAL+AYS+ LQNGTLSQVF E+   EM   ++ KG +NL+L+YM+ 
Sbjct: 213 AFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNP 272

Query: 259 DYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARAR 318
           DYL+ V  SF    H NYDK FRS+Q+FQKDFGQ IGQGFSDRHAVKVQG+RRKLM RAR
Sbjct: 273 DYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRAR 332

Query: 319 NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYD 378
           NWL ANALKPYH+WVYWRDAD+ELCPGSVI+DLM+KDYDV+VPNVWRPLP FLDG+QPYD
Sbjct: 333 NWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYD 392

Query: 379 LNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVS 438
           LNSWIES EAL LAKTLDEDDVIVEGYAEYPTWR HLAY RDA GDPNEVV+LDGVGGVS
Sbjct: 393 LNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVS 452

Query: 439 ILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKE 498
           ILA+A++FR G+ FPAFTFENHAETEAFGKMA+KMGFRVGGLPHYT+WHIYEPSDDDL E
Sbjct: 453 ILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLME 512

Query: 499 IGNKEREKRR 508
           I NKER+ +R
Sbjct: 513 IANKERQNKR 522

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/529 (63%), Positives = 417/529 (78%), Gaps = 31/529 (5%)

Query: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLN-----------PKTKSASFTWNGSRVKRIANW 49
           ++ ++G  R  RKD     LP+SR+  N           PK KS +        K +A  
Sbjct: 4   LLHKFG--RNSRKDA-KLELPISRNNSNVADELKKQRFIPKKKSTA--------KNVAIG 52

Query: 50  ALIS-VICFLMFK-----FLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFENI 103
           +++S +IC L++      F ++  LG            + SY T  LSD+ YY+YDFENI
Sbjct: 53  SVVSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENI 112

Query: 104 DPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAA 163
           + DV+ KF+NGV +Y I++FG + +T ++  ++E+E++MLLD++VEKYD+++F G+ N A
Sbjct: 113 EADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGA 172

Query: 164 ENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSR 223
           EN++H+LLCVPLRDAE+VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD+TL+AL+ YSR
Sbjct: 173 ENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSR 232

Query: 224 QLQNGTLSQVFAEVEMSEKERK---KGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSF 280
            LQNGTLSQVF +++  + E     +G +NL+L+YM+Q+YL+ V+ +F+ P HENYDK F
Sbjct: 233 HLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPF 292

Query: 281 RSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADV 340
           RSVQIF+KDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWL ANALKPYHSWVYWRDAD+
Sbjct: 293 RSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADI 352

Query: 341 ELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDV 400
           ELCPG++++D+MA DYDV+VPNVWRPLP FLD +QPYDLNSWIES EAL LAKTL EDDV
Sbjct: 353 ELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDV 412

Query: 401 IVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENH 460
           IVEGYAEYPTWR HLAY R+A GDP  VV+LDGVGGVSILA+A+LFR G+HFPAFTFENH
Sbjct: 413 IVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENH 472

Query: 461 AETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509
           AETE FGKMAK+MG+RVGGLPHYT+WHIYEPSDDDLKEI NKER+ R +
Sbjct: 473 AETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/431 (73%), Positives = 376/431 (87%), Gaps = 7/431 (1%)

Query: 84  SYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSML 143
           +Y T+ L +  YY+YDFE +DP VI KFD GV +Y I++FG + +T ++  ++E EV  L
Sbjct: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142

Query: 144 LDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAF 203
            DSTV++YD+ +F G+ +   N++HVL+CVPLRDAE VLPLMFKHLMN+TYPHELID+AF
Sbjct: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202

Query: 204 LVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVE-----MSEKERKKGGENLYLQYMDQ 258
           LVSDCS+ D+TL+ALIAYSRQLQNGTLSQ+F E++     ++ K+RK     LYL+YM Q
Sbjct: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNN--KLYLKYMKQ 260

Query: 259 DYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARAR 318
           +YL +V+ +F+PP+HENYDK FRSVQIF+K+FGQ IGQGFSDRHAVKVQG+RRKLM R+R
Sbjct: 261 EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR 320

Query: 319 NWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYD 378
           NWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+MAKDYDV+VPNVWRPLP FL+G+QPYD
Sbjct: 321 NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD 380

Query: 379 LNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVS 438
           LNSW+ES EAL+LA+TLDEDDVIVEGYAEYPTWR HLAY RD  GDP+EVV+LDGVGGVS
Sbjct: 381 LNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440

Query: 439 ILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKE 498
           ILARA+LFR G+ FPAFTFENHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL+E
Sbjct: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE 500

Query: 499 IGNKEREKRRE 509
           I NKEREKRRE
Sbjct: 501 IANKEREKRRE 511

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/508 (63%), Positives = 403/508 (79%), Gaps = 11/508 (2%)

Query: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF 60
           M F   +KR+ +K D+   LP+S S+  PK+K        +    +   A+I++I FL+F
Sbjct: 1   MDFLLNNKRQLKKKDE---LPISDSRWAPKSKYRHKFNPANSENFVKINAIITLILFLVF 57

Query: 61  KFLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKI 120
                 I            + + + +   L D  YYDYDF+N D  ++KKFD+G  +Y I
Sbjct: 58  ------ICQNSFSSSSSNVVDSHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLI 111

Query: 121 TQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAEN 180
           +++G E +T E+ +++EQE+  LL +TV+ YD+ ++ GT N  +N+EHVLLCVPLRDAE+
Sbjct: 112 SKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAED 171

Query: 181 VLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMS 240
           VLPLMFK++MN+TYPHELIDLAFLVSDC+EGDHTL++LIAYSR LQ+GTL+ +F E  M 
Sbjct: 172 VLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQE--MD 229

Query: 241 EKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSD 300
           + + KK  E LYL+YM++DYL+ V+D++SPPFH +Y+K FRSVQIFQKDFGQ++GQGF++
Sbjct: 230 KDDSKKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTE 289

Query: 301 RHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMV 360
           RH+VKVQG+RRKLM RARNWL  NALKPYH+WVYWRDADVELCPG+VI+DLM+K++DVMV
Sbjct: 290 RHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMV 349

Query: 361 PNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRD 420
           PNVWRPLP FL+ +QPYDLNSW+ES EAL LAK LDEDDVIVEGYAEYPTWR HLAY R+
Sbjct: 350 PNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIRE 409

Query: 421 ANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 480
            NG+PN+VV+LDGVGGVSIL +A+LFR GIHFPAFTFENHAETEAFGKMAKKMGFRVGGL
Sbjct: 410 KNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 469

Query: 481 PHYTLWHIYEPSDDDLKEIGNKEREKRR 508
           PHYTLWHIYEPSDDDL EI +KERE  R
Sbjct: 470 PHYTLWHIYEPSDDDLLEIASKERENNR 497

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/456 (68%), Positives = 372/456 (81%), Gaps = 10/456 (2%)

Query: 55  ICFLMFKFLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNG 114
           +  L+  FL   ILG              +Y T +L D  YY+YDF+NID D+I+K+D G
Sbjct: 1   MVILIIFFLLNSILGGDPYV---------NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKG 51

Query: 115 VTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVP 174
             ++ I+Q G E +T E+  ++E+EV MLL +TV+ YD+ ++ G+ N AEN++HVLLCVP
Sbjct: 52  AEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVP 111

Query: 175 LRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVF 234
           LR+A NVLPLMFKHLMN+TYPHELIDLAFLVSDCSE D TLDALIAYS++LQNGTLS++F
Sbjct: 112 LRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELF 171

Query: 235 AEV-EMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQK 293
           AE  EM  K   KG  +LYL+YM+QDYL  V+ +F PPFH++YDK FRSVQ+FQKDFGQ 
Sbjct: 172 AEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQV 231

Query: 294 IGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMA 353
           IGQGFSDRHAV VQG+RRKLM RARNWLTANALKPYHSWVYWRD D+ELCPGSVI+DLM+
Sbjct: 232 IGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMS 291

Query: 354 KDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRG 413
            + DV VPNVWRPLP FL G+Q YDLNSW+ES EAL LA TLDEDDVIVEGYAEYPTWR 
Sbjct: 292 LNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRV 351

Query: 414 HLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKM 473
           HL Y R+ + +P E+++LDGVGGVSILA+A+LFR G+HFPAFTFENHAETEAFGKMAKKM
Sbjct: 352 HLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKM 411

Query: 474 GFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509
            +RVGGLPHYT+WHIYEPSDDDLKEI  KEREKRR+
Sbjct: 412 HYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREKRRD 447

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/470 (63%), Positives = 373/470 (79%), Gaps = 10/470 (2%)

Query: 39  NGSRVKRIANWALISVICFLMFKFLSTVILGXXXXXXXXXXIWTKSYDTITLSDEAYYDY 98
           NG R  +     L +++    F  LS ++ G          +    Y   +L ++ YYDY
Sbjct: 39  NGLRYAKSRIVFLFALVLVSTFLLLSKLVGGN---------VNLMQYIPTSLDEQEYYDY 89

Query: 99  DFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRG 158
           DF+ +D D IKK+D GV++Y I++ G E ++SE+   FE+E  MLL ST + YD+ Q+ G
Sbjct: 90  DFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNG 149

Query: 159 TTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDAL 218
            +N A N++HVLLCVPLRDA ++LP++FK+LMN+TYPHELID+AFLVSDC++   T+ +L
Sbjct: 150 ASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSL 209

Query: 219 IAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDK 278
           + +S++LQNGTLS+   + E ++K++    E LYL+YM +DYL+ VK++F+PPFH++YDK
Sbjct: 210 LDFSKELQNGTLSKTLQDFE-ADKDKGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDK 268

Query: 279 SFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDA 338
            FRS+QIF+KDFGQ+IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRD 
Sbjct: 269 PFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDV 328

Query: 339 DVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDED 398
           DVELCPG+VI+DLM  DYDV+VPNVWRPLP FL G Q YDLNSW+ES EA+ LAKTLDED
Sbjct: 329 DVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDED 388

Query: 399 DVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFE 458
           DVIVEGYAEYPTWR HL Y R  NG+P+++++LDGVGGVSILARA+LFR GIHFPAFTFE
Sbjct: 389 DVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFE 448

Query: 459 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508
           NHAETEAFGKMAKKMGF+VGGL HYTLWHIYEPSDDDL+EI   ERE RR
Sbjct: 449 NHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRR 498

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/521 (60%), Positives = 381/521 (73%), Gaps = 24/521 (4%)

Query: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF 60
           M+  +   +EK+K  D   LP +RSKL PK       ++  R      W  I   C  ++
Sbjct: 1   MVLNFSIIKEKQKQKD--ELPTTRSKLYPKKS----VYDRKRRSPAFYWTCILATCLAIY 54

Query: 61  KFLSTVILGXXXXXXXXXXIWTKSYDTITLS--------------DEAYYDYDFENIDPD 106
             L    LG              SY +  LS              D  YYDYDF +ID  
Sbjct: 55  -LLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEM 113

Query: 107 VIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQ 166
               FD G  +Y ITQ+G + +TS++  ++ QE+  LL S+V+KYD+ QF GT N AEN+
Sbjct: 114 SFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENR 173

Query: 167 EHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQ 226
           EH+L   PLRDAE+VLP+MFKHLMN+TYPHELID+AFLVSDCSEGD TLD LI ++R LQ
Sbjct: 174 EHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQ 233

Query: 227 NGTLSQVFAEVEMSEKERKKGGEN---LYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSV 283
           +GTL  +F +++ S  + +K  EN    YL++MDQ+Y++    SF+ P H  Y+K FRSV
Sbjct: 234 DGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSV 293

Query: 284 QIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELC 343
           QIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVELC
Sbjct: 294 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 353

Query: 344 PGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVE 403
           PGSVIQDLM+K+YDV+VPNVWRPLP FL+ +QPYDLNSW+ES EAL+LAKTLDEDDVIVE
Sbjct: 354 PGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVE 413

Query: 404 GYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAET 463
           GYAEYPTWR HLAY RD NGDPN+ +++DGVGGVSILA+A+LFR G+HFPAFTFENHAET
Sbjct: 414 GYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAET 473

Query: 464 EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKER 504
           EAFGKMAKKMG+ VGGLP+Y LWHIYEPSDDDLK++   ER
Sbjct: 474 EAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/426 (69%), Positives = 347/426 (81%), Gaps = 2/426 (0%)

Query: 81  WTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEV 140
           + K Y      D AY+ +DFE+ID D++ KFD G+  Y I+++G E  +  +  ++   +
Sbjct: 89  YHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNL 148

Query: 141 SMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELID 200
            MLLDSTVEKYD+  F+G+ +  E QEH+L+CVPLRDAE VLPLMFK+LMN+TYPHELID
Sbjct: 149 QMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELID 208

Query: 201 LAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDY 260
           LAFLVSDCSEGD TL+AL  YS+ LQ G L  + A+  M    + K  E+++L+YM+ DY
Sbjct: 209 LAFLVSDCSEGDKTLEALETYSQLLQEGILPDILAD--MDNYNKGKSNESIHLKYMEPDY 266

Query: 261 LQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNW 320
           L+RVK ++ PPFH NY K FRSVQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNW
Sbjct: 267 LKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 326

Query: 321 LTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLN 380
           L +NALKPYHSWVYWRDADVELCPGSVI+DLM +DYDV+VPNVWRPLP FL+  QPYDLN
Sbjct: 327 LMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLN 386

Query: 381 SWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSIL 440
           SW+ES EAL LAKTLDEDDVIVEGYAEYPT+R HLAY R+ +GDP +VV+LDGVGGVSIL
Sbjct: 387 SWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSIL 446

Query: 441 ARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
           ARAR+FR G+HF AFTFENHAETEAFGKMAKK+GFRVGGLPHYTLWHIYEPSDDDL  + 
Sbjct: 447 ARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMA 506

Query: 501 NKEREK 506
             E+ K
Sbjct: 507 KLEKGK 512

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/404 (72%), Positives = 343/404 (84%), Gaps = 3/404 (0%)

Query: 107 VIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQ 166
           +++KFDNG  +Y I++ G+E + S +  ++E+EV  LLDSTVE YD+  F G+     N+
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 167 EHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQ 226
           EHVLL VPLR+AE VLPLMFK+LMN+TYPHELIDLAFLVSDCSE D TL+AL+ Y ++LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 227 NGTLSQVFAEVEMSEKE--RKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQ 284
           +GTLS VFA    S++E  ++KG  +L+L+YM   YL+ VKD++SPPFH+ YDK FRSVQ
Sbjct: 121 SGTLSDVFA-AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQ 179

Query: 285 IFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCP 344
           IFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVELCP
Sbjct: 180 IFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCP 239

Query: 345 GSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEG 404
           GSVIQDLM+ D+DV VPNVWRPLP FL G+QPYDLNSWIES  AL LA+TLDEDDVIVEG
Sbjct: 240 GSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEG 299

Query: 405 YAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETE 464
           YAEYPTWR HLAY RD + +P +++ LDGVGGVSILA+A+LFR G+HFPAFTFENHAETE
Sbjct: 300 YAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETE 359

Query: 465 AFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508
           AFGKMAKKMG+RV GLPHYTLWHIYEPSDDDL +I  +EREK+R
Sbjct: 360 AFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 368/496 (74%), Gaps = 7/496 (1%)

Query: 17  NYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMFKFLSTVILGXXXXXXX 76
           N  L    S+ +PK K   F +  S   +    +L+++ C       +    G       
Sbjct: 31  NVPLSPQNSRYHPKVK-GKFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYA 89

Query: 77  XXXIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKF 136
                + SYDT  L +  YY++++  +D D ++++D+G  +  I Q G  T+ S +   F
Sbjct: 90  GLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGF 147

Query: 137 EQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPH 196
           E+ + MLL +TVE YD+ ++ GT N AEN+EHVL+CVPLR+AENVLPLMF+HLMN+TYPH
Sbjct: 148 EEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPH 207

Query: 197 ELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFA---EVEMSEKERKKGGE-NLY 252
           ELIDLAFLVSDCS+ DHT+D+LI+Y+ +LQ GTLS+        +M +K + K  E +L+
Sbjct: 208 ELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLH 267

Query: 253 LQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRK 312
           L+YM++DYL  V+++   PFH+NYDK FRSVQIFQKDFGQ IGQGFSDRH VKVQG RRK
Sbjct: 268 LKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRK 327

Query: 313 LMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLD 372
           LM +ARNWLTANALKPYHSWVYWRDADVELCPGSVI+DLM+  YDV+VPNVWRPLP FL 
Sbjct: 328 LMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLG 387

Query: 373 GQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLD 432
            +Q YDLNSWIES  AL+LAKTLDEDDVIVEGYAEY TWR HLA  RD  G+  +V++LD
Sbjct: 388 SEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLD 447

Query: 433 GVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPS 492
           GVGGVSILA+A+LFR G+HF AF FENHAETEAFGKMAKKMG+RVGGL HYTLWHIYEPS
Sbjct: 448 GVGGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPS 507

Query: 493 DDDLKEIGNKEREKRR 508
           +DDL EI  KER  RR
Sbjct: 508 NDDLMEIARKERSSRR 523

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/510 (59%), Positives = 380/510 (74%), Gaps = 19/510 (3%)

Query: 16  DNYRLPVSRS----------KLNPKTKSASFTWNGSRVKRIANWALISVICFLMFKFLST 65
           ++Y+LP+S            +L PK      T    +V        + ++C  + K +S 
Sbjct: 14  NSYKLPLSEKTKEKRKNRDFRLLPKYSKFKVTNFRDKVSNFNVALSVILLCIFIAKTISV 73

Query: 66  -VILGXXXXXXXXXXIWTKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFG 124
            V +             T ++DT  L+   YY+YDF + + D I K+D GV  Y +  + 
Sbjct: 74  NVSIYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYK 133

Query: 125 EE---TMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENV 181
            +    ++ +    ++ E+  LL S+V+ YDM+ F GT++   ++EHVLLC+PLRDAE+V
Sbjct: 134 TDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDV 193

Query: 182 LPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSE 241
           LPLMFK+LMN+TYPHELID+AFLVSDCSE DHTL++L+ Y+R LQNGTL  VF E++  +
Sbjct: 194 LPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLD 253

Query: 242 KERKKGGEN-----LYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQ 296
           +   K  EN     LYL+YM ++YLQRVK++F  PFHENYDK FRS+QI++KDFGQ +GQ
Sbjct: 254 EMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQ 313

Query: 297 GFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDY 356
            FSDRH VKVQG+RRKLM RARNWL  NALKPYHSWVYWRDADVELCPG+VI+DLM+KD+
Sbjct: 314 SFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDF 373

Query: 357 DVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLA 416
           DV+VPNVWRPLP F++ +QPYDLNSW+ESREA+DLAK L ED+VIVEGYAEYPTWR HLA
Sbjct: 374 DVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLA 433

Query: 417 YFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFR 476
           Y R+ +GDPN+VV++DGVGGVSILARARLFR G+HFPAFTFENHAETEAFGKMAKKMGFR
Sbjct: 434 YLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFR 493

Query: 477 VGGLPHYTLWHIYEPSDDDLKEIGNKEREK 506
           VGGLPHYTLWHIYEPSDDDL  I  KE+E+
Sbjct: 494 VGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/424 (66%), Positives = 342/424 (80%), Gaps = 7/424 (1%)

Query: 89  TLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTV 148
            L D  YYDY+F     + + K+D G  +Y +T+ G+    S +  +FE+++  L+ +TV
Sbjct: 64  VLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATV 120

Query: 149 EKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDC 208
           E+YD+  + GT N AEN+EHVL+C+PLR+A  VLP+MFKHLMN+TYPHELID+AFLVSDC
Sbjct: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180

Query: 209 SEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERK----KGGENLYLQYMDQDYLQRV 264
           SE D TL +L+ Y+  LQ GTL+ V A  E   K  K     GG +LYL+YMDQ+YLQ V
Sbjct: 181 SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV 240

Query: 265 KDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTAN 324
           +D+FSPP+HENY+K FRSVQ+F+KDFGQKIGQGFSDRH VKVQG+RR+LM RARNWLTAN
Sbjct: 241 RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN 300

Query: 325 ALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIE 384
           ALKPYHSWVYWRD DVELCPGSVI+DLM+  YDV+VPNVWRPLP FL G+Q YDLNSWIE
Sbjct: 301 ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE 360

Query: 385 SREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARAR 444
           S +AL+LAK L+EDDVIVEGYAEY TWR HL   R+A G+P EV++LDGVGGVSILA+A+
Sbjct: 361 STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK 420

Query: 445 LFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKER 504
           LFR G HF AF FENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDD+ +I  +ER
Sbjct: 421 LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480

Query: 505 EKRR 508
           E RR
Sbjct: 481 ENRR 484

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/338 (75%), Positives = 291/338 (86%), Gaps = 1/338 (0%)

Query: 173 VPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQ 232
           VPLR+A+ VLPLMFK+LMN+TYPHELIDLAFLVSDCSE D T +AL+ Y+++LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 233 VFAEVEMSEKE-RKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFG 291
           VFA     E   R++G  +L+L+YM   YL+ VKD+F+PPFH+NYDK FRSVQIFQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 292 QKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 351
           Q IGQ FSDRHAVKVQG RRKLM RARNWLTANALKPYHSWVYWRDADVELCPGSVI+DL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 352 MAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTW 411
           MA  YDV VPNVWRPLP FL G+Q YDLNSW+ES  ALDLAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 412 RGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAK 471
           R HL Y R+ +GDP   ++LDGVGGVSILA+A+LFR G+HFPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 472 KMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509
           KMG+ V GLPHYTLWHIYEPSDDDL ++  +ERE +R+
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  384 bits (985), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 187/362 (51%), Positives = 235/362 (64%), Gaps = 47/362 (12%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           V+ YD+  ++G  +  +  + VL CVPLRDA N LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            +  D T+  L+     LQ+                                        
Sbjct: 110 ST--DDTMGVLLNSLHDLQS---------------------------------------- 127

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                  +  K F  ++IFQKDFGQ IGQ FSDRH    QG RRKLMARARNWL + A+K
Sbjct: 128 -----QADGTKRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIK 182

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D D++VPNVWRPLP +L+  QPYDLNSW+ES  
Sbjct: 183 PYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEG 242

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA +L EDDVIVEGY EY TWR HLAY RD NGDP   + LDG+GGVSIL++A++FR
Sbjct: 243 GLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFR 302

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKR 507
            G HFPAF+FE HAETEAFGK++++M + V GLPHY +WH+YEPS DDLK +     E++
Sbjct: 303 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQ 362

Query: 508 RE 509
           R+
Sbjct: 363 RK 364

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 237/362 (65%), Gaps = 49/362 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  + G  +  +  + +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D+T+  L+ + +Q Q                                         
Sbjct: 114 SS--DNTMGVLMHHLQQAQ----------------------------------------- 130

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                 ++ +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMARARNWL + A+K
Sbjct: 131 ------KDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 184

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE+ P S+++DLM  D DV+VPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 185 PYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 244

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA TL ED VIVEGY EY TWR HLAY RD NG+P + + LDG+GGVSIL++AR+FR
Sbjct: 245 GLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFR 304

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKR 507
            G HFPAF+F+ HAETEAFGK++++MGF V GLPHY +WHIYEPS DDLK +     E++
Sbjct: 305 AGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEK 364

Query: 508 RE 509
           R+
Sbjct: 365 RK 366

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  380 bits (977), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 239/362 (66%), Gaps = 47/362 (12%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D+T+  L++    LQN            S+++R K                     
Sbjct: 142 SS--DNTMGVLLS---NLQNA----------QSQQDRSK--------------------- 165

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                       F +++IF+KDFGQ IGQ FSDRH  K QG RRKLMARARNWL + A+K
Sbjct: 166 -----------RFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIK 214

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 274

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA +LDED VIVEGY EY TWR HLAY RD NG+P + + L+G+GGVSIL++A++FR
Sbjct: 275 GLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFR 334

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKR 507
            G HFPAF+FE HAETEAFGK++++M F V GLPHY +WHIYEPS +DLK +     E++
Sbjct: 335 SGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEK 394

Query: 508 RE 509
           R+
Sbjct: 395 RK 396

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  379 bits (973), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/364 (51%), Positives = 237/364 (65%), Gaps = 47/364 (12%)

Query: 146 STVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLV 205
           +  E YD++ +RG +N  +  + +L CVPLRDA   LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 206 SDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVK 265
           SD    D T+  L++  +  Q             S+K+R K                   
Sbjct: 125 SDSK--DDTMGVLLSNLQTAQ-------------SQKDRSK------------------- 150

Query: 266 DSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANA 325
                         F +++ F+KDFGQ IGQ FSDRH    QG RRKLMARARNWL + A
Sbjct: 151 -------------RFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 326 LKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIES 385
           +KPYHSWVYWRD DVE  P ++++DLM    DV+VPNVWRPLP +L   QPYDLNSW ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 386 REALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARL 445
              L+LA +LD+D VIVEGY EY TWR HLAY RD NGDP   + LDG+GGVSIL++AR+
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 446 FRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKERE 505
           FR G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DLK +     E
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 377

Query: 506 KRRE 509
           ++R+
Sbjct: 378 EQRK 381

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  379 bits (974), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 187/362 (51%), Positives = 237/362 (65%), Gaps = 47/362 (12%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + VL CVPLRDA   LP+ FKH+  I+YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L++  ++ Q+                             +QD  QR    
Sbjct: 142 SS--DDTMGVLLSSLKKAQS-----------------------------NQDKSQR---- 166

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                       F +++IF+KDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 167 ------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 214

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  + DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 274

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA +L+ED VIVEGY EY TWR HLAY RD +GDP   + LDG+GGVSIL++A++FR
Sbjct: 275 GLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFR 334

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKR 507
            G HFPAF+FE HAETEAFGK++++M + V GLPHY +WH+YEPS DDLK +     E++
Sbjct: 335 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEK 394

Query: 508 RE 509
           R+
Sbjct: 395 RK 396

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  377 bits (969), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 230/363 (63%), Gaps = 49/363 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE +D+   RG  +     + VL CVPLRDA   LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
               D T+  L  + R+LQ+                                        
Sbjct: 102 SK--DETMSVLRQHVRELQS---------------------------------------- 119

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                  +  + F +++IFQKDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 120 -----QPDNARQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 174

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++I+DLM  D DV+VPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 175 PYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEG 234

Query: 388 ALDLAK-TLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLF 446
            L LA  T DED VIVEGY EY TWR HLAY RD NGDP   + LDG+GGVSIL+RAR+F
Sbjct: 235 GLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVF 294

Query: 447 RLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG-NKERE 505
           R G HFPAF+F+ HAETE FGK+++ MG+ V GLPHY +WHIYEPS DDLK +    E E
Sbjct: 295 RSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 354

Query: 506 KRR 508
           +RR
Sbjct: 355 QRR 357

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  379 bits (974), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 232/354 (65%), Gaps = 47/354 (13%)

Query: 147 TVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVS 206
           +VE YD+  ++G  +  +  + +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 207 DCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKD 266
           D S+                  T+  + + ++M++ ++ K                    
Sbjct: 121 DSSDN-----------------TMGVLLSNLQMAQSQQDKS------------------- 144

Query: 267 SFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANAL 326
                      K F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + AL
Sbjct: 145 -----------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 327 KPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESR 386
           KPYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 387 EALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLF 446
             L LA +LDED VIVEGY EY TWR HLAY RD NG+P + + LDG+GGVSILA+A++F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 447 RLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
           R G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDLK + 
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  377 bits (968), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 188/362 (51%), Positives = 237/362 (65%), Gaps = 48/362 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G ++  +  + +L CVPLRDA   LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L+++ +  Q+                            MD+         
Sbjct: 122 SS--DDTMGVLLSHLQSAQS---------------------------QMDKS-------- 144

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                     K F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 194

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 254

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA+ L+ED VIVEGY EY TWR HLAY RD NGDP E + LDG+GGVSIL++A++FR
Sbjct: 255 GLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 314

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG-NKEREK 506
            G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS +DLK +    E EK
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEK 374

Query: 507 RR 508
           RR
Sbjct: 375 RR 376

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/363 (51%), Positives = 236/363 (65%), Gaps = 47/363 (12%)

Query: 147 TVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVS 206
            V+ YD+  ++G  +  +  +HVL  VPLRDA   LP+ F H+  I+YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 207 DCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKD 266
           D S  D T+  L+ Y ++ Q+                               D  QR   
Sbjct: 112 DSS--DDTMGVLLEYLQKAQSKP-----------------------------DRTQR--- 137

Query: 267 SFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANAL 326
                        F +++I++KDFGQ IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 138 -------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVAL 184

Query: 327 KPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESR 386
           KPYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES 
Sbjct: 185 KPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 244

Query: 387 EALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLF 446
             L LA++LDED VIVEGY EY TWR HLAY RD +GDP + + LDG+GGVSIL++A++F
Sbjct: 245 GGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVF 304

Query: 447 RLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREK 506
           R G HFPAF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDLK +     E+
Sbjct: 305 RAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 364

Query: 507 RRE 509
           +R+
Sbjct: 365 KRK 367

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  379 bits (973), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 233/362 (64%), Gaps = 47/362 (12%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           V  YD+  +RG ++  +  + +L CVPLRDA   LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
               D T+  L+++ +  Q+                                        
Sbjct: 132 SK--DDTMGVLLSHLQTAQS---------------------------------------- 149

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                 +N  K F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 150 -----QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 204

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE CP ++++DLM    DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 205 PYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 264

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA +LDED VIVEGY EY TWR HLAY RD NGDP E + LDG+GGVSIL++A++FR
Sbjct: 265 GLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 324

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKR 507
            G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DLK +     E++
Sbjct: 325 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEK 384

Query: 508 RE 509
           R+
Sbjct: 385 RK 386

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  376 bits (966), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 181/353 (51%), Positives = 231/353 (65%), Gaps = 47/353 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + +L CVPLRDA   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S+                  T+  + ++++M++ ++ K                     
Sbjct: 122 SSDN-----------------TMGVLLSKLQMAQSQQDK--------------------- 143

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                     K F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 144 ---------TKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA  LDED VIVEGY EY TWR HLAY RD NG+P + + LDG+GGVSILA+A++FR
Sbjct: 255 GLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
            G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDLK + 
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  376 bits (965), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 230/353 (65%), Gaps = 47/353 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + +L CVPLRDA   LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D+T+  L++                             NL+     QD  +R    
Sbjct: 122 SS--DNTMGVLLS-----------------------------NLHKAQSQQDKSKR---- 146

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                       F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 147 ------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA  L+ED VIVEGY EY TWR HLAY RD NG+P + + LDG+GGVSILA+A++FR
Sbjct: 255 GLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
            G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDLK + 
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  376 bits (966), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 186/353 (52%), Positives = 228/353 (64%), Gaps = 47/353 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + +L CVPLRDA   LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L++    LQN    Q                                   
Sbjct: 147 SS--DDTMGVLLS---NLQNAQSQQ----------------------------------- 166

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                  +  K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMARARNWL + A+K
Sbjct: 167 -------DKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 219

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 220 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 279

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA TL EDDVIVEGY EY TWR HLAY RD NG+P + + LDG+GGVSILA+A++FR
Sbjct: 280 GLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 339

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
            G HFPAF+FE HAETEAFGK+++KM + V GLPHY +WHIYEPS +DLK + 
Sbjct: 340 TGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  374 bits (961), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 237/362 (65%), Gaps = 47/362 (12%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + VL  VPLRDA   LP+ F H+  I+YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L+ + ++ Q+ T             +RKK                     
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------DRKK--------------------- 136

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                       F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 137 -----------RFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 186 PYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            + LA++LDED VIVEGY EY TWR HLAY RD +G+P + + LDG+GGVSIL++A++FR
Sbjct: 246 GMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFR 305

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKR 507
            G HFPAF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDLK +     E++
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 508 RE 509
           R+
Sbjct: 366 RK 367

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 242/383 (63%), Gaps = 51/383 (13%)

Query: 131 EETTKFEQEVSMLLD-STVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHL 189
           +E T+ E  +    D  +VE YDM  ++G  +       +L+CVPL+DA N LPL FK L
Sbjct: 37  DEFTRNEHRIPDFQDIPSVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTL 96

Query: 190 MNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGE 249
             +TYPHELIDL+FLVSD S  D+T+  L+   ++LQ                    GG 
Sbjct: 97  EKMTYPHELIDLSFLVSDSS--DNTMYNLLNMLKRLQ------------------IDGGT 136

Query: 250 NLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGL 309
           +                             F +++I++KDFGQ IGQGFSDRH    QG 
Sbjct: 137 S---------------------------GKFGNIEIYEKDFGQVIGQGFSDRHGFAAQGP 169

Query: 310 RRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPV 369
           RRKLM +ARNWL   A+KPYHSWVYWRD DVE+ P ++++DLM  D DV+VPNVWRPLP 
Sbjct: 170 RRKLMGKARNWLNTVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPD 229

Query: 370 FLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVV 429
           +L   QPYDLNSW ES   L L+ +L ED VIVEGY EY TWR HLAY RD NGDP   +
Sbjct: 230 WLGNIQPYDLNSWKESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREM 289

Query: 430 NLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIY 489
            LDGVGGVSIL++A +FR G HFPAF+F+ HAETEAFGK++K M F V GLP+Y +WHIY
Sbjct: 290 ELDGVGGVSILSKANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIY 349

Query: 490 EPSDDDLK---EIGNKEREKRRE 509
           EPS +DL+   ++  KER KR +
Sbjct: 350 EPSKEDLQYMAKLEEKERLKRND 372

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  374 bits (961), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 179/353 (50%), Positives = 229/353 (64%), Gaps = 47/353 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + +L CVPLRDA   LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S+                  T+  + + ++ ++ ++ K                     
Sbjct: 122 SSDN-----------------TMGVLLSSLQTAQSQQDKS-------------------- 144

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                     K F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DV+  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA  LDED VIVEGY EY TWR HLAY RD NG+P + + LDG+GGVSILA+A++FR
Sbjct: 255 GLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
            G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDLK + 
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/364 (51%), Positives = 233/364 (64%), Gaps = 52/364 (14%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  N  +  + V+ CVPLRDA   L + F  L  +TYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L+++ R+ Q+                                        
Sbjct: 117 SS--DDTMKTLLSHLRRAQS---------------------------------------- 134

Query: 268 FSPPFHENYDKS--FRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANA 325
                  N DKS  F +++IF+KDFGQ +GQ FSDRH    QG RRK MARARNWL + A
Sbjct: 135 -------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAA 187

Query: 326 LKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIES 385
           LKPYHS+VYWRD DV+  P ++++DLM  D DV+VPNVWRPLP +L   QPYDLNSW+ES
Sbjct: 188 LKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVES 247

Query: 386 REALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARL 445
              L LA +LDED  IVEGY EY TWR HLAY RD +GDP   + LDG+GGVSIL++A++
Sbjct: 248 EGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKV 307

Query: 446 FRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG-NKER 504
           FR G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS DDLK +    E 
Sbjct: 308 FRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEE 367

Query: 505 EKRR 508
           EKRR
Sbjct: 368 EKRR 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  372 bits (956), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 227/353 (64%), Gaps = 47/353 (13%)

Query: 147 TVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVS 206
            VE YD+  ++G  +  +  + ++ CVPLRDA   LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 207 DCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKD 266
           D S+                  T+  + + ++ ++ +R K                    
Sbjct: 124 DSSDD-----------------TMGVLLSNLQTAQSQRDKS------------------- 147

Query: 267 SFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANAL 326
                      K F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL + AL
Sbjct: 148 -----------KRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 327 KPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESR 386
           KPYHSWVYWRD D+E  P ++++DLM  D D++VPNVWRPLP +L   QPYDLNSW ES 
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 387 EALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLF 446
             L LA  L+ED VIVEGY EY TWR HLAY RD NGDP   + LDG+GGVSIL++A +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 447 RLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEI 499
           R G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DLK +
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  373 bits (958), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/353 (49%), Positives = 230/353 (65%), Gaps = 47/353 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +  + +L C+PLRDA   LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L+++ + +Q+                                        
Sbjct: 126 SS--DDTMGVLLSHLQTVQS---------------------------------------- 143

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                 ++  K F +++I++KDFGQ IGQ FSDRH    QG RRKLMA+ARNWL + ALK
Sbjct: 144 -----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALK 198

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD D+E  P ++++DLM  D D++VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 199 PYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 258

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
            L LA  LDE+ VIVEGY EY TWR HLAY RD NGDP + + LDG+GGVSIL++A++FR
Sbjct: 259 GLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFR 318

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
            G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DLK + 
Sbjct: 319 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  367 bits (942), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 183/362 (50%), Positives = 233/362 (64%), Gaps = 48/362 (13%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           VE YD+  ++G  +  +    +L  VPLRDA   LP  F H+  ++YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            S  D T+  L+ +              ++  S+K+R                       
Sbjct: 117 SS--DDTMGELLHH-------------LQIAQSQKDR----------------------- 138

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                    +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMARARNWL +  LK
Sbjct: 139 ---------NKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLK 189

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PYHSWVYWRD DVE+ P S+++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 190 PYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 249

Query: 388 ALDLAKTL-DEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLF 446
            + LA TL DED VIVEGY E+ TWR HLAY RD NG+P + + LDG+GGVSILA+A++F
Sbjct: 250 GIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 309

Query: 447 RLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREK 506
           R G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DLK +     E+
Sbjct: 310 RTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 369

Query: 507 RR 508
           +R
Sbjct: 370 KR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  361 bits (926), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 228/355 (64%), Gaps = 48/355 (13%)

Query: 147 TVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVS 206
            VE YD+  ++G  +  +    +L  VPLRDA   LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 207 DCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKD 266
           D S  D T+ AL+++  + Q+             +K R+                     
Sbjct: 122 DSS--DDTMGALLSHLEKAQSN-----------KDKTRR--------------------- 147

Query: 267 SFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANAL 326
                        F +++I++KDFGQ IGQ FSDRH    QG RRKLMARARNWL   AL
Sbjct: 148 -------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVAL 194

Query: 327 KPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESR 386
           K YHSWVYWRD DVELCP S+++DLM  D DV+VPNVWRPLP +L   QPYDLNSW ES 
Sbjct: 195 KAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 254

Query: 387 EALDLAKTLDEDD-VIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARL 445
             + LA +L +DD VIVEGY +Y TWR HLAY RD NG+P + + LDG+GGVSIL++ ++
Sbjct: 255 VGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKV 314

Query: 446 FRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500
           FR G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL+ + 
Sbjct: 315 FRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  205 bits (521), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 187/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ + + T+NA  N+E VL+  P++         + +L+++TYP  LI+L
Sbjct: 90  LIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F++   + GD  L  L +  R++Q G   + FA++ +                     L
Sbjct: 147 GFIIPRTASGDAALQKLESAVREVQTGKQDKRFAKITI---------------------L 185

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
           ++   SF                      G+K      DRHA++VQ  RR  MA ARN L
Sbjct: 186 RQASQSFD-------------------RLGEK------DRHALEVQKERRAAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SW+ W DAD+   P +VIQDL + +  V+  NV++    F D  Q      
Sbjct: 221 LFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQK---FYDKDQKKESIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L LA+ L ++++IVEGY+E  T+R  +A+F DANG  N ++ LDGVG
Sbjct: 278 PYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  F  F F +  ETEAF KMAK++G+ V GLP+Y ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  197 bits (500), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 187/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T +A + +EHVL+  P++   +     + +L+ ++YP  L++L
Sbjct: 90  IIPEGHIAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F++     GD TL  L A  + +Q G +   FA++ +                + QD  
Sbjct: 147 GFIIPRTPTGDETLKKLEAAVKNVQTGKVEDRFAKITI----------------LRQD-- 188

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                       +++DK            G+K      +RH++ VQ  RR  MA ARN L
Sbjct: 189 -----------SQSFDK-----------LGEK------ERHSLAVQKERRSAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             +++ P  SWV W DAD+   P +VIQD+   +  V+  NV++    F D ++      
Sbjct: 221 LFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQR---FFDKEKNENSIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES + L++AK ++ED++IVEGYAE  T+R  +A+F D  G  + ++ LDGVG
Sbjct: 278 PYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + + GLP+Y ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  194 bits (493), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 121/355 (34%), Positives = 183/355 (51%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ ++ +  YD+ +   T  AA N+E VL+  P++         + +++++TYP ELI+L
Sbjct: 91  IIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIEL 147

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+      GD  L  L A  +++Q+G  ++ FA++ +  +E                  
Sbjct: 148 GFIAPRTPTGDAALKKLEAAIKKIQSGKKNERFAKIIILRQE------------------ 189

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                           +SF  +                DRHA+ VQ  RR  MA ARN L
Sbjct: 190 ---------------SQSFDML-------------AEKDRHALAVQKQRRSAMALARNEL 221

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQ------Q 375
             + L P+ SWV W DAD+   P +VIQDL A D  V+  NV++    F + +      +
Sbjct: 222 LFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIR 278

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L+LA +L  D++IVEGYAE  T+R  +A+F D +   +E + LDGVG
Sbjct: 279 PYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVG 338

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 339 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  193 bits (490), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 184/355 (51%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ ++ +  YD+ +   T  AA N+EHVL+  P++         + +L+ +TYP E  +L
Sbjct: 91  IIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YWDNLLQLTYPREFTEL 147

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F++   S GD  L  L A  +++Q    +Q F+++ +  +                   
Sbjct: 148 GFILPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKITILRQNSA---------------- 191

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                         +DK      + +K+           RHA++VQ  RR  MA ARN L
Sbjct: 192 -------------GFDK------LMEKE-----------RHALEVQKERRSAMASARNEL 221

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQ------Q 375
             ++L P  SWV W DAD+   P ++IQD+ + +  V+  NV++    + D Q      +
Sbjct: 222 LFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQK---YYDDQAKKVQIR 278

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES  AL+LAK + +D+++VEGY +  T+R  +AYF DA G  N  +NLDGVG
Sbjct: 279 PYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVG 338

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 339 GGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  191 bits (486), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 186/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  + ++D+ +   T +A+ N+E VL+  PL+         +++++ ++YP ELI+L
Sbjct: 91  IISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIEL 147

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+V     GD  L +L     + Q    +Q FA+V +                     L
Sbjct: 148 GFIVPRTQTGDLALQSLEKAVEKTQTDKKNQRFAKVTI---------------------L 186

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
           ++  +SF+                       K+ +   +RHA+ VQ  RR  MA ARN L
Sbjct: 187 RQDSESFN-----------------------KLAE--KERHALNVQKERRSSMALARNEL 221

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P ++IQD+ A D  V+  NV++    + D ++      
Sbjct: 222 LFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQR---YYDDEKKASATR 278

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L+LA  +++D++IVEGY+E  T+R  +AYF D     +E + LDGVG
Sbjct: 279 PYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVG 338

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP+F F +  ETE F KMAK++G+ + GLP+Y ++HI E
Sbjct: 339 GGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  191 bits (484), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 117/357 (32%), Positives = 184/357 (51%), Gaps = 68/357 (19%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           V KYD+ +   T++AA N+E VL+  P++         + +L+ +TYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            + GD                 L Q+ A V+ ++ ++K                      
Sbjct: 151 SASGD---------------AALKQLEAAVKRAQTDKK---------------------- 173

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGF-----SDRHAVKVQGLRRKLMARARNWLT 322
                    +  F  V I ++D      +GF      +RHA+ VQ  RR  MA ARN L 
Sbjct: 174 ---------NNRFGKVTILRQD-----SKGFDKLQEKERHALAVQKERRSAMALARNELL 219

Query: 323 ANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------P 376
            + + P+ SWV W DAD+     S+IQD+ A +  V+  NV++    + D  +      P
Sbjct: 220 FSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQ---RYFDEAENKPSIRP 276

Query: 377 YDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGG 436
           YD N+W +S+ A +L   + +D++IVEGYAE  T+R  +A+F   +G PNE+++LDGVGG
Sbjct: 277 YDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGG 336

Query: 437 VSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 493
              L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 337 GCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  191 bits (484), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 183/355 (51%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T+ AA N+EH+L+  P++         + +L+ + YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+    + GD  L  L    +++Q    +Q F+++ +                     L
Sbjct: 147 GFITPRTATGDLALKKLENAIKKVQTDKKTQRFSKITI---------------------L 185

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
           ++   SF               ++ +K+           RHA+ VQ  RR  MA ARN L
Sbjct: 186 RQNSQSFD--------------KLMEKE-----------RHALDVQKERRAAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P S+IQD+   +  ++  N+++    F D ++      
Sbjct: 221 LFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L++A  + +D++IVEGYAE  T+R  +A+F DANG P E + LDGVG
Sbjct: 278 PYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  191 bits (484), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 185/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T++AA N+E +L+  P++         +++L+ +TYP ELI+L
Sbjct: 88  IIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIEL 144

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+      GD  L AL A   ++Q+   +Q F++V +                + QD  
Sbjct: 145 GFIAPRTPTGDQALAALEAAVDKVQSDKKNQRFSKVTI----------------LRQD-- 186

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                  S  F++  +K                     +RHA++VQ  RR  MA ARN L
Sbjct: 187 -------SVGFNKLTEK---------------------ERHALEVQKERRASMALARNEL 218

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P S+IQD+ A D  V+  NV++    + D ++      
Sbjct: 219 LFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQR---YYDEEKKQKAIR 275

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L+LA  + +D++IVEGYAE  T+R  +AYF D +    E + LDGVG
Sbjct: 276 PYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVG 335

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 336 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  190 bits (483), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 121/358 (33%), Positives = 180/358 (50%), Gaps = 58/358 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T  AA N+E VL+  P++         + +L+ +TYP ELI+L
Sbjct: 91  IIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIEL 147

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+V     GD  L  L    +++Q    +Q F +V +                + QD  
Sbjct: 148 GFIVPRTQSGDVALAKLEEAVKKVQTDKKNQRFVKVTI----------------LRQD-- 189

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                           KSF  +Q               +RHA+ VQ  RR  MA ARN L
Sbjct: 190 ---------------SKSFDKLQE-------------KERHALAVQKERRAAMALARNEL 221

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P ++IQD+ A +  V+  NV++    + D ++      
Sbjct: 222 LFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQR---YYDEEKKESSIR 278

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
            YD N+W ES   L+LA  + ED++IVEGY+E  T+R  +AY+ DANG P   + LDGVG
Sbjct: 279 AYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVG 338

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 493
           G   L +A + R G  FP F F +  ETE F KMAK++   V GLP+Y ++HI E +D
Sbjct: 339 GGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  190 bits (482), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 183/349 (52%), Gaps = 58/349 (16%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           +  YD+ +   T  A  N+E VL+  P++   +     + +L+ +TYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            + GD  L  L A  ++ Q G   Q F+++ +                + QD        
Sbjct: 153 TATGDTALRKLEAAVKRTQLGKKDQRFSKITI----------------LRQD-------- 188

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                     +SF S+Q               +RHA+KVQ  RR  MA ARN L  + + 
Sbjct: 189 ---------SQSFDSLQE-------------KERHALKVQKERRAAMALARNELLFSTIG 226

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLD------GQQPYDLNS 381
           P+ SW+ W DAD+   P S+IQD+ A +  V+  NV++    +++       ++PYD N+
Sbjct: 227 PHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQK---YMNEETKKIAERPYDFNN 283

Query: 382 WIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILA 441
           W +S +AL +A  + +D+V+ EGYAE PT+R  +A+  DA+G     ++LDGVGG   L 
Sbjct: 284 WADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGCTLV 343

Query: 442 RARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           +A + R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  189 bits (481), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 116/355 (32%), Positives = 186/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ + R T  AA N+E VL+  P++         +++L+ +TYP ELI+L
Sbjct: 93  IIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIEL 149

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F++     G++ L  L    +++Q+   +Q FA++ +                     L
Sbjct: 150 GFIIPRTKTGENALKELEIAIKKVQSDKKNQRFAKITI---------------------L 188

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
           ++   SF               Q+ +KD           RH++ VQ  RR  MA ARN L
Sbjct: 189 RQDSQSFD--------------QLAEKD-----------RHSILVQKERRAAMALARNEL 223

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + L P+ +WV W DAD+   P +VIQD+ + D  V+  NV++    + D  +      
Sbjct: 224 LFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQK---YFDNDEKKMAIR 280

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L++A  +DE+++IVEGY+E  T+R  +A+F +A+G   + + LDGVG
Sbjct: 281 PYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVG 340

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 341 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  189 bits (480), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 185/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ ++ +  YD+ +   T++AA N+E VL+  P++   +     +++L+ +TYP ELI+L
Sbjct: 88  IIPENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIEL 144

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F++     GD  L AL A  +++Q    +Q F+++ +                + QD  
Sbjct: 145 GFILPRSDSGDAALKALEAAVKKVQTDKKNQRFSKITI----------------LRQD-- 186

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                                     + FGQ + +   +RHA+ VQ  RR  MA ARN L
Sbjct: 187 -------------------------SQGFGQLMEK---ERHALHVQKERRAAMALARNEL 218

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P +VIQD+ A D  V+  NV++    + D ++      
Sbjct: 219 LFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQR---YFDEEKKEKSIR 275

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
            YD N+W ES   L +A  +++D++IVEGY+E  T+R  +A+F D     N  + LDGVG
Sbjct: 276 AYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVG 335

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++H+ E
Sbjct: 336 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (480), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 185/355 (52%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T++AA N+EHVL+  P++         + +L+ ++YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+    + GD  L  L    +++Q    +Q F+++ +                     L
Sbjct: 147 GFITPRTATGDLALKNLENAIKKVQTDKKTQRFSKITI---------------------L 185

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
           ++   SF               ++ +K+           RHA+ VQ  RR  MA ARN L
Sbjct: 186 RQNSQSFD--------------KLMEKE-----------RHALDVQKERRAAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SW+ W DAD+   P S+IQD+   D  V+  N+++    F D ++      
Sbjct: 221 LFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQR---FYDQEKKQPSIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L++A  + +D++IVEGYAE  T+R  +A+  +A+G PNE + LDGVG
Sbjct: 278 PYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 338 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (479), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 183/355 (51%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T +AA N+EHVL+  P++         + +L+ +TYP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQ---YWDNLLQLTYPRELIEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+    + GD  L  L    +++Q    +Q F+++ +                M Q+  
Sbjct: 147 GFITPRTATGDLALKKLENAVKKVQADKKAQRFSKITI----------------MRQN-- 188

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                       +++DK                     +RHA+ VQ  RR  MA ARN L
Sbjct: 189 -----------SQSFDKLMEK-----------------ERHALDVQKERRAAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P ++IQD+   +  V+  N+++    F D ++      
Sbjct: 221 LFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQR---FYDQEKKQSSIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L++A  +D+D++IVEGYAE  T+R  +A+F  AN  P++ + LDGVG
Sbjct: 278 PYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  188 bits (478), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/355 (31%), Positives = 181/355 (50%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T +AA N+EH+L+  P++         + +L+ + YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F+    + GD  L  L +  +++Q    +Q F+++ +  +                   
Sbjct: 147 GFITPRTATGDSALKKLESAIKKVQTDKKTQRFSKITILRQNS----------------- 189

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                       +++DK                     +RHA++VQ  RR  MA ARN L
Sbjct: 190 ------------QSFDKLMEK-----------------ERHALEVQKERRAAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + + P+ SWV W DAD+   P S+IQD+   +  V+  N+++    F D ++      
Sbjct: 221 LFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQR---FYDQEKKQASIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   LD+A  + +D++IVEGYAE  T+R  +A+F DA+   NE + LDGVG
Sbjct: 278 PYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  187 bits (476), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 177/349 (50%), Gaps = 58/349 (16%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           +  YD+ +   T NAA N+E VL+  P+   +N     + +L+ +TYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPM---QNFHQKYWDNLLQLTYPRELIELGFIVPR 151

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
              G+  L+ L A  +++Q G     F ++ +                     L++   S
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKITI---------------------LRQASQS 190

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
           F               ++ +K+           RHA++VQ  RR  MA ARN L  + + 
Sbjct: 191 FD--------------KLLEKE-----------RHALEVQKERRAAMALARNELLFSTIG 225

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------PYDLNS 381
           PY SW+ W DAD+   P SVI+D+ A +  V+  NV++    + D +Q      PYD N+
Sbjct: 226 PYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQR---YYDQEQKKESIRPYDYNN 282

Query: 382 WIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILA 441
           W ES   L LA  +  D+++VEGY E  T+R  +A+F + +      + LDGVGG   L 
Sbjct: 283 WAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGCTLV 342

Query: 442 RARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           +A + R G  FP F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 343 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  186 bits (473), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 176/351 (50%), Gaps = 62/351 (17%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           +  YD+ +   T NAA N+E VL+  P++         + +L+ +TYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
            + GD+ L  L A  ++ Q            +S+K                         
Sbjct: 212 TTSGDNALRKLEAAVKKTQ------------LSKK------------------------- 234

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGF-----SDRHAVKVQGLRRKLMARARNWLT 322
                    D+ F  + I ++D      Q F      DRHA++VQ  RR  MA ARN L 
Sbjct: 235 ---------DQRFLKITILRQD-----SQSFDLLKEKDRHALEVQKKRRSAMALARNELL 280

Query: 323 ANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ---PYDL 379
            + + PY SWV W DAD+   P ++IQD+ A D  V+  NV++       GQ+   PYD 
Sbjct: 281 FSTIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDF 340

Query: 380 NSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSI 439
           N+W +S  AL +A ++ +D V+ EGY E  T+R  +A+F      P+  + LDGVGG   
Sbjct: 341 NNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCT 400

Query: 440 LARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           L +A + R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 401 LVKAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  180 bits (456), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 180/355 (50%), Gaps = 58/355 (16%)

Query: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201
           ++ +  +  YD+ +   T+++  ++EHVL+  P++         +++L+ ++YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIEL 146

Query: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261
            F++     GD  L  L    + +Q+   +  F+++ +  +E                  
Sbjct: 147 GFIIPRSDAGDAALKKLETAVKNVQSDKKNNRFSKITILRQES----------------- 189

Query: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321
                       +++DK             +K      +RH++ VQ  RR  MA ARN L
Sbjct: 190 ------------QSFDK-----------LEEK------ERHSLAVQKERRAAMALARNEL 220

Query: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQ------ 375
             + L P+ SWV W D+D+   P +VI+ +   D  V+  NV++    F D  +      
Sbjct: 221 LFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQR---FFDNDKQQDSIR 277

Query: 376 PYDLNSWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVG 435
           PYD N+W ES   L LA  + +D++IVEGYAE  T+R  +A+F + +GD  E + LDGVG
Sbjct: 278 PYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVG 337

Query: 436 GVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           G   L +A + R G  FP F F +  ETE F KMAK++ + V GLP++ ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  178 bits (452), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 178/348 (51%), Gaps = 57/348 (16%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           + KYDM     T++   N+E VL+  P++   +     +++L+++TYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
              GD  +  L    +++Q+G  +Q F ++ +                     L++   S
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKENQRFLKITI---------------------LRQDSQS 190

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
           F+                       K+ +   +RHA  VQ  RR  MA ARN L  + + 
Sbjct: 191 FN-----------------------KLDE--KERHAFNVQKERRAAMALARNELVFSTIG 225

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQ-----QPYDLNSW 382
           P  SW+ W DAD+   P +VIQD+ A D  ++  NV++    ++D Q     +PYD N+W
Sbjct: 226 PSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQR---YIDDQNQENIRPYDFNNW 282

Query: 383 IESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILAR 442
            ES+  L++A ++ +D++IVE Y E  T+R  +A   D NG P+  ++LDGVGG   L +
Sbjct: 283 QESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVK 342

Query: 443 ARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
           A++ R G  FP F F +  ETE F  MAK++ + V GLP+Y ++H  E
Sbjct: 343 AQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  177 bits (449), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 105/343 (30%), Positives = 175/343 (51%), Gaps = 51/343 (14%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           +  YD+ + + + NAAEN+EHVL+  PL+  E      + +L+ ++YP + I+L F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPR 159

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
             +GDH+L  L +  +++Q       F+++ +  ++  KG E +     ++  +  ++  
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSKITIL-RQNSKGFETV----PEKKEVSEIE-- 212

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                   Y+K  R+                               MA ARN L A+ L 
Sbjct: 213 --------YEKQIRAE------------------------------MALARNELLASTLG 234

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQ---QPYDLNSWIE 384
           P  +W+ W D+D+   P S+IQD+   D  V+  NV+        G+   +PYD  +WIE
Sbjct: 235 PQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRNWIE 294

Query: 385 SREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARAR 444
           S EAL LA  + ED++IVEG A   T R  + +F   +G P+  ++LDGVG   +L ++ 
Sbjct: 295 STEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLVKSE 354

Query: 445 LFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 487
           + R G  FP F F +  E+E F KMAK++ + V GLP+Y ++H
Sbjct: 355 VHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  169 bits (428), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 107/348 (30%), Positives = 165/348 (47%), Gaps = 57/348 (16%)

Query: 145 DSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFL 204
           D  + +YD+   + T  AA N E VL+  P++         + +L+ +TYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 205 VSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRV 264
           +   S G+  L  L    R++Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTGP----------------------------------- 172

Query: 265 KDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTAN 324
                       D+ F  + I ++DF        S RH   VQ  RR  MA ARN L  +
Sbjct: 173 -----------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 325 ALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQP----YDLN 380
            + PY SWV W D+D+   P ++I+D+ + +  ++  NV++    +++  +P    YDLN
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLN 278

Query: 381 SWIESREALDLAKTLDEDDVIVEGYA-EYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSI 439
           +W ES   L +A  L ED +IVEGY  E+ T+R  +A+        +E++ LDGVGG   
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 440 LARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 487
           L +A + R G  FP F F +  ETE F KMAK++ + + GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  167 bits (422), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 107/341 (31%), Positives = 175/341 (51%), Gaps = 44/341 (12%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           +  YD+ +   + NA EN+EHVL+  PL+  +      +++L+N++YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
             +GD  L       +QL+N         V+  +   KK G N + +      + R KDS
Sbjct: 159 TKKGDQIL-------KQLENA--------VKNVQGIDKKLGSNKFAKIT----ILRQKDS 199

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
               F++  DK                     + + ++++  +R  MA ARN L ++ L 
Sbjct: 200 GFHKFNDRKDKK--------------------EMNDIELEKEKRAEMALARNELLSSTLS 239

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQ--QPYDLNSWIES 385
              +W+ W D++V   P ++IQD+   D  V+  NV+       D    +PYD  +WIES
Sbjct: 240 HSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNWIES 299

Query: 386 REALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARL 445
             AL LA  + ED++IVEG A   T R  +  F +++G P E + LDG+G    L ++ +
Sbjct: 300 DTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKSEV 359

Query: 446 FRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLW 486
            R G  FP F F +  E+E F KMAK++ + V GLP+Y ++
Sbjct: 360 HRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 138/338 (40%), Gaps = 62/338 (18%)

Query: 148 VEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSD 207
           +  Y++ +   + +A  + EH+L+ +PL    N     F++L  +TYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLI---NFNSRFFENLFALTYPKQLIDLGVIVPD 135

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
                  L A            L +  A+V+ ++  R                       
Sbjct: 136 SKNATGILQA------------LQETLAKVQANDSTR----------------------- 160

Query: 268 FSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALK 327
                       +  + + + D   K G    D  A       RK +A  +N L  + L 
Sbjct: 161 ------------YNKITVLKDD--NKWGNT-DDPVA------YRKQLAALKNQLLFSTLP 199

Query: 328 PYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESRE 387
           PY SWV W D+ +   P +++QDL      ++  +++       D +    LN+W+ S  
Sbjct: 200 PYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSDGSPDSET---LNNWVASDT 256

Query: 388 ALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFR 447
              LA  +    V++EG +   T R  +  F DA       + LD V     L +A + R
Sbjct: 257 WRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEMELDSVSTACTLVKAEVHR 316

Query: 448 LGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTL 485
            G  FP F F +  ETE F +MA+ +  +  GLP+Y +
Sbjct: 317 DGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 88/209 (42%), Gaps = 33/209 (15%)

Query: 300 DRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVM 359
           DRH   VQ  RRK +A+ RN+L  N       +    D+D+ + P  +++  +    +++
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 360 VPNVWRPLPVFLDGQQPYDLNSWIESR-EALDLAKTLDEDDVIVEGYAEYPTWRGHLAYF 418
           VP + R     +   + YD N+WI  R +  D +K  +      E Y   P   G   + 
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNN-----YESYVPRPV-NGKTKFL 475

Query: 419 RDANGD----------PNEVVNLDGVGGVSILARARLFRLGIHFPAFTF----------E 458
           +D   +           + VV LD VGG  +    ++F  GI FP F             
Sbjct: 476 QDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGY 535

Query: 459 NHAETEAFGKMAKKMGFRVGGLPHYTLWH 487
           +  ETE     AK +G++  G+P+    H
Sbjct: 536 DGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 428 VVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 487
           V+NL+G G   I  +A LFR      A  ++N  ++  FG    + GF  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 488 IYE 490
           IYE
Sbjct: 272 IYE 274

>Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRV 264
           C+ G H    LI   R+LQN +L+ +F E       + +  +  +++  D D ++R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.296
           YNL032W
          Length = 264

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRV--K 265
           C+ G H    LI   R+LQN +L+ +F E       + +  +  +++  D  Y++ V  K
Sbjct: 197 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFSFPKARALDQQFIELYDDKYIKEVATK 256

Query: 266 DSFSP 270
           +S+ P
Sbjct: 257 NSWLP 261

>KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 303

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 30/57 (52%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRV 264
           C+ G H    L+   R+LQN +L+ +F E       + +  +  +++  D+D ++R+
Sbjct: 236 CNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDEDKIKRI 292

>Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRV 264
           C+ G H    LI   R+LQN +L+ +F E       + +  +  +++  D D ++R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON}
           (106636..107478) [843 nt, 281 aa]
          Length = 280

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 30/59 (50%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKD 266
           C+ G H    LI   R+LQN +L+ +F E       + +  +  +++  D  Y+++V +
Sbjct: 213 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIELYDDIYIKKVAE 271

>YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyrosine
           phosphatase that plays a role in actin filament
           organization and endocytosis; localized to the cytoplasm
          Length = 281

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRV 264
           C+ G H    LI   R+LQN +L+ +F E       + +  +  +++  D D ++R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>Skud_38.1 Chr38 (502..1347) [846 bp, 281 aa] {ON} YNL032W (REAL)
          Length = 281

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/83 (20%), Positives = 38/83 (45%), Gaps = 10/83 (12%)

Query: 192 ITYPHELIDLAF----------LVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSE 241
           +  P +L+ +A           ++  C+ G H    L+   R+LQN +L+ +F E     
Sbjct: 188 VNIPSDLLTMALQIVLNPANQPILIHCNRGKHRTGCLMGCIRKLQNWSLTMIFDEYRRFA 247

Query: 242 KERKKGGENLYLQYMDQDYLQRV 264
             + +  +  +++  D D ++R+
Sbjct: 248 FPKARALDQQFIEMYDDDEIKRI 270

>TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {ON}
           Anc_2.503 YKL007W
          Length = 274

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%), Gaps = 2/48 (4%)

Query: 275 NYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKL-MARAR-NW 320
           N  +  ++++ F+ DF +++   F+D +  K + LRR+L ++RAR NW
Sbjct: 210 NLSEILKTIKSFESDFEKQLDVSFNDLNEKKFKTLRRRLPVSRARVNW 257

>KLTH0H01034g Chr8 complement(107338..108687) [1350 bp, 449 aa] {ON}
           similar to uniprot|P14743 Saccharomyces cerevisiae
           YLR195C NMT1 N-myristoyl transferase catalyzes the
           cotranslational covalent attachment of myristic acid to
           the N-terminal glycine residue of several proteins
           involved in cellular growth and signal transduction
          Length = 449

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 13/131 (9%)

Query: 104 DPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDME-QFRGTTNA 162
           DPD  KK    +    ++Q     +T  +  +FE E        V ++D E +  G  N+
Sbjct: 4   DPDQAKKLQELLKMLSLSQNDASKLTQPQRKQFE-EYKFWKTQPVPRFDDEVEDEGPINS 62

Query: 163 AENQEHVLLCVPLRDAENVLPLMFKH---LMNITYPHELIDLAFLVSDCSEGDHTLDALI 219
           ++  E++            LPL+ +     ++IT PH+L D+  L+++    D       
Sbjct: 63  SQRPENI--------PNEPLPLLSEFEWCTVDITDPHQLEDVFVLLNENYVEDQDATFRF 114

Query: 220 AYSRQLQNGTL 230
            YSR+  N +L
Sbjct: 115 NYSREFFNWSL 125

>NCAS0G03690 Chr7 (684097..685146) [1050 bp, 349 aa] {ON} Anc_2.296
          Length = 349

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 30/60 (50%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDS 267
           C+ G H    LI   R+LQN +L+ +F E       + +  +  +++  D + ++R+  S
Sbjct: 282 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDEGIKRIAKS 341

>Ecym_2675 Chr2 complement(1304086..1307046) [2961 bp, 986 aa] {ON}
           similar to Ashbya gossypii AGL209W
          Length = 986

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 36/88 (40%), Gaps = 14/88 (15%)

Query: 403 EGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAE 462
           E + E+P W   L Y          VVNL+G G      +A LFR      A  + +   
Sbjct: 229 EAFFEHP-WSKELLY----------VVNLEGTGAG---GKAVLFRTSDVSTASVYADAVR 274

Query: 463 TEAFGKMAKKMGFRVGGLPHYTLWHIYE 490
            + FG    + GF  G +   T + +YE
Sbjct: 275 QQPFGNSIYQQGFYTGNIGSETDFKVYE 302

>NDAI0G00770 Chr7 complement(162781..163800) [1020 bp, 339 aa] {ON}
           Anc_2.296
          Length = 339

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/59 (22%), Positives = 29/59 (49%)

Query: 208 CSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKD 266
           C+ G H    L+   R+LQN +L+ +F E       + +  +  +++  D   ++R+ +
Sbjct: 272 CNRGKHRTGCLVGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDKEIKRIAN 330

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,558,251
Number of extensions: 2480062
Number of successful extensions: 6910
Number of sequences better than 10.0: 86
Number of HSP's gapped: 7041
Number of HSP's successfully gapped: 129
Length of query: 509
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 395
Effective length of database: 40,409,475
Effective search space: 15961742625
Effective search space used: 15961742625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)