Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005508.843ON53753725410.0
YML116W (ATR1)8.843ON54253214680.0
Kpol_541.168.843ON52849714660.0
NDAI0E002808.843ON54949414570.0
NCAS0A02540singletonON53948414540.0
Skud_13.258.843ON53752714380.0
Suva_13.278.843ON55349914370.0
Kwal_27.102458.843ON51548214260.0
NDAI0K004008.843ON55349414280.0
Smik_13.188.843ON54551614190.0
SAKL0D01386g8.843ON52151514090.0
NCAS0B002908.843ON54250214090.0
NCAS0C004008.843ON51748214050.0
KAFR0B03930singletonON55546413900.0
KLTH0C03806g8.843ON52550413830.0
KNAG0J002608.843ON55049313850.0
KNAG0G034308.843ON54250913820.0
Suva_13.4678.843ON54351813800.0
CAGL0B02343g8.843ON53750513730.0
YMR279C8.843ON54052513630.0
TBLA0D032708.843ON55048813620.0
Skud_13.4518.843ON53951613580.0
CAGL0M03003g8.843ON55852213430.0
TPHA0C047908.843ON55644813381e-180
Smik_13.4928.843ON54351213281e-179
KAFR0B039408.843ON54752913021e-175
TBLA0D03280singletonON58049212831e-171
KAFR0A028408.843ON52051712721e-170
TBLA0C01160singletonON60047410961e-143
Smik_15.560na 1ON5165258561e-108
YOR378Wna 1ON5154948461e-106
Skud_15.545na 1ON5164728411e-106
Suva_8.435na 1ON5155188211e-103
KLLA0B00352gna 1ON4984338121e-102
KLTH0C10560gna 1ON5154877991e-99
Kwal_23.6547na 1ON5114457842e-97
TDEL0G04950singletonON5124917441e-91
KNAG0D00130na 1ON5654765072e-56
KAFR0C04860na 1ON5345014738e-52
CAGL0L02519gna 1ON5293704299e-46
NCAS0A05720na 1ON5635293932e-40
SAKL0C06116gsingletonON1851903576e-39
NDAI0K02730singletonON6044533572e-35
SAKL0E08756g2.242ON5652451207e-06
AGR076C8.272ON6863921162e-05
SAKL0F00440gsingletonON5445511109e-05
NCAS0G029902.242ON5812341101e-04
NDAI0D010202.242ON5921951063e-04
YNL065W (AQR1)2.242ON5862451045e-04
Skud_14.2672.242ON5622581045e-04
KLLA0F03311g2.242ON5422891020.001
Suva_10.11singletonON5404791020.001
Kpol_543.448.272ON6434231020.001
Smik_14.2622.242ON5612421000.001
SAKL0C02178gsingletonON5651631000.002
TBLA0B044808.570ON6082641000.002
KLLA0C18931gna 2ON553171990.002
Suva_14.2762.242ON562245970.004
KLTH0G09372g2.242ON551171960.005
TPHA0F012902.242ON562253950.007
TBLA0G025502.242ON613241940.009
Kpol_1039.192.242ON573236920.012
ZYRO0E10230gsingletonON558192920.014
Kwal_23.48242.242ON553171910.017
KLTH0H16214gsingletonON551237900.025
Kpol_1003.112.241ON581203890.028
Kwal_34.15746na 2ON518176890.029
Suva_9.712.241ON561192890.036
KLTH0C10142gsingletonON573230880.040
Skud_16.503singletonON543219870.059
Smik_6.24na 3ON544170860.079
Skud_2.423na 4ON560332850.095
SAKL0E04246gna 5ON565236850.095
KAFR0J016202.242ON570244840.12
TBLA0A014201.451ON572104840.12
Skud_6.16na 3ON549429840.13
TBLA0E038002.242ON608210840.13
KLLA0E24113g8.570ON575229840.14
KNAG0I019102.242ON598195840.15
YPR198W (SGE1)singletonON543140830.17
NDAI0B037702.242ON571245820.20
YIL120W (QDR1)2.242ON563242820.24
Kwal_27.12832singletonON508113810.29
KLTH0C10120gsingletonON651127810.30
KAFR0J009302.242ON566172810.33
TDEL0C045902.242ON529250800.35
ZYRO0C01430g8.272ON590359800.38
TDEL0E05700singletonON58486800.41
SAKL0C05588gsingletonON677122800.45
TDEL0D06570singletonON566124790.49
YKR105C (VBA5)singletonON582324790.52
NCAS0C03460na 6ON630113780.60
TBLA0F030408.272ON906161790.63
Skud_12.13na 7ON531123770.92
ADL258W2.242ON534186761.0
KLTH0G19668gsingletonON508113761.1
TDEL0A03210singletonON584143761.1
YBR293W (VBA2)na 4ON474312751.3
SAKL0A08228gsingletonON569122751.4
Ecym_73992.473ON563175751.5
ZYRO0F02178gsingletonON59573751.6
TDEL0D06610singletonON49754741.7
CAGL0M06281g8.570ON542255741.8
Smik_2.434na 4ON474303741.8
Skud_3.172na 8ON521146742.2
SAKL0H16808g8.272ON65740742.2
SAKL0E06864gna 9ON573140732.4
YCR098C (GIT1)na 8ON518141732.5
CAGL0G08624g2.242ON583240732.7
Smik_3.200na 8ON518141723.4
KLTH0G11154gna 9ON572142723.5
TDEL0A024902.473ON554110714.7
KLTH0B00594gsingletonON618115705.7
Ecym_42988.272ON678160706.2
Kwal_27.121738.570ON567154706.5
TBLA0E02520singletonON563258706.7
Smik_16.81na 6ON625125706.8
TPHA0B037705.284ON520260697.8
Smik_12.5na 7ON531130697.8
KLLA0A04631g8.272ON57940698.2
ACL172C3.245ON631138698.3
ZYRO0G15422gsingletonON542127689.2
TDEL0G00210singletonON530115689.3
CAGL0B02079gna 6ON624126689.9
Suva_4.553na 4ON562329689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00550
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   983   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   570   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   569   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      565   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   564   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   558   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   558   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   553   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               554   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   551   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   547   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      547   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      545   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   540   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   537   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   538   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   536   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   536   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   533   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   529   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   529   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   527   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   521   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   520   e-180
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   516   e-179
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   506   e-175
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   498   e-171
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   494   e-170
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   426   e-143
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   334   e-108
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   330   e-106
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   328   e-106
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   320   e-103
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   317   e-102
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   312   1e-99
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   306   2e-97
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   291   1e-91
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   199   2e-56
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     186   8e-52
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   169   9e-46
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            155   2e-40
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   142   6e-39
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   142   2e-35
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    51   7e-06
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    49   2e-05
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    47   9e-05
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    47   1e-04
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    45   3e-04
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    45   5e-04
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    45   5e-04
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    44   0.001
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    44   0.001
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    44   0.001
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    43   0.001
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    43   0.002
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    43   0.002
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    43   0.002
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    42   0.004
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    42   0.005
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    41   0.007
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    41   0.009
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    40   0.012
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    40   0.014
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    40   0.017
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    39   0.025
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    39   0.028
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    39   0.029
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    39   0.036
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    39   0.040
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    38   0.059
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    38   0.079
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    37   0.095
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    37   0.095
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    37   0.12 
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    37   0.12 
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    37   0.13 
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    37   0.13 
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    37   0.14 
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    37   0.15 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    37   0.17 
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    36   0.20 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    36   0.24 
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    36   0.29 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    36   0.30 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    36   0.33 
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    35   0.35 
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    35   0.38 
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...    35   0.41 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    35   0.45 
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    35   0.49 
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    35   0.52 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    35   0.60 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    35   0.63 
Skud_12.13 Chr12 (16964..18559) [1596 bp, 531 aa] {ON} YLL055W (...    34   0.92 
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    34   1.0  
KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weak...    34   1.1  
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}               34   1.1  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    33   1.3  
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    33   1.4  
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    33   1.5  
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    33   1.6  
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    33   1.7  
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    33   1.8  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    33   1.8  
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    33   2.2  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   2.2  
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    33   2.4  
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    33   2.5  
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    33   2.7  
Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON...    32   3.4  
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    32   3.5  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    32   4.7  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    32   5.7  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    32   6.2  
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    32   6.5  
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    32   6.7  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   6.8  
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               31   7.8  
Smik_12.5 Chr12 (12023..13618) [1596 bp, 531 aa] {ON} YLL055W (R...    31   7.8  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    31   8.2  
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    31   8.3  
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    31   9.2  
TDEL0G00210 Chr7 complement(40994..42586) [1593 bp, 530 aa] {ON}       31   9.3  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    31   9.9  
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    31   9.9  

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/537 (91%), Positives = 492/537 (91%)

Query: 1   MFDRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGK 60
           MFDRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGK
Sbjct: 1   MFDRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGK 60

Query: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILIS 120
           WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELD            FPLVSGSFILIS
Sbjct: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILIS 120

Query: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180
           GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI
Sbjct: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180

Query: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTT 240
           VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTT
Sbjct: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTT 240

Query: 241 IISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXX 300
           IISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGY         
Sbjct: 241 IISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSI 300

Query: 301 XXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNY 360
                      KYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNY
Sbjct: 301 FLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNY 360

Query: 361 SPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYF 420
           SPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYF
Sbjct: 361 SPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYF 420

Query: 421 RSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIE 480
           RSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIE
Sbjct: 421 RSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIE 480

Query: 481 RQINKSGDRLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELEYNGS 537
           RQINKSGDRLLEGFRAALYFA             FVLQKELMRSKSRKENELEYNGS
Sbjct: 481 RQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELEYNGS 537

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/532 (53%), Positives = 360/532 (67%), Gaps = 17/532 (3%)

Query: 8   NGGQVTALKSSHENEIERNLS------REDKMLTTEKEAPVFVEEPESPWQDPNYFKGKW 61
           N  ++   KSS +N I  +L+       ED+M+ + ++           WQ+PNYFK  W
Sbjct: 18  NETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQK-----------WQNPNYFKYAW 66

Query: 62  DEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISG 121
            E LF+ +CM+ QLLNQAG+T TLS M +L                 FPLVSGSFILISG
Sbjct: 67  QEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISG 126

Query: 122 RLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIV 181
           RLGDIYGLKKMLL+GY+ + IWSLICG++ +S +DTFFI SRAFQGLGI+FVLPN+LGI+
Sbjct: 127 RLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGII 186

Query: 182 GNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTI 241
           GNIY  GT RKNIVIS +G  APIGAT G LFAG++       WPWAFYAY+IAAF+  +
Sbjct: 187 GNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFV 246

Query: 242 ISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXX 301
           +S + IP++IP N++ F+MDWIGS LGV GL+L NFVWNQ+ + GW   Y          
Sbjct: 247 LSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVI 306

Query: 302 XXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYS 361
                     ++AK PLLP+ V + R +I I+ +L  GWGSFGI+ FYYFQF L +R Y+
Sbjct: 307 FLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYT 366

Query: 362 PVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFR 421
            +WAGGT+FM  I G IAAL VGF+IK V P+V LFFSM+AF  GSI+ SVTPVHETYFR
Sbjct: 367 ALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFR 426

Query: 422 SCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIER 481
           + LG M+ILSFGMDLSFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E 
Sbjct: 427 TQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVET 486

Query: 482 QINKSGDRLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELE 533
           Q+N  G  LL+G+R A Y               ++++  +   ++R   E +
Sbjct: 487 QVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYD 538

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 346/497 (69%), Gaps = 1/497 (0%)

Query: 37  EKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELD 96
             E+P  +E   S  ++P+YF     E  F+ SCM+ QLLN AG+T TLS M VL R+L 
Sbjct: 29  NDESPS-MELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLH 87

Query: 97  XXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHND 156
                       FPLVSGSFIL+SGRLGDIYGLKKML+LGY+ L IWSLI GLS +SH+ 
Sbjct: 88  SSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGLSGYSHSG 147

Query: 157 TFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGV 216
            FFI +RAFQGLGIS VLPN+LG++G IYKPGT +KN+VIS++G  +PIGAT GGLF+G+
Sbjct: 148 IFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGL 207

Query: 217 VVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFN 276
           V    +  WPWAFYAYT+AAF+ T ISY+ IPN+IP NVN+ +MDWIGS  GV GL+LFN
Sbjct: 208 VATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFN 267

Query: 277 FVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASL 336
           FVWNQ+   GW + Y                    +YA+ PLLP E+  +R +IMIL ++
Sbjct: 268 FVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQLIMILTAM 327

Query: 337 MAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLL 396
             GWGSFGIW FYYF FVL LRNYSP+WAGG++F+  I G I A++ GF +K++ PAVLL
Sbjct: 328 TFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFLMKKIRPAVLL 387

Query: 397 FFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGM 456
            FSM+ F  G II SVTPVH+TYFR+ LG M+IL  GMDLSFPA+SIILSD L  Q+QGM
Sbjct: 388 TFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIILSDNLPNQHQGM 447

Query: 457 AGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAXXXXXXXXXXXXXFV 516
           AGSLVNTV+NYS SLFLGI GT+E+  NK+G  LL G+R ALYF              ++
Sbjct: 448 AGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYM 507

Query: 517 LQKELMRSKSRKENELE 533
           ++      K RKE + E
Sbjct: 508 VETIFDSYKDRKEKDCE 524

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/494 (57%), Positives = 349/494 (70%), Gaps = 5/494 (1%)

Query: 11  QVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEP-----ESPWQDPNYFKGKWDEVL 65
           ++T   SS   E   ++++E+    +E E P   +E       S WQ+P+YF+ KW E L
Sbjct: 18  EITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYL 77

Query: 66  FVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGD 125
           F+ SCMM QLLNQA +  TLS M ++                 FPLVSGSFILISGR+GD
Sbjct: 78  FIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGD 137

Query: 126 IYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIY 185
           IYGLKK L+ GY++  IWSLI G + +SHND FFI SRAFQGLGI+F+LPN++GIVGNIY
Sbjct: 138 IYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIY 197

Query: 186 KPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYF 245
           KP T+RKNIVIS+IG  APIGA  G LFAG++       WPWAFYA+ IA+ +   IS +
Sbjct: 198 KPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIY 257

Query: 246 VIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXX 305
            IPN+IP N++ FAMDWIGS + V GL+L NFVWNQ  +VGW   Y              
Sbjct: 258 SIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVL 317

Query: 306 XXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWA 365
                 KYAK P+LP EVT++R IIMILA+L  GWGSFGI+ FYYF F+L LR+YS +WA
Sbjct: 318 FFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWA 377

Query: 366 GGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLG 425
           G T+FM +I G +AA+ VG  IKR+  +V+LFFSMIAF  G I+LSVTPV +TYFR  LG
Sbjct: 378 GTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLG 437

Query: 426 AMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINK 485
            M+ILSFGMD+SFPAA+IILSD L+MQYQGMAGSL NT+VNYSMSL LG+G T+ERQINK
Sbjct: 438 TMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINK 497

Query: 486 SGDRLLEGFRAALY 499
           SG  +L+G+RAA Y
Sbjct: 498 SGKEILKGYRAAEY 511

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/484 (56%), Positives = 341/484 (70%), Gaps = 3/484 (0%)

Query: 18  SHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLN 77
           S  NE ++N+S  +K + +     V   + +SPWQ+PNYF  K+ E  F+ +CM+  LLN
Sbjct: 20  SFPNE-DKNISHNEKEVYSNSTDSVL--DDDSPWQNPNYFSSKYKEYFFIFTCMVANLLN 76

Query: 78  QAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGY 137
           QAG T  LSTM V+                 FPLVSGSFILISGR+GDIYGLKK ++ GY
Sbjct: 77  QAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGY 136

Query: 138 IWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVIS 197
           I++ IWSL+CG + F+HNDTFFI  RAFQGLGISF+LPN++G++GNIYK GT RKNIVIS
Sbjct: 137 IFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVIS 196

Query: 198 LIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNK 257
           +IG+ AP GA  G L+ G++V      WPW FYAY +   +  I++ + +PN IP NV+ 
Sbjct: 197 MIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHN 256

Query: 258 FAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVP 317
           FAMDWIGS +GV GL+LFNFVWNQ  V GW   Y                    KY   P
Sbjct: 257 FAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISP 316

Query: 318 LLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGC 377
           LLP EVT++  I+ IL+ L  GWG+FGIW FYYF F L LR+YSPVW GGT+FM  I G 
Sbjct: 317 LLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGT 376

Query: 378 IAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLS 437
           IAAL V F+IK+VGPA+LLFFS + FT GS++LSVTP+H+ Y+R  LG  +IL FGMDLS
Sbjct: 377 IAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLS 436

Query: 438 FPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAA 497
           FPA+SIILSD L MQYQGMAGSLVNTV+NY+ SL LG+G T+ERQINKSG+ LL+G+R+A
Sbjct: 437 FPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSA 496

Query: 498 LYFA 501
           LY A
Sbjct: 497 LYLA 500

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/527 (52%), Positives = 353/527 (66%), Gaps = 6/527 (1%)

Query: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWD 62
           D        V+A+K S  ++     + E   ++T+    + V++    WQ+PNYFK  W 
Sbjct: 15  DSFEAENESVSAVKKSSRHD----GNEETVTISTDHGEEMTVDKQR--WQNPNYFKNSWH 68

Query: 63  EVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGR 122
           E LF+ +CM+ QLLNQAG+T TLS M ++                 FPLVSGSFILISGR
Sbjct: 69  EYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGR 128

Query: 123 LGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVG 182
           LGDIYGLKKML +GY+ + IWSLICGL+ +S +DTFFI SRAFQGLGI+FVLPN+LGI+G
Sbjct: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 188

Query: 183 NIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTII 242
           NIY  GT RKNIVISL+G  AP+GAT G LFAG++  +    WPWAFYAYTI + +   +
Sbjct: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLAL 248

Query: 243 SYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXX 302
           S + IPN+IP N+  F+MDWIGSALGV GLVL NFVWNQ+ + GW   Y           
Sbjct: 249 SVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVF 308

Query: 303 XXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSP 362
                    ++AK PLLP+ V + R +I I+ +L  GWGSFGI+ FYYFQF L +R+YS 
Sbjct: 309 LVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368

Query: 363 VWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRS 422
           VWAGGT+FM  I G IAAL VG  IK+V P+V LF SM+AF  GSI+ SVTPVHETYFR+
Sbjct: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428

Query: 423 CLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQ 482
            LG M+ILSFGMD SFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E  
Sbjct: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488

Query: 483 INKSGDRLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKE 529
           ++  G  +L+G+R A Y               +++++ +   K++  
Sbjct: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/499 (56%), Positives = 343/499 (68%), Gaps = 12/499 (2%)

Query: 13  TALKSSHENEIERN--LSREDKMLTTEKEAPVF----------VEEPESPWQDPNYFKGK 60
           TA K     EIE    L  ED      KE  +           V + +  WQ+PNYFK  
Sbjct: 17  TAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFKYP 76

Query: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILIS 120
           W E LF+ +CM+ QLLNQ+G+T TLS M +L                 FPLVSGSFILIS
Sbjct: 77  WQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILIS 136

Query: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180
           GR+GDI+GLK MLL+GY+ + IWSLICGL+ +S +DTFFI SRAFQGLGI+FVLPN+LGI
Sbjct: 137 GRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGI 196

Query: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTT 240
           +GN+Y  GT RKNIVIS IG  APIGAT G  FAG++     + WPWAFYAYTI A +  
Sbjct: 197 IGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINL 256

Query: 241 IISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXX 300
           I+S + IPN+IP NV++F+MDWIGS LGV GLVL N VWNQ+ + GW   Y         
Sbjct: 257 ILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISV 316

Query: 301 XXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNY 360
                       +AK PLLP+ V + R +I I+ SL  GWGSFGI+ FYYFQF L +R+Y
Sbjct: 317 LFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHY 376

Query: 361 SPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYF 420
           +P+WAGG++FM  I G IAAL VGFSIKRV P+V LFF+M+AF  GSI+ SVTPVHETYF
Sbjct: 377 TPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYF 436

Query: 421 RSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIE 480
           R  +G M+ILSFGMDLSFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E
Sbjct: 437 RMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 496

Query: 481 RQINKSGDRLLEGFRAALY 499
            Q++  G  +L+G+R A Y
Sbjct: 497 MQLDPDGKHILKGYRGAQY 515

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 347/482 (71%), Gaps = 3/482 (0%)

Query: 20  ENEIERNLSR--EDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLN 77
           EN+ E N  +         E++       P+S  Q+P+YF   W E +FVLS M+ QLLN
Sbjct: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64

Query: 78  QAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGY 137
           QA +T T     VL ++L+            FPLVSGSFIL+SG++GDIYGLKK LL GY
Sbjct: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124

Query: 138 IWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVIS 197
           + + IWSLICGLSS++HN  FF+ +R+FQGLGI+FVLPN++GIVGNIYKP T  KN+V S
Sbjct: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184

Query: 198 LIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNK 257
           LIG CAPIGAT G +F+G++  R D  W W FYAY I A L  +++ ++IPN+IP NVN+
Sbjct: 185 LIGACAPIGATLGCVFSGLIGARTDL-WGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243

Query: 258 FAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVP 317
           + MDWIGSA+GV GL+LFNFVWNQ+ + GW + Y                    ++AK P
Sbjct: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQP 303

Query: 318 LLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGC 377
           LLP  V  +R ++MIL+SL  GWGSFGIW FYY  F+L LR+YSP+WAGGT+FM +I G 
Sbjct: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363

Query: 378 IAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLS 437
           +A+L VG++I + GPAV+LF SM+AF CG I+L+VTPVH+TYFR  LG M+ILSFGMDLS
Sbjct: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423

Query: 438 FPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAA 497
           FPAASIILSD+L  QYQGMAGSLV+T+++YSMSL LGI GT E Q+NK+G  LL+G++AA
Sbjct: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483

Query: 498 LY 499
           LY
Sbjct: 484 LY 485

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/494 (55%), Positives = 344/494 (69%)

Query: 44  VEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXX 103
           ++E  S WQ+P+YF   + E +FV +CM+  LLNQAG +  LS M V+            
Sbjct: 56  LQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQT 115

Query: 104 XXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSR 163
                FPLVSGSFILISGRLGDIYGLK+M++ G+I++ IWSLICG ++++H+DTFFI +R
Sbjct: 116 WLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVAR 175

Query: 164 AFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDS 223
           AFQGLGISF+LPN++G+VGNIYK GT RKN+VISLIG+ AP G+ FG L+ G++V     
Sbjct: 176 AFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPK 235

Query: 224 DWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQST 283
            WPW FYAY +AA +  ++ Y+ +P++IP NVN F MDWIGS LGV GL+LFNFVWNQ  
Sbjct: 236 QWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGP 295

Query: 284 VVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSF 343
           +VGW   Y                    KYAKVPLLPK VT++  I+ IL  L  GWGSF
Sbjct: 296 IVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSF 355

Query: 344 GIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAF 403
           GIW FYYF F L LR YSPVW+GGTFF+  I G +AA TV  +IK+VGPA+LLFFS I F
Sbjct: 356 GIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGF 415

Query: 404 TCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNT 463
           TCGSII+SVTPVH+TY+R+  G  +IL FGMDL FPA+SIILSD L MQYQGMA SLVNT
Sbjct: 416 TCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNT 475

Query: 464 VVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMR 523
           +VNYS SL LG+G T+ERQINKSGD LL+G+RAALYF               V      +
Sbjct: 476 IVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSK 535

Query: 524 SKSRKENELEYNGS 537
             ++   +L+  G+
Sbjct: 536 RNAKDPKDLQRCGT 549

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/516 (54%), Positives = 348/516 (67%), Gaps = 5/516 (0%)

Query: 16  KSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQL 75
           KSS +N  E  L R       E E    + E    WQ+P YFK  W E LF+ +CM+ QL
Sbjct: 29  KSSRDNGSEETL-RGTAFTNLEDE----MVECNQKWQNPKYFKYAWQEYLFIFTCMISQL 83

Query: 76  LNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLL 135
           LNQAG+T TLS M +L                 FPLVSGSFILISGRLGDIYGLKKMLL+
Sbjct: 84  LNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 143

Query: 136 GYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIV 195
           GY+ + IWSLICG++++S +DTFFI  RAFQGLGI+FVLPN+LGI+GNIY  GT RKNIV
Sbjct: 144 GYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIV 203

Query: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNV 255
           IS +G  APIGAT G LFAG++     + WPWAFYA++IA+ +   +S + IPN+IP N+
Sbjct: 204 ISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNI 263

Query: 256 NKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAK 315
           + F+MDWIGS LGV GL+L NFVWNQ+ + GW+  Y                     +AK
Sbjct: 264 HHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAK 323

Query: 316 VPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIV 375
            PLLP  V +   +I I+ +L  GWGSFGI+ FYYFQF L +R+Y+ +WAGGT+FM  I 
Sbjct: 324 SPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIW 383

Query: 376 GCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMD 435
           G IAAL VGF+IK V P+V LFFSM+AF  GSI+ SVTPVHETYFR+ LG M+ILSFGMD
Sbjct: 384 GIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMD 443

Query: 436 LSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFR 495
           LSFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E Q++  G  LL+G+R
Sbjct: 444 LSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYR 503

Query: 496 AALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENE 531
            A Y               ++++  +   K++   E
Sbjct: 504 GAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/515 (53%), Positives = 356/515 (69%), Gaps = 9/515 (1%)

Query: 24  ERNLSREDKMLTTE------KEAPVFVEEPESP-WQDPNYFKGKWDEVLFVLSCMMGQLL 76
             ++S + K L T+      + + V V++ + P  QDP YF   W E LF+ + MM QLL
Sbjct: 7   NESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLL 66

Query: 77  NQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLG 136
           NQAG+T TLS + +L +  D            FPLVSGSFIL+SG++GDIYGLKK LL+G
Sbjct: 67  NQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVG 126

Query: 137 YIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVI 196
           Y+   IWSLICGL+S++ +  FFI SRAFQGLGI+F+LPN++GIVGNIY  GT RKN+VI
Sbjct: 127 YVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVI 186

Query: 197 SLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVN 256
           SLIG CAPIGAT G LF+G++    +  W W FYAYTI A +   +S +VIPN+IP NV 
Sbjct: 187 SLIGACAPIGATMGVLFSGLIGTLSER-WAWTFYAYTITAAINMGLSIWVIPNTIPTNVR 245

Query: 257 KFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKV 316
             +MDWIGS +G+ G++LFNFVWNQ  +VGW T Y                    KYA  
Sbjct: 246 GSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYAND 305

Query: 317 PLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVG 376
           PL+P+    +  ++M L ++  GWGSFGIW FYYF FVL LR Y+P+WAGG++FM  I G
Sbjct: 306 PLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWG 365

Query: 377 CIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDL 436
            IAA++VG++IKR+ P+++LF SM+AF CG I+LSVTPV +TYFR  LG M+ILSFGMDL
Sbjct: 366 IIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDL 425

Query: 437 SFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRA 496
           SFPA+SIILSDEL M+ QGMAGSLV+T++NYSMS+ LGI GT+E QINK+GD LL+G+RA
Sbjct: 426 SFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRA 485

Query: 497 ALYFAXXXXXXXXXXXXXFVLQKEL-MRSKSRKEN 530
           ALY               F+L+  L MR ++ KE 
Sbjct: 486 ALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/502 (55%), Positives = 352/502 (70%), Gaps = 4/502 (0%)

Query: 1   MFDRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPE---SPWQDPNYF 57
           +F+R +    ++    +S   E E ++ +   +   EK+     E P+   S WQ+P+YF
Sbjct: 4   IFNRKSHRSEEIMESAASSITE-ETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYF 62

Query: 58  KGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFI 117
           + +W E LF+ SCMM QLLNQA +  TLS M ++    +            FPLVSGSFI
Sbjct: 63  QNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFI 122

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
           LISGR+GDIYGLKK L+ GYI+  IWS+I GL+ +SH+DTFFI SRAFQGL I+F+LPN+
Sbjct: 123 LISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNV 182

Query: 178 LGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAF 237
           +GIVGNIYKP + RKNIVIS+IG  APIGA FG LFAG++       WPWAFYA+ IA+ 
Sbjct: 183 MGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASA 242

Query: 238 LTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXX 297
               IS + IPNS+P NV+ FAMDWIGS L V GL+L NFVWNQ  +VGW T Y      
Sbjct: 243 FNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLV 302

Query: 298 XXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTL 357
                         KYA+ PLLP EVT++R IIMILA+L  GWGSFGI+ FYYF F+L L
Sbjct: 303 VSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNL 362

Query: 358 RNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHE 417
           R+YS +WAG T+FM +I G +AA+ VG  IK++  A +LF SM+AF  G I+LSVTPV +
Sbjct: 363 RHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQ 422

Query: 418 TYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGG 477
           TYFR  LG M+ILSFGMD+SFPAA+IILSD L+MQYQGMAGSL NT+VNYSMSL LG+G 
Sbjct: 423 TYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGT 482

Query: 478 TIERQINKSGDRLLEGFRAALY 499
           T+ERQINKSG+ LL+G+R A Y
Sbjct: 483 TVERQINKSGNDLLKGYRGAEY 504

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/482 (55%), Positives = 335/482 (69%), Gaps = 5/482 (1%)

Query: 20  ENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQA 79
           EN+     S + K L+ +      + E  +PWQ+  YF+    E  F+ +CM   LLNQA
Sbjct: 2   ENKEPIVSSSQKKTLSCDS-----LLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQA 56

Query: 80  GSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIW 139
           G T  LSTM V+                 FPLVSGSFILISGR+GDIYGLKK ++ GYI+
Sbjct: 57  GQTQVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIF 116

Query: 140 LTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLI 199
           + IW+L+CG + ++H+DTFFI  RAFQGLGISF+LPN++G+VGNIYK GT RKNIVISLI
Sbjct: 117 MIIWTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLI 176

Query: 200 GMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFA 259
           G+ AP GA  G L+ G++       WPW FYAY +AAF+  I++ + +P ++P NV+ FA
Sbjct: 177 GITAPTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFA 236

Query: 260 MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLL 319
           MDW+G+ +GV GL+LFNFVWNQ  V GWA  Y                    K+   PLL
Sbjct: 237 MDWMGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLL 296

Query: 320 PKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIA 379
           P+EVT++  I+ IL  L  GWGSFGIW FYY+ F L LRNYSP+WAG T FM  I G IA
Sbjct: 297 PREVTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIA 356

Query: 380 ALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFP 439
           A  VGF+I RVGPAVLLFFS + FT GS++LSVTP+H+TY+R  +G  +ILSFGMDLSFP
Sbjct: 357 AFIVGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFP 416

Query: 440 AASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALY 499
           A+SIILSD L MQYQGMAGSLVNT++NYS SL LG+G T+ERQINK+G+ LL G+R+ALY
Sbjct: 417 ASSIILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALY 476

Query: 500 FA 501
            A
Sbjct: 477 LA 478

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/464 (55%), Positives = 334/464 (71%), Gaps = 1/464 (0%)

Query: 36  TEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLEREL 95
           T  +A  F  +  +PWQ+P+YF  +W E LF+L+CM+  LLNQAG T   STM V+    
Sbjct: 55  TSPDAEKF-SDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAF 113

Query: 96  DXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHN 155
           +            FPLVSGSFIL+SGR+GDIYGLK+ ++ G I + IWSLICG +++S +
Sbjct: 114 NADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSS 173

Query: 156 DTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAG 215
            TFFI  RAFQGLGI+FVLPN++G+VGNIYK G+ RKNIVIS IGMCAP GA FG  +AG
Sbjct: 174 VTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAG 233

Query: 216 VVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLF 275
           ++  + +  WPW FYAY  A  L  +++ + IP+++PVNV+ F+MDW GS +GV GL+LF
Sbjct: 234 LIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILF 293

Query: 276 NFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILAS 335
           NFVWN++ +VGW   Y                    K+AK PLLP+ VT + +IIMIL++
Sbjct: 294 NFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSA 353

Query: 336 LMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVL 395
           +  GWGSFGIW FYY+ F+L LR Y+P+ AG +  M  + G IAA TV F+IKRVGP+VL
Sbjct: 354 MFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVL 413

Query: 396 LFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQG 455
           LF SM+AFT GSI+LS+TPVH+TY++   G  +IL+FGMDLSFPA+SIILSD L M+YQG
Sbjct: 414 LFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQG 473

Query: 456 MAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALY 499
           MAGSLVNT+VNYS SL LG+G T E Q+NK+G  LL+G+RAALY
Sbjct: 474 MAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALY 517

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/504 (52%), Positives = 341/504 (67%), Gaps = 1/504 (0%)

Query: 24  ERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTM 83
           +R  S   + +    E    +    S  Q+P+YF  +W E LFV+S M+ QLLNQA +  
Sbjct: 11  QRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAALQ 70

Query: 84  TLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIW 143
                 +L  +L             FPLVSGSFIL+SG++GDIYGLKK LL GY  + IW
Sbjct: 71  ANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIW 130

Query: 144 SLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCA 203
           SLICGLSS++HN  FFI +R+FQGLGI+FVLPN+ GIVGNIYKP T+ KN+V S+IG CA
Sbjct: 131 SLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACA 190

Query: 204 PIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWI 263
           PIGAT G LF+G++    ++ W W FYAYTI A L  +I+++VIP++IP NV+KF MDW+
Sbjct: 191 PIGATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWL 249

Query: 264 GSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEV 323
           GS LGV GL++FNFVWNQ+   GW + Y                    ++AK PLLP+ V
Sbjct: 250 GSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPRAV 309

Query: 324 TESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTV 383
             +R ++MILASL  GWGSFGIW +YY  FVL LR+Y+P+WAGG++FM +I G IAA  V
Sbjct: 310 LFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLV 369

Query: 384 GFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASI 443
           G +I + GPA++L  S+IAF  G I+LSVTPV +TYFR  LG MVILSFGMDLSFPA+SI
Sbjct: 370 GHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSI 429

Query: 444 ILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAXX 503
           ILSD+L  QYQGMAGSLVNT++NYSMSL LG+ GT ERQ+NK G  LL+G+RAALY    
Sbjct: 430 ILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIG 489

Query: 504 XXXXXXXXXXXFVLQKELMRSKSR 527
                      + ++    R + R
Sbjct: 490 LASVGIFVSGAYAIEDWWTRRRER 513

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/493 (52%), Positives = 335/493 (67%), Gaps = 4/493 (0%)

Query: 11  QVTALKSSHENEIERNLSREDKMLTTEKEAPVFVE----EPESPWQDPNYFKGKWDEVLF 66
            +T  + +   + ++    E K  +TE EA    E    + ++PWQ+P YF  +W E  F
Sbjct: 18  HITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAF 77

Query: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDI 126
           + +CM+ QLLNQAG     + M +L    +            FPLVSGSFIL+SGR+GDI
Sbjct: 78  ISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDI 137

Query: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186
           YGLKK L+ GY+ + IWSLICG ++++HND FFI  RAFQGLGI+F+LPN++G++GNIYK
Sbjct: 138 YGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYK 197

Query: 187 PGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFV 246
             T RKN VIS +GMCAPIGA  GG+++G++       WPW FYAY I   +  +++ + 
Sbjct: 198 ANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYS 257

Query: 247 IPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXX 306
           IP+++P N++ F MDW GSA+GV G++LFNFVWNQ  + GW  GY               
Sbjct: 258 IPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAF 317

Query: 307 XXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAG 366
                K+AK PLLP EV ++R I MIL ++  GWGSFGIW FYY+ F L LR+YS VWAG
Sbjct: 318 FIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAG 377

Query: 367 GTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGA 426
           GTFFM  I G IAA  V  +IKRVGP+VLL FSM  FT G I+LSVTPVH++Y++  LG 
Sbjct: 378 GTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGM 437

Query: 427 MVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKS 486
            +ILSFGMDLSFPA+SIILSD L  QYQGMAGSLVNT+VNYS SL LG+G T E Q+NK+
Sbjct: 438 QIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKN 497

Query: 487 GDRLLEGFRAALY 499
           G   L+G+RAALY
Sbjct: 498 GTDKLKGYRAALY 510

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/509 (52%), Positives = 342/509 (67%), Gaps = 1/509 (0%)

Query: 28  SREDKMLT-TEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLS 86
           +  DK+ +  E    V   +P   WQD  YF+ +W E +FV +CMM QLLNQA    TLS
Sbjct: 32  TDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLS 91

Query: 87  TMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLI 146
            M +L +               FPLVSGSFILISGR+GDIYGLK  L+ G I+  IW+LI
Sbjct: 92  LMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALI 151

Query: 147 CGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIG 206
            G ++++H+DTFFI SR+FQGLG++F+LPN++G VGNIYKP T RKNIVISLIG CAP+G
Sbjct: 152 SGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVG 211

Query: 207 ATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSA 266
           A  G  FAG++  +   DWPW+FYA  IA+ LT + + + IPN IP NV+ F+MDWIGS 
Sbjct: 212 AFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSG 271

Query: 267 LGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTES 326
           L V GL+L NFVWNQ  + GW   Y                     YA  PLLP+ +T++
Sbjct: 272 LAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQN 331

Query: 327 RSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFS 386
           R ++MIL +L  GWGSFGI+ FYYF F+L LR+YS VWAGGT+FM +I G +A++ VG S
Sbjct: 332 RHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLS 391

Query: 387 IKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILS 446
           I+++  +++LFFSMIAF  G I+LSVTPV +TYFR  LG M+ILSFGMD+SFPAA+IILS
Sbjct: 392 IRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILS 451

Query: 447 DELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAXXXXX 506
           D L  QYQGMAGSL NT+VNYSMSL LG+G T+E QIN++G  LL+G+RAA Y       
Sbjct: 452 DSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIAS 511

Query: 507 XXXXXXXXFVLQKELMRSKSRKENELEYN 535
                   ++ ++  +  K R E+  E N
Sbjct: 512 LAVILSLIYMCERLWIDRKERMESTSETN 540

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 351/518 (67%), Gaps = 1/518 (0%)

Query: 16  KSSHENEIERNLSREDKMLTTEKEAPVFVE-EPESPWQDPNYFKGKWDEVLFVLSCMMGQ 74
           K S + E +  +S ED+ +TT   +    +   +SPWQDP YF     E++F+++CM+ Q
Sbjct: 21  KISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQ 80

Query: 75  LLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLL 134
           LLNQAG T  L+ M VL +  +            FPLV+GSFILISGRLGDIYGLKKML+
Sbjct: 81  LLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLM 140

Query: 135 LGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNI 194
           +GY+ + +WSLICGLS +S+ND FFIT RAFQGLGI+F+LPN++G+VG++YK G+ RKN+
Sbjct: 141 IGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNL 200

Query: 195 VISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVN 254
           VIS IG CAP G  FGGLF G++V      WPW FYA+ IA FL  I++++ IPN+IP N
Sbjct: 201 VISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTN 260

Query: 255 VNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYA 314
           V+ F+MDW GS L V GL+LFNFVWNQ+   GW T Y                    KYA
Sbjct: 261 VHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYA 320

Query: 315 KVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSI 374
           KVPLLP  VT++R +IMIL ++  GWGSFGIW FYY  F L LR+YSPVW GGT+F+  I
Sbjct: 321 KVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVI 380

Query: 375 VGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGM 434
            G IAA  V  SIKRVGPA LL F+++AF  GSI+ SV PV +++++   G   IL FGM
Sbjct: 381 FGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGM 440

Query: 435 DLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGF 494
           DLSFPA+SIILSD L M+YQGMAGSLVNTV+NYS SL LG+G T+E QINK+G  LL+G+
Sbjct: 441 DLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGY 500

Query: 495 RAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENEL 532
           R A+Y               ++L+      + R+++ +
Sbjct: 501 RGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQKDSV 538

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/505 (50%), Positives = 345/505 (68%), Gaps = 1/505 (0%)

Query: 29  REDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTM 88
           +++  +  EK+      +    WQ+P YF     E LF+ SC + QLLNQAG+  T   M
Sbjct: 28  QDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIM 87

Query: 89  KVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICG 148
            ++   LD            FPL+SGSFILISGR+GDIYGLKK LL+GY++L +WSLICG
Sbjct: 88  NIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICG 147

Query: 149 LSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGAT 208
           L+ ++H+D+FFI SRAFQGLGIS +LPN+LGIVG+IY  G++RKN+VISLIG  APIGAT
Sbjct: 148 LTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGAT 207

Query: 209 FGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALG 268
            G +F+G++     + WPWAFY+Y I A +  ++S ++IPN+IP NV+   MDWIGS LG
Sbjct: 208 LGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLG 267

Query: 269 VSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAK-VPLLPKEVTESR 327
           V GL++ NFVWNQ+ + GW + Y                     +    PLLPKEV +S 
Sbjct: 268 VVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSP 327

Query: 328 SIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSI 387
             I++L +L  GWGSFGI+ FYYF F L LR+Y+P+WAGGT+FM  I G +AAL VGF+I
Sbjct: 328 KTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTI 387

Query: 388 KRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSD 447
           K+V P+++LF SM+AF CGSII+SVTP+H+TYFR+ LG M+ILSFGMDLSFPA+SI+LSD
Sbjct: 388 KKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSD 447

Query: 448 ELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAXXXXXX 507
           +L +QYQGMAGSLVNT+VNYSMS  LG+ G +E+ +N  G  +L+G+R A Y        
Sbjct: 448 KLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASM 507

Query: 508 XXXXXXXFVLQKELMRSKSRKENEL 532
                   +L + +   K+ K++ +
Sbjct: 508 ACIISGALMLSEIIQGRKNEKDSAV 532

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/525 (50%), Positives = 358/525 (68%), Gaps = 11/525 (2%)

Query: 20  ENEIERNLS--REDKML--TTEKEAPVFVEEP-------ESPWQDPNYFKGKWDEVLFVL 68
           ++EI+  ++   +DK++  T ++E    V          +SPWQDP YF     E++F+ 
Sbjct: 15  DSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIA 74

Query: 69  SCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYG 128
           +CM+ QLLNQAG T  L  M VL +  +            FPL +GSFILISGRLGDIYG
Sbjct: 75  TCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYG 134

Query: 129 LKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPG 188
           LKKML++GY+ + +WS+I GLS +S++D FFITSRAFQG+GI+F+LPN++G+VG++YK G
Sbjct: 135 LKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVG 194

Query: 189 TRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIP 248
           + RKNIVIS IG CAP G  FGGLF G++V    + WPW FYA+ IA FL+ +++++ IP
Sbjct: 195 SFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIP 254

Query: 249 NSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXX 308
           N++P N++  +MDW GSAL + GL+LFNFVWNQ+ +VGW   Y                 
Sbjct: 255 NNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFV 314

Query: 309 XXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGT 368
              KYA+VPLLP+ +T++R +IMIL ++  GWGSFGIW FYY  F L LR+YSPVW GGT
Sbjct: 315 YESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGT 374

Query: 369 FFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMV 428
           +F+  I G +AA  V FSIKR+GPA+LL FS++AF  GSI+ SV PV ++Y++       
Sbjct: 375 YFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQA 434

Query: 429 ILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGD 488
           IL FGMDLSFPA+SIILSD L MQYQGMAGSLVNTV+NYS SL LG+GGT+E QINKSG+
Sbjct: 435 ILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGN 494

Query: 489 RLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELE 533
            LL+G+RAA+Y               ++L+    R +  ++  LE
Sbjct: 495 DLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDRSLE 539

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/488 (52%), Positives = 338/488 (69%), Gaps = 2/488 (0%)

Query: 16  KSSHENEIERNLSRE--DKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMG 73
           K+  +  ++   SR   +  LT          +  S +Q+P+YFK K+ E  F+ S M+G
Sbjct: 25  KNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSYQNPDYFKNKYQEFGFIFSGMIG 84

Query: 74  QLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKML 133
           QLL+QAG T TLS M VL +ELD            FPL  GSFIL+SGRLGDIYGLKK+L
Sbjct: 85  QLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKIL 144

Query: 134 LLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKN 193
           L GYI  T+WS+ICGLSS++HND FFIT+RAFQGLG++F LPN++G++G IY+PG  RKN
Sbjct: 145 LGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKN 204

Query: 194 IVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPV 253
           ++IS+IG  +P GAT GGLFAG+ V    S+WPW+FYA+ + +F+  IIS++ IPNSIP 
Sbjct: 205 MIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPT 264

Query: 254 NVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKY 313
           N++   MDW+GS LGV GL++ NFV+NQ+ +VGW + Y                    KY
Sbjct: 265 NIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 324

Query: 314 AKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVS 373
           AK PL+PK ++ +R ++MIL SL  GWGSFGIW FYYF F L LR+YSP+WAG ++F+  
Sbjct: 325 AKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFV 384

Query: 374 IVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFG 433
           I G   A+  G +IK++ P+VL   SM+ F  G+II + TPV++T+FR+ LG M +L  G
Sbjct: 385 ISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLG 444

Query: 434 MDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEG 493
           MD SFPA+SIILSD L MQYQGMAGSLVNTV+NYS S+ LG+ GT+E + N  G  LL G
Sbjct: 445 MDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNG 504

Query: 494 FRAALYFA 501
           +RAA+YFA
Sbjct: 505 YRAAIYFA 512

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/516 (50%), Positives = 345/516 (66%), Gaps = 8/516 (1%)

Query: 26  NLSREDKMLTTEKEAPVFVEEP--------ESPWQDPNYFKGKWDEVLFVLSCMMGQLLN 77
           ++  EDK++ +  E    V           +SPWQDP YF     E++F+ +CM+ QLLN
Sbjct: 23  SMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLN 82

Query: 78  QAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGY 137
           QAG T  L  M VL +               FPL +GSFILISGRLGDIYGLKKML++GY
Sbjct: 83  QAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGY 142

Query: 138 IWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVIS 197
           + + +WS+I GLS +S+ND+FFIT RAFQG+GI+F+LPN++G+VG++YK G+ RKN+VIS
Sbjct: 143 VIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVIS 202

Query: 198 LIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNK 257
           +IG C P GA FGG+F G++V    + WPW FYA+ IA F++ +++++ IPN++P NV+ 
Sbjct: 203 VIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHG 262

Query: 258 FAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVP 317
            +MDW GS L V GL+LFNFVWN++ + GW   Y                    KYA+VP
Sbjct: 263 LSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVP 322

Query: 318 LLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGC 377
           LLP  VT++R +IMIL ++  GWGSFGIW FYY  F L LR+YSPVW GGT+F+ +I G 
Sbjct: 323 LLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGT 382

Query: 378 IAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLS 437
           IAA  V FSIKR+GPA+LL F+++AF  GSI+ SV PV ++Y++       +L FGMDLS
Sbjct: 383 IAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLS 442

Query: 438 FPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAA 497
           FPA+SIILSD L MQYQGMAGSLVNTV+NYS SL LG+G T+E QINKSG  +LEG+RAA
Sbjct: 443 FPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAA 502

Query: 498 LYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELE 533
           +Y               ++L+      K  +   LE
Sbjct: 503 VYLGIGLASLGVLISVTYMLETVWNERKKCQRKSLE 538

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/522 (53%), Positives = 355/522 (68%), Gaps = 7/522 (1%)

Query: 16  KSSHENEIERNLSREDKMLTTEKEAPVFVE---EPESPWQDPNYFKGKWDEVLFVLSCMM 72
           + S  +E + N    D++  T K     V+   E +SP+Q+P YF+  + EV+F++SCM+
Sbjct: 38  ECSSSDECQSN---SDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMV 94

Query: 73  GQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKM 132
            QLLNQAG T +LSTM VL                 FPLVSGSFILISGRLGDIYGLKK 
Sbjct: 95  AQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKA 154

Query: 133 LLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRK 192
           L +GYI +T+WS+ICGL+ ++++D FFI  R+FQGLGI+F+LPN++G+VGNIYK GT RK
Sbjct: 155 LSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRK 214

Query: 193 NIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIP 252
           NIVIS IG  AP GA  G LF G++V      WPW FYA+ IA+F+  +++ + IPN++P
Sbjct: 215 NIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVP 274

Query: 253 VNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXK 312
            N+N   MDWIGS LGVSGL+L N VWNQ+ +VGW   Y                    K
Sbjct: 275 TNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIK 334

Query: 313 YAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMV 372
           YA  PLLP  V E++ I+MILA+L  GWGSFGIW +YY+ F L LR Y+P+WAGGT FM 
Sbjct: 335 YATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMF 394

Query: 373 SIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSF 432
            I G +AA  V  +IK+VGPAVLL FSM+AF CGSI+LSVTPVH+TY+R  +G  +ILSF
Sbjct: 395 VIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSF 454

Query: 433 GMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLE 492
           GMDLSFPA+SIILSD L MQYQGMAGSLVNTVVNYS SL LG+G T+E+Q N  G  LL+
Sbjct: 455 GMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLK 514

Query: 493 GFRAALYFAXXXXXXXXXXXXXFVLQKELM-RSKSRKENELE 533
           G+R+ALY A             F++   +  R + R E+E E
Sbjct: 515 GYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECE 556

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  520 bits (1338), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 318/448 (70%)

Query: 52  QDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPL 111
           Q P YF  K  E  F+ +C+MGQLLNQAG+T ++S M ++  +              FPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 112 VSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGIS 171
           VSGSFIL+ GR GDIYGLKKMLLLGY  LTIWS+ICGL+ ++H+D FFI ++AFQGLG+S
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 172 FVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYA 231
           F+LPN++G+VG IY+PG+ +KNI IS IG  AP+GATFGGLF+G+VV++ D +WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 232 YTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGY 291
           + I +FL  +  YF +P+++P N N   MDWIGSA+GV GL+LF+FVWNQ+ + GW   Y
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 292 XXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYF 351
                                YA+VPLLPK +T +R IIMIL ++  GWG+FGIW FYYF
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 352 QFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILS 411
            F L LR++SPVW GG +F   + G   A  VGF IK + P+++L  S+  FT G++I +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 412 VTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSL 471
           VTP  +TY+R+  G M++L  GMDLSFPA+SIILSD+L  +YQGMAGSLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 472 FLGIGGTIERQINKSGDRLLEGFRAALY 499
            LG+  T+E+QIN SGD LL+G+RAA Y
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFY 513

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  516 bits (1328), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 266/512 (51%), Positives = 348/512 (67%), Gaps = 1/512 (0%)

Query: 27  LSREDKMLTTEKEAPVFVE-EPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTL 85
           +S ED+ +TT   +    +   +SPWQDP YF     E++F+ +CM+ QLLNQAG T  L
Sbjct: 32  ISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHAL 91

Query: 86  STMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSL 145
             M VL +  +            FPL +GSFILISGRLGDIYGLKKMLL+GY+ + IWS+
Sbjct: 92  CIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSI 151

Query: 146 ICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPI 205
           I GLS +S++D FFIT RAFQGLGI+F+LPN++G+VG++YK G+ RKN+VIS+IG CAP 
Sbjct: 152 ISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPA 211

Query: 206 GATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGS 265
           G  FGG+F G++V      WPW FYA++IA F++ +++++ IPN++P NV+  +MDW GS
Sbjct: 212 GGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGS 271

Query: 266 ALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTE 325
            L V GL+LFNFVWNQ+ + GW   Y                    KYA+VPLLP  VT+
Sbjct: 272 TLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTK 331

Query: 326 SRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGF 385
           +R +IMIL ++  GWGSFGIW FYY  F L LR+YSPVW GGT+F+  I G IAA  V F
Sbjct: 332 NRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAF 391

Query: 386 SIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIIL 445
           SIKR+GPA+LL F+++AF  GSI+ SV PV ++Y++       IL FGMDLSFPA+SIIL
Sbjct: 392 SIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIIL 451

Query: 446 SDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAXXXX 505
           SD L MQYQGMAGSLVNTV+NYS SL LG+G T+ERQINKSG  LL+G+RAA+Y      
Sbjct: 452 SDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLA 511

Query: 506 XXXXXXXXXFVLQKELMRSKSRKENELEYNGS 537
                    ++L+    + K  ++  LE   S
Sbjct: 512 SLGLLISVTYMLENFWNKHKESEKKRLEAETS 543

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  506 bits (1302), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 250/529 (47%), Positives = 334/529 (63%), Gaps = 2/529 (0%)

Query: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWD 62
           ++  +   Q T + +    ++  +  ++D++  T+ +         S WQDP YFK  W 
Sbjct: 15  EKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSI--SNNSKWQDPTYFKSSWQ 72

Query: 63  EVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGR 122
           E  F+ +CM+  LLNQAG T TLSTM VL   L+            F L SGSFIL+SGR
Sbjct: 73  EYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGR 132

Query: 123 LGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVG 182
           +GDIYGLK   + G I   IWS++CG+S ++ N TFFI  RAFQGLG++FVLPN++G+VG
Sbjct: 133 IGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVG 192

Query: 183 NIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTII 242
           NIY  G+ RKNIVIS IG  AP+G TFGG++ G++V      WPW F+A  IA F+  I+
Sbjct: 193 NIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIM 252

Query: 243 SYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXX 302
             + IPN +P N+    MDWIGS LGV GL+L NFVWNQ+ + GW+  Y           
Sbjct: 253 GIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFF 312

Query: 303 XXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSP 362
                    K A+ PLLP EVT++R I+ I+ SL  GWG+FGIW FYY+ F L LR++SP
Sbjct: 313 LVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSP 372

Query: 363 VWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRS 422
           +WAG T F+  I G + A+TV F+I +VGP+VL   S I FTCG+II SVT   +TY+R+
Sbjct: 373 LWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRN 432

Query: 423 CLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQ 482
            LG  +IL+ GMDLSFP +SIILSD L MQYQGM+GSLVNT+ NY+ SL LG+G T E Q
Sbjct: 433 SLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQ 492

Query: 483 INKSGDRLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENE 531
            N  G  +L+G+RAALY A             ++ +   +R + R++NE
Sbjct: 493 YNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNE 541

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  498 bits (1283), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 238/492 (48%), Positives = 333/492 (67%), Gaps = 5/492 (1%)

Query: 15  LKSSHENEIERNLSRED---KMLTTEKEAPVFVE--EPESPWQDPNYFKGKWDEVLFVLS 69
           LK ++  + + N S  +    + +   ++ +  E  + E+    P YFK +  E LF++S
Sbjct: 45  LKKNYSQDSQTNTSMNEVIGSISSVSNDSDINSENLQSENKVLSPKYFKNRTHEYLFIIS 104

Query: 70  CMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGL 129
           CM+ Q ++QAG T  LS M +L  EL+            F L  GSFIL+SGRLGDIYGL
Sbjct: 105 CMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGL 164

Query: 130 KKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGT 189
           KK+LL GY  LTIWSLICG SS+SHND FFITSRAFQGLG++FVLPN LG++G IY+PG+
Sbjct: 165 KKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGS 224

Query: 190 RRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPN 249
            +KN++I  +G  +PIGAT GGLFAG++  +    WPW+FY++ I +F   I+S++ IPN
Sbjct: 225 MKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPN 284

Query: 250 SIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXX 309
           +IP N+   +MDWIG+ LG+ GL++ NFV+NQ+ +VGW + Y                  
Sbjct: 285 NIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVY 344

Query: 310 XXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTF 369
             KYAK PL+PK ++ +R ++MIL +L  GWG+FG W FYYF FVL +R Y+  WAGG++
Sbjct: 345 EVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSY 404

Query: 370 FMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVI 429
           F+  + GC  A   GF +K+V P+V+L+ SMI F  G ++L+VTP+H++YF++ LG M +
Sbjct: 405 FIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFV 464

Query: 430 LSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDR 489
           L  G+DLSFPAASIILSD L +QYQGMAGSLV T+ NYS S+ LG+ G++E   N +G  
Sbjct: 465 LPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQN 524

Query: 490 LLEGFRAALYFA 501
           +L+G+R A+ FA
Sbjct: 525 ILKGYRNAMIFA 536

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  494 bits (1272), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/517 (50%), Positives = 340/517 (65%), Gaps = 6/517 (1%)

Query: 17  SSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLL 76
           SS +  I+ ++S +    ++ ++  V V E +S WQDP YFK  + E LFV SCM  QLL
Sbjct: 7   SSIKEHIQSDISIDK---SSNEKCEVIVRE-KSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62

Query: 77  NQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLG 136
           NQA +  TLS M VL    +            FPLV+GSFILISGR+GDIYGLKK L+ G
Sbjct: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122

Query: 137 YIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVI 196
           YI+L IWSLICG + +S +DTF I +RAFQGLGI+F LPN++G +GNIY  G+ RKN+VI
Sbjct: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182

Query: 197 SLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVN 256
           SLI   AP+GA  GG FAG++V    S WPW+FYA+ IA     +IS + IP++IP NVN
Sbjct: 183 SLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242

Query: 257 KFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKV 316
            F MDWIGSAL V+GL+LFNF WNQ  +VGW   Y                     +A  
Sbjct: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPS 302

Query: 317 PLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVG 376
           PL+ +E+T SR++I+ + +L  GWGS+GIW FYYF FVL LR+YSPVWAGG++F+  I G
Sbjct: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362

Query: 377 CIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDL 436
            +A+  VG SIK++   V+L FSM+ F  G+ +LSV PV ++YF+  L  M IL  G+D 
Sbjct: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422

Query: 437 SFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRA 496
           SFPAA+IILSD L M+YQGMAGSL  T+VNYSMSL LG+G T+ERQINK G  +L+G+R+
Sbjct: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482

Query: 497 ALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELE 533
           A Y                V+ K  + +K R +N ++
Sbjct: 483 AEYLGIGLSGLGLLLACILVIDK--LVAKYRNKNSIK 517

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/474 (44%), Positives = 296/474 (62%), Gaps = 1/474 (0%)

Query: 28  SREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLST 87
           S E  +  T  +   F+ E ++  + P+ FK ++ E  FVL  ++GQ L+Q G T  LST
Sbjct: 88  SFESSLSATPPDNKPFITESQN-LRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLST 146

Query: 88  MKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLIC 147
           M +L  EL             FPL  G  ILISGRLGDI+GLKK+LLLGYI  TIW+LIC
Sbjct: 147 MNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLIC 206

Query: 148 GLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGA 207
           G SS++H+D  FI SR FQGLG++  LPN+  ++G IYKP   +KN++  +IG  +PIGA
Sbjct: 207 GFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGA 266

Query: 208 TFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSAL 267
           T GG+FAG+ V     +WPW+FY++ I AFL  II++F IPN I  N     MDWIGSAL
Sbjct: 267 TLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSAL 326

Query: 268 GVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESR 327
           G+ GLV+ NFV+NQ+ + GW++ Y                      A  PL+PK +  + 
Sbjct: 327 GLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNY 386

Query: 328 SIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSI 387
            +I+IL +L  GWG F IW FYYF F L LR+YSP+WA  + F++ I G I  +    ++
Sbjct: 387 RLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAV 446

Query: 388 KRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSD 447
           +R+ P +LLFFSM+ F  G+I+ +VTP+H+T+FR+  G+M +   GM  SFP+AS++ ++
Sbjct: 447 QRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAE 506

Query: 448 ELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFA 501
            L   Y+ MAGSLVN  +NY+ S+ +G+ G+     N  G  LL GFRAA Y A
Sbjct: 507 TLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLA 560

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  334 bits (856), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/525 (37%), Positives = 292/525 (55%), Gaps = 29/525 (5%)

Query: 20  ENEIERN---LSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLL 76
           E  ++ N   L ++D++L+ E +  V  E+PES           W+     + C   QL+
Sbjct: 9   EENLDMNVETLKKDDEVLSDEFD--VQEEKPESL---------LWESAFVGVLCS-AQLM 56

Query: 77  NQAGSTMTLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILISGRLGDIYGLKKMLLL 135
            QAG   +L+ + ++                  + L  G+FILI+GRLGDI+G KK  +L
Sbjct: 57  TQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 116

Query: 136 GYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIV 195
           G+ W  +WSL+ G S +S N  FF   RAFQG+G +F+LPN + I+G  YKPG RRKN+V
Sbjct: 117 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RRKNMV 174

Query: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVN- 254
            SL G  AP G   G +F+ +  + + + WPWA++   IA FL  +  Y++IP++   N 
Sbjct: 175 FSLFGASAPGGFVLGAVFSSM--LGQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNR 232

Query: 255 -VNKFAM----DWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXX 309
            V  F +    D+ GS  GV GL+LFNF WNQ  VVGW T Y                  
Sbjct: 233 DVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFI 292

Query: 310 XXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTF 369
             + A  PLLP     S +   +L+ + AGW SFGIWIFY +QF+   R  +P+ +   F
Sbjct: 293 ESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 350

Query: 370 FMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVI 429
             V+I G  AAL  GF +    P+ ++FF+M AFT G+I+++  PVH+TY+     ++++
Sbjct: 351 SPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 410

Query: 430 LSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDR 489
           + +GMD+SFPAA+I+LSD +  ++QG+A SLVNTVVNYS+S+ LGI GTIE  +N  G  
Sbjct: 411 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAN 470

Query: 490 LLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELEY 534
           +L+G+R + Y               + +    M+SK R   +  +
Sbjct: 471 VLKGYRCSWYLGIGLSGFGIFVAATYAVST-FMKSKKRVSEKQHF 514

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  330 bits (846), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/494 (38%), Positives = 285/494 (57%), Gaps = 29/494 (5%)

Query: 16  KSSHENEIERN---LSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMM 72
            S  +  ++ N   L +EDK+L+   E  +  E P+S           W+     + C  
Sbjct: 5   SSVTQKNLDTNAEALKKEDKVLS---EFDIQDERPKSL---------LWESAFVGVLCS- 51

Query: 73  GQLLNQAGSTMTLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILISGRLGDIYGLKK 131
            QL+ QAG   +L+ + ++                  + L  G+FILI+GRLGDI+G KK
Sbjct: 52  AQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKK 111

Query: 132 MLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR 191
             +LG+ W  +WSL+ G S +S N  FF   RAFQG+G +F+LPN + I+G  YKPG RR
Sbjct: 112 FFVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-RR 169

Query: 192 KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS- 250
           KN+V SL G  AP G   G +F+ +  + + + WPWA++   IA F+  +  YFVIP++ 
Sbjct: 170 KNMVFSLFGASAPGGFFLGAVFSSM--LGQLAWWPWAYWIMGIACFVLAVAGYFVIPHTP 227

Query: 251 IPV-NVNKFAM----DWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXX 305
           +P  + + F +    D+ GS  GV GL+LFNF WNQ  VVGW T Y              
Sbjct: 228 MPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVI 287

Query: 306 XXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWA 365
                 + A  PLLP     S +   +L+ + AGW SFGIWIFY +QF+   R  +P+ +
Sbjct: 288 FAYIESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLS 345

Query: 366 GGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLG 425
              F  V+I G  AA+T GF +    P+ ++ F+M AFT G+I+++  PVH+TY+     
Sbjct: 346 SAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFV 405

Query: 426 AMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINK 485
           +++++ +GMD+SFPAA+I+LSD +  ++QG+A SLVNTVVNYS+S+ LGI GTIE ++N 
Sbjct: 406 SIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVND 465

Query: 486 SGDRLLEGFRAALY 499
            G + L+G+R + Y
Sbjct: 466 GGAKPLKGYRCSWY 479

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/472 (39%), Positives = 277/472 (58%), Gaps = 16/472 (3%)

Query: 35  TTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERE 94
           T +K+  V ++E +   QD       W E  FV      QL+ QAG   +L+ + ++ + 
Sbjct: 18  TLKKDDEVVLDEFDI--QDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKS 74

Query: 95  LDXXXXXXXX-XXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFS 153
                          + L  G+FILI+GRLGDI+G KK  +LG+ W  +WSL+ G S +S
Sbjct: 75  FGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS 134

Query: 154 HNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLF 213
            N  FF   RAFQG+G +F+LPN + I+G  YK G +RKN+V SL G CAP G   G +F
Sbjct: 135 -NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSG-KRKNMVFSLFGACAPGGFVLGAVF 192

Query: 214 AGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS-IPV-NVNKFAM----DWIGSAL 267
           + +  + + + WPWA++   IA F   I  YF+IP++ +P  + + F +    D+ GS  
Sbjct: 193 SSL--LGQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVT 250

Query: 268 GVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESR 327
           GV GL+LFNF WNQ  VVGW T Y                    + A  PLLP     S 
Sbjct: 251 GVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFPLLPFAALSSD 309

Query: 328 SIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSI 387
           +   +L+ + AGW SFGIWIFY +QF+   R  +P+ +   F  V++ G  AALT G+ +
Sbjct: 310 TA-FVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLL 368

Query: 388 KRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSD 447
            R  P+ ++ F+M AFT G+I+++  PVH+TY+     +++++ +GMD+SFPAA+I+LSD
Sbjct: 369 SRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSD 428

Query: 448 ELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALY 499
            +  ++QG+A SLVNTVVNYS+S+ LGI GTIE  +N  G + L+G+R + Y
Sbjct: 429 SMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWY 480

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/518 (37%), Positives = 286/518 (55%), Gaps = 20/518 (3%)

Query: 24  ERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTM 83
           ++NL  E    TT+ +  V + + E   QD       W E  FV      QL+ QAG   
Sbjct: 9   QKNL--ETSAETTKTDDEVLLNQFEL--QDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQ 63

Query: 84  TLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTI 142
           +++ + ++                  + L  G+FILI+GRLGDI+G +K  +LG+ W  +
Sbjct: 64  SIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYAL 123

Query: 143 WSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMC 202
           WSL+ G S +S N  FF   RAFQG+G +F+LPN + I+G  YKPG +RKN+V SL G  
Sbjct: 124 WSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPG-KRKNMVFSLFGAS 181

Query: 203 APIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPN-SIPV-NVNKFAM 260
           AP G   G +F+ +  + + + WPWA++   IA FL  +  YFVIP+  +P  +   F M
Sbjct: 182 APGGFVLGAVFSSM--LGQLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNM 239

Query: 261 ----DWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKV 316
               D+ GS  GV GL+LFNF WNQ  VVGW T Y                    + A  
Sbjct: 240 LERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAY 298

Query: 317 PLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVG 376
           PLLP     S +   +L  + AGW SFGIWIFY +QF+   R  SP+ +   F  V+I G
Sbjct: 299 PLLPFAALSSDAA-FVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISG 357

Query: 377 CIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDL 436
             AA+T GF +     + ++ F+M AFT G I+++  PVH+TY+     +++++ +GMD+
Sbjct: 358 FCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDM 417

Query: 437 SFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRA 496
           SFPAA+I+LS+ +  ++QG+A SLVNTVVNYS+S+ LGI GTIE Q+N  G   L+G+R 
Sbjct: 418 SFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRC 477

Query: 497 ALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELEY 534
           + Y               +      ++SK +K +E +Y
Sbjct: 478 SWYMGIGLSGLGIFVAAVYA-SSTFLKSK-KKASEKQY 513

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/433 (38%), Positives = 254/433 (58%), Gaps = 12/433 (2%)

Query: 73  GQLLNQAGSTMTLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILISGRLGDIYGLKK 131
            QL+ QAG   ++  ++++                  F L  G+FILI+GRLGD +G KK
Sbjct: 39  AQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKK 98

Query: 132 MLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR 191
             ++G++W  +WS++ G S +S N  FF   RAFQG+G +F LPN + I+   Y+PG R+
Sbjct: 99  FFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPG-RK 156

Query: 192 KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSI 251
           +N++ SL G CAP G   G +F+ +  + + + WPWA++   I  FL  +  Y VIP+  
Sbjct: 157 QNMIFSLFGACAPSGFVVGAVFSSL--LSEFAWWPWAYWIMGITCFLLGVAGYLVIPHHP 214

Query: 252 PVNVNKFA-----MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXX 306
           P++ ++       +D  GS  GV GL+LFNF WNQ  VVGW T Y               
Sbjct: 215 PIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAF 274

Query: 307 XXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAG 366
                + AK PLLP     S +I  ++  + AGW SFGIW++Y +Q +  LR+  P+ + 
Sbjct: 275 GFIESR-AKHPLLPVRKLSSDTI-FVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSS 332

Query: 367 GTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGA 426
             F  V+I G  AA++  F + R  P+ ++  +MIAFT GSI+++  PV +TY+     +
Sbjct: 333 AQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVS 392

Query: 427 MVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKS 486
           ++++ +GMD+SFPAA+IILS  +   +QG+A SLVNT++NYS+S+ LG  GTIE QI+  
Sbjct: 393 IIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDG 452

Query: 487 GDRLLEGFRAALY 499
            D LL+G+R A Y
Sbjct: 453 EDDLLKGYRGAYY 465

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  312 bits (799), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 180/487 (36%), Positives = 268/487 (55%), Gaps = 17/487 (3%)

Query: 21  NEIERNLSREDKML--TTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQ 78
            + E N  ++D +   +T  +     +   +  Q P    G   E  FV      QL+ Q
Sbjct: 4   TDKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLG---EAAFVGVICGAQLMTQ 60

Query: 79  AGSTMTLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILISGRLGDIYGLKKMLLLGY 137
           AG   +++ + ++                  + L  G+FILI+GRLGD+YG KK  ++G+
Sbjct: 61  AGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGF 120

Query: 138 IWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVIS 197
            W  +WSL+ G S +S N  FF   RAFQG+G + +LPN + I+G  Y PG RRK +++S
Sbjct: 121 FWYALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPG-RRKAMILS 178

Query: 198 LIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPN----SIPV 253
           L G  AP G   G +F+ +    + + WPWA++A  I  F   +    VIP      +  
Sbjct: 179 LFGATAPAGFVLGAVFSSI--FGQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDT 236

Query: 254 NVNKFA-MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXK 312
           +V+ +  +D  GS  GV GLVL NF WNQ  VVGW T Y                    +
Sbjct: 237 SVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR 296

Query: 313 YAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMV 372
            A  PLLP     S +   +L  + AGW SFGIWI+Y++ F+  LR +SP+     F  V
Sbjct: 297 -APHPLLPLSALSSDAA-FVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPV 354

Query: 373 SIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSF 432
           +I G  AALT GF I RV  ++++ F+M AFT G I+++  PV + Y+     +++++ +
Sbjct: 355 AISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPW 414

Query: 433 GMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLE 492
           GMD+SFPAA+I+LSD +  ++QG+A SLVN VVNYS+S+ LG+ GT+E ++N  G  LL+
Sbjct: 415 GMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLK 474

Query: 493 GFRAALY 499
           G+R A Y
Sbjct: 475 GYRGAWY 481

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  306 bits (784), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 258/445 (57%), Gaps = 16/445 (3%)

Query: 63  EVLFV--LSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILI 119
           E LFV  LSC   QL+ QAG   +++ ++++                  + L  G+FILI
Sbjct: 39  EALFVGILSC--AQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILI 96

Query: 120 SGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLG 179
           +GRLGD++G KK+ ++G++W ++WSL+ G S +S N  FF   RA QG+G +F+LPN + 
Sbjct: 97  AGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIA 155

Query: 180 IVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLT 239
           I+G  Y PG +RK +V S+ G  AP G   G +F+ +    + + WPWA++A   A  + 
Sbjct: 156 ILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSVFSSI--FSQLAWWPWAYWAMGTACLVL 212

Query: 240 TIISYFVIPNSIPVNVNKFA-----MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXX 294
            +    VIP + P  ++  A     +D  G+  G+ GL L NF WNQ  VVGW T Y   
Sbjct: 213 GVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYTYA 272

Query: 295 XXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFV 354
                            + A+ PLLP     S  +  +L  + AGW SFGIWIFY++QF+
Sbjct: 273 LLIVGFVFLLVFSLIESR-ARFPLLPFAAL-STDLAYVLGCIAAGWSSFGIWIFYFWQFL 330

Query: 355 LTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTP 414
              R+ SP+     F  V+I G  AALT G+ +  V    ++  +MIAFT G ++++  P
Sbjct: 331 EDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAP 390

Query: 415 VHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLG 474
           +++TY+     +++I+ +GMD+SFPAA+I++S+ +  ++QG+A SLVNTVVNYS+SL LG
Sbjct: 391 INQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALG 450

Query: 475 IGGTIERQINKSGDRLLEGFRAALY 499
             GTIE ++N  G   LEG+R A Y
Sbjct: 451 FAGTIETRVNNKGANRLEGYRGAWY 475

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  291 bits (744), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 175/491 (35%), Positives = 272/491 (55%), Gaps = 20/491 (4%)

Query: 23  IERNLSREDKML----TTEKEAPVFVEEPESPWQDPNYFKGK-----WDEVLFVLSCMMG 73
           + +   +ED+ +     TE+      E  +  +   ++ K         E  FV + +M 
Sbjct: 1   MNKKHDKEDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMA 60

Query: 74  QLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKML 133
           Q  NQAG TM L  + VL                 +P+V GSF+LI GRLG+++G K+ L
Sbjct: 61  QAFNQAGGTMILPLVNVLSDSFHGKFLLNS-----YPMVCGSFMLIGGRLGEVHGYKETL 115

Query: 134 LLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTR--R 191
           L GYI L + SL+ GLS +S +  F++  RAFQG+G++ +LPN        Y+   +  R
Sbjct: 116 LGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHR 175

Query: 192 KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSI 251
           K I+ ++IG  A  GA  G   +G+ V R +S+W WA+Y YTIAA LT  +SY+ +P++I
Sbjct: 176 KTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNI 235

Query: 252 PVNVNKFAMDWIGSALGVS-GLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXX 310
               NK  ++ +G     S GL++ N   N + V      +                   
Sbjct: 236 -TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFE 294

Query: 311 XKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFF 370
            K+++ P+  KE+  + S+ ++LAS+  GWG++GIW  Y+F+F+L LRNYSP+ AG T+ 
Sbjct: 295 LKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYL 354

Query: 371 MVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVIL 430
            + I G +A + +   +KR GP + L FS + FTC  IILSVTP+H++YFRS LG+M+ L
Sbjct: 355 TLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFL 414

Query: 431 SFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRL 490
           + G+D SFP+++IIL +EL  +Y  M   L N + NY++S + GI  +  R +  S   L
Sbjct: 415 ALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSL--SSIEL 472

Query: 491 LEGFRAALYFA 501
           ++ +R   YFA
Sbjct: 473 IKYYRYVYYFA 483

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  199 bits (507), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 134/476 (28%), Positives = 226/476 (47%), Gaps = 20/476 (4%)

Query: 2   FDRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVE-EPESPWQDPNYFKGK 60
           +D    NGG         ++  +     +D +    K AP   E +P    ++       
Sbjct: 25  YDSINFNGG---------DDSSKTRRDSDDNVSDINKSAPAPEEHDPPCTGEEATLNMSL 75

Query: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXX-XXXXFPLVSGSFILI 119
             E++FVL     Q+L  AG+   +  M V+                  +    GSF+LI
Sbjct: 76  LHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLI 135

Query: 120 SGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLG 179
           +G++GD+ G K M L+GY WL +WSL+ G S +  +  FF   RA QG+G +F   + L 
Sbjct: 136 AGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALS 195

Query: 180 IVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLT 239
           I+G  Y P  +RKN + S  G C   G   G +F+   +  + + W WA+++  IA  + 
Sbjct: 196 ILGKSYPP-CKRKNFIFSFFGACGSFGVVLGMVFSA--LFTQLAHWSWAYWSMAIACVVI 252

Query: 240 TIISYFVIPNSI---PVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXX 296
            I+S F IP  +       N F  D++G+ L V+GLVLF+  WNQ+   G+   Y     
Sbjct: 253 IILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLL 312

Query: 297 XXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLT 356
                          K    PLLP     + ++ ++LA   A + SF +W  Y F+F L 
Sbjct: 313 IVSVVILALAMYVETKVDD-PLLPWTHISANTLKVLLAIFFA-YASFTMWAAYTFRFNLM 370

Query: 357 LRNYSPVWAGGTFFMVSIVGCIAALTVGFSIK-RVGPAVLLFFSMIAFTCGSIILSVTPV 415
            +  + + A      +++ G  AAL     +   V   + +  S++AF    I+++    
Sbjct: 371 AKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGA 430

Query: 416 HETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSL 471
            +TY+       +++SFG+D+SFP+A+++LS+ +  +++G+  SLV  V+NY+ +L
Sbjct: 431 GQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATAL 486

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  186 bits (473), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 240/501 (47%), Gaps = 33/501 (6%)

Query: 26  NLSREDKMLTTEKEAPVFVEEPESPWQ------------DPNYFKGKWDEVLFVLSCMMG 73
           +    ++ LT+ K  P    EP SP +            D +    ++ E++ VL    G
Sbjct: 2   SFHESEETLTSSKLQP---HEPTSPVKVVPSHNEILSKTDEHPLNMQFKEIIIVLLISSG 58

Query: 74  QLLNQAGSTMTLSTMKVLERELDXXXXXXXX---XXXXFPLVSGSFILISGRLGDIYGLK 130
           Q ++  G+   +  M  +                    +   + +F++I+G+LGDI G K
Sbjct: 59  QFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHK 118

Query: 131 KMLLLGYIWLTIWSLICGLSSFSH-NDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGT 189
            M + GY WLT+WSL+ G S ++  N  FF   R  QG+G +F+ P  L ++G  Y P  
Sbjct: 119 NMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPP-C 177

Query: 190 RRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPN 249
           +RKN V S  G C P G   G +F+ +    + + W W +++  +   + TI+SY  IP 
Sbjct: 178 KRKNYVFSFYGACGPFGIVAGSVFSAL--FTQLTTWAWTYWSMAVTCLIITILSYIFIPK 235

Query: 250 SIPVNVNK---FAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXXXX 306
                  +   ++ D++G   G++G++LF+ VWNQ+ +  +   Y               
Sbjct: 236 DNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMA 295

Query: 307 XXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAG 366
                +  K PL+P + +   ++I  L  +  G+  F IW+FY ++F L  +N S + A 
Sbjct: 296 LIIDSR-VKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAA 353

Query: 367 GTFFMVSIVGCIAA-LTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLG 425
             F  + I G  AA  +V    K+V   + L  ++ AF   +I++S   + ETY+ +   
Sbjct: 354 AKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFV 413

Query: 426 AMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTI-----E 480
           A VI++ G+D++FP+A+++LS+ +  + QG+A +L  T +NY  +L  G+   I     +
Sbjct: 414 ATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLIITYQCD 473

Query: 481 RQINKSGDRLLEGFRAALYFA 501
             + +S  R +     A Y A
Sbjct: 474 DCLARSDGRFVHAVHIAGYVA 494

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  169 bits (429), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 195/370 (52%), Gaps = 19/370 (5%)

Query: 113 SGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSH-NDTFFITSRAFQGLGIS 171
           S   +LI+G+LGD+ G K+M++ G+IWLTIWSLI G S +   N  F+ T+RA QG+G  
Sbjct: 91  SAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSG 150

Query: 172 FVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAP----IGATFGGLFAGVVVIRKDSDWPW 227
           F++PN L I+G  Y     +K I+ S+ GM       IG TF  LFA +      + W W
Sbjct: 151 FIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQL------TKWAW 204

Query: 228 AFYAYTIAAFLTTIIS-YFVIPNSIPVNVNKFAM----DWIGSALGVSGLVLFNFVWNQS 282
            ++A      L T+ +  F+ P++I    N   +    D++G+  GVSGLVLF+  + Q+
Sbjct: 205 NYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQA 264

Query: 283 TVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGS 342
           + +GW+  +                    +    PL+P +   +  +++IL  +  G+ S
Sbjct: 265 SALGWSPPHTYITLIIGVILILIAMFVDWRVDD-PLVPLQHLRA-DVVVILICVYFGFLS 322

Query: 343 FGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAAL-TVGFSIKRVGPAVLLFFSMI 401
           F IW  +++QF   + N SP+        ++I    AA+ TV      +    ++  SM+
Sbjct: 323 FVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMV 382

Query: 402 AFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLV 461
            F   +I+++    + TY+     + +I  F +D++ P A+++ SD +  + QG+A SL+
Sbjct: 383 CFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLI 442

Query: 462 NTVVNYSMSL 471
            TV++Y++S+
Sbjct: 443 ITVISYAISI 452

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 140/529 (26%), Positives = 244/529 (46%), Gaps = 60/529 (11%)

Query: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWD 62
           D    +    ++L S    E   NL         E   P     P  P         +  
Sbjct: 24  DHYLPSNSTASSLHSQRTKEQCSNLQPAQAQDQLESMNP-----PPGP--------SRLR 70

Query: 63  EVLFVLSCMMGQLLNQAGSTMTLSTMKVL--------ERELDXXXXXXXXXXXXFPLVSG 114
           E +F++     Q ++ A ++  +  M  +        +R L+            F +  G
Sbjct: 71  ECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAA-----FAITCG 125

Query: 115 SFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSH--NDTFFITSRAFQGLGISF 172
           +FI+ +G+L D+ G K + + GY W T+WSL+ G+S ++     TFF   R  QG+G + 
Sbjct: 126 TFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAA 185

Query: 173 VLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAY 232
           + P+ L ++G  Y P  + KNIV SL G C P+G   GG+F+ +    + + W W +++ 
Sbjct: 186 LFPSSLALLGKYYPPSCK-KNIVFSLYGFCVPLGVVVGGVFSAI--FTQLAHWSWNYWSM 242

Query: 233 TI-AAFLTTIISYFVIPNSIP-----------VNVNKFAMDWIGSALGVSGLVLFNFVWN 280
            I +AF T I  +++ P+ I             ++ KF  D++G+ L V+ L+LF   WN
Sbjct: 243 AIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKF--DYLGTFLYVASLLLFAVCWN 300

Query: 281 QSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGW 340
           Q+T   + +                       Y   P++P      ++I  +L    + +
Sbjct: 301 QATGFKFKS-VQVYVTLIVSLVCFVAMVIVEFYVDDPIIPARKIHPQTIKALLVVFFS-Y 358

Query: 341 GSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSM 400
            SF IW+FY +++   +RN + +     F  +SI G IAAL   FSI  +  AV +   +
Sbjct: 359 LSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAAL---FSILLISTAVPVQIRL 415

Query: 401 IAFTC----GSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGM 456
           +A  C      I+       E+Y+      ++I+S G+D+SFP+A+++LS+ +  + +G+
Sbjct: 416 LAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGI 475

Query: 457 AGSLVNTVVNYSMSLFLGIGGT-IERQINK---SGDRLLEGFRAALYFA 501
           + +LV T +NY   +   I  T I  Q +K   SGD  ++ F  A++ A
Sbjct: 476 SAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGD--MDQFVKAIHIA 522

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  142 bits (357), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 104/190 (54%), Gaps = 34/190 (17%)

Query: 71  MMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLK 130
           MM QLLNQ G+T TL  + VL R  +             PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 131 KMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTR 190
             LL GY  + +WS ICGL+ ++ +  FF+ +RAFQGLG++FVLPN++G V N+Y  G+ 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 191 RKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS 250
           RKN+V                                  YAYT+A  L   +  + +P +
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 251 IPVNVNKFAM 260
           IP NV   AM
Sbjct: 147 IPTNVRGQAM 156

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 462 NTVVNYSMSLFLGIGGTIERQINKSG-DRLLE 492
             ++ YSM + LGI GT+E +++K G DRL E
Sbjct: 154 QAMLGYSMPMCLGIAGTVEHRVHKGGADRLGE 185

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/453 (24%), Positives = 205/453 (45%), Gaps = 68/453 (15%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSF-SHNDTFFITSRAFQG 167
           F +  G+FI+++G+L DI   + + + GY+W ++W+LI G +S+   N  F    R  QG
Sbjct: 120 FAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQG 179

Query: 168 LGISFVLPNLLGIVGNIYK------------------PGTRR------------------ 191
           +G + + P+ L ++   Y                   P                      
Sbjct: 180 IGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSI 239

Query: 192 ----------KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTI 241
                     K+I  SL G CAP+G   GG+F+ +    + + WPW +++ +I   L +I
Sbjct: 240 ADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAI--FTQLATWPWNYWSMSIVTTLLSI 297

Query: 242 ISYFVIPNSIPV-----NVNKFA----MDWIGSALGVSGLVLFNFVWNQSTVVGWATGYX 292
           +SYF +   IPV     N N        D++G  LG+S L+LF   W+Q+T+  + T + 
Sbjct: 298 LSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHV 357

Query: 293 XXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQ 352
                               Y   P++P       +I  +L    + + SF  W+FY ++
Sbjct: 358 YLTLLFSLVSFIAMIIWEY-YFNNPIIPIRQIHPGTIKALLVVFFS-YISFTQWLFYTWK 415

Query: 353 FVLTLRNYSPVWAGGTFFMVSIVGCIAA-LTVGFSIKRVGPAVLLFFSMIAFTCGSIILS 411
               +++ SP+     F  +S+ G I+A  ++   +KRV   + L     +F    I+L 
Sbjct: 416 LFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLL 475

Query: 412 VTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSL 471
              +  +Y+     +++ +S G+D+SFP+A+++L++ +  + QG+  +LV +V+NY  ++
Sbjct: 476 TCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAI 535

Query: 472 FLGIGGTI-----ERQINKSGDR--LLEGFRAA 497
              I  TI     E  ++   D+   L+G   A
Sbjct: 536 GPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIA 568

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 108/245 (44%), Gaps = 14/245 (5%)

Query: 7   VNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLF 66
           + G  V +L  +   E+    S  D    T+ E P  V   E+P+    + + KW  V  
Sbjct: 45  LKGDNVNSLSRTTTREVRATPSESDLDTYTDAETPDKVS-CETPYTLMTHGQ-KWFMVAL 102

Query: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDI 126
           + S   G   +  GS +    +K LE+  +            + +  G    ISG L D+
Sbjct: 103 LTS---GGFWSSLGSPIYYPALKQLEQVFNINEEMVNITVVVYFIFQGVAPTISGGLADV 159

Query: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186
           YG + ++L G +   + S+  GL+  S++    +  R  Q  GIS ++    G+VG+ + 
Sbjct: 160 YGRRPIILAGMLIYVVASI--GLAC-SNSYGVIVFLRCVQSAGISPLIAISSGVVGD-FT 215

Query: 187 PGTRRKNIVISLIGMCAPIGATFGGLF-AGVVVIRKDSDWPWAFYAYTIAAFLTTIISYF 245
             + R + V ++ G  A +G  FG L  AG+       DW   F+  TI      +I++F
Sbjct: 216 TKSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAY---DWRAIFWFLTIGCGTCFVINFF 271

Query: 246 VIPNS 250
           ++P +
Sbjct: 272 LLPET 276

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 93/392 (23%), Positives = 143/392 (36%), Gaps = 38/392 (9%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGI 170
           L S +F  + G+L DI+G + +L+   +   + +LICG+S    N    +  R   G+G 
Sbjct: 186 LSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK---NLWVLVLGRFVAGIG- 241

Query: 171 SFVLPNLLGIVGNIYKPGTRR---KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPW 227
              L ++  I      P   R   + I     G+    G   GGLFA   V      W  
Sbjct: 242 GGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFADRAV-----GWRM 296

Query: 228 AFYAYTIAAFLTTIISYFVIPNSIPVNVNKFA-------------MDWIGSALGVSGLVL 274
           AF        L+T      +    PV+ +K A             +DW G+   V  L  
Sbjct: 297 AFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFC 356

Query: 275 FNFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILA 334
           F  V    ++ G    +                      A  P+LP    E+RS++    
Sbjct: 357 FTLV---CSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLENRSVLAASL 413

Query: 335 S---LMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVG 391
           S    M G  + G +I  Y+  VL   N  P   G             +L  G+ +KR G
Sbjct: 414 SNWFCMMGMMTTGFYIPVYYASVL---NMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTG 470

Query: 392 PAV--LLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDEL 449
                LL F ++       I  VTP   T+ + CL   +I  FG  +      + L   +
Sbjct: 471 KYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCL--YMIPGFGSAVLLTVTLLALIVAV 528

Query: 450 SMQYQGMAGSLVNTVVNYSMSLFLGIGGTIER 481
             ++Q    S+     +   +L + IGG I R
Sbjct: 529 PQRHQAATTSISYAFRSTGSTLGVSIGGAIFR 560

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 115/551 (20%), Positives = 199/551 (36%), Gaps = 78/551 (14%)

Query: 45  EEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXX 104
           +   S +Q+ ++ +   + VL ++SC    L+N    T  LS  + +E            
Sbjct: 10  DSIRSNFQNISFHR-YINLVLIMVSCAF-DLINV---TAVLSATRDIENTYQIEFTTASW 64

Query: 105 XXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRA 164
               + +    FI   GR+GDI G   + +      +I SLIC +    +N   F   RA
Sbjct: 65  ALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAV---VNNFGTFAVFRA 121

Query: 165 FQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATF--GGLFAGVVVIRKD 222
            QG+  + ++P+   ++  +      +    I   G     G  F  GG F    +    
Sbjct: 122 LQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTLTRI---- 177

Query: 223 SDWPWAFYAYTIAAFLTTIISYFVI---PNSIPVNVNK---------FAMDWIGSALGVS 270
             +   FY       + +IISYF I    N  P   +           ++D+IGS + +S
Sbjct: 178 -GYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFIS 236

Query: 271 GLVLFNF-------VWNQ-STVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVP----- 317
             +L           W + S  V    G                     K A  P     
Sbjct: 237 STILIVVGLTEGGESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNY 296

Query: 318 ------LLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFM 371
                 L+PK+V   ++ I I  ++ A +G     ++   Q+   +   SP+ A      
Sbjct: 297 FRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLP 356

Query: 372 VSIVGCIAALTVGFSIKRVGP---AVLLFFSMIAFTCGSIILSVTPVH----ETYFRSCL 424
           + +   I  + +      + P    VL FF M     GSIIL    +H      Y++   
Sbjct: 357 LVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFI---GSIIL--IQLHLITDNLYWKIFF 411

Query: 425 GAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTV----VNYSMSLFLGIGGTIE 480
            +  +++FG  + FP +  IL      +Y+G+A  ++ T     V  + S+   I G I 
Sbjct: 412 CSQSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNIN 471

Query: 481 RQINKSGDRLL--EGFRAALYFAXXXXXXXXXXXXXFVLQ--------------KELMRS 524
               KSG   +    F+   YF              FV +              +E+ R 
Sbjct: 472 ELSGKSGSAGIYKTRFQNCTYFTLASSVVGLISTAFFVKENKPTDDTGSLSTICEEVARG 531

Query: 525 KSRKENELEYN 535
           +++ E+ +  N
Sbjct: 532 ETKDESSIYQN 542

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 103/234 (44%), Gaps = 20/234 (8%)

Query: 23  IERNLSRE---DKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQA 79
           + R  +RE   D + ++++E      E  SP+    Y K KW  V  +  C     L   
Sbjct: 50  LSRATTREIDGDSLQSSDEEKNEQASESTSPYTLLTY-KQKWGMVALLTMCGFWSSL--- 105

Query: 80  GSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIW 139
           GS +    ++ LE++              + L  G    ISG L D++G + ++L+G + 
Sbjct: 106 GSPIYYPALRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLI 165

Query: 140 LTIWSLICGLS-SFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISL 198
             + S+  GL+ + S+    F+  R  Q +GIS  +    G+VG+ +     R   V + 
Sbjct: 166 YVVASI--GLACAPSYGVIVFL--RIIQSIGISPTIAISSGVVGD-FTLKHERGTFVGAT 220

Query: 199 IGMCAPIGATFGGLFAGVVVIRKDSDWPWA--FYAYTIAAFLTTIISYFVIPNS 250
            G+   +G  FG L   V+     + W W   F+  TI    + II++ ++P +
Sbjct: 221 SGLVL-LGQCFGSLIGAVLA----AAWNWRAIFWFLTIGCGTSFIIAFLLLPET 269

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 87/195 (44%), Gaps = 12/195 (6%)

Query: 57  FKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSF 116
           +K KW  V  ++ C     L   GS +    ++ LE+E +            + L  G  
Sbjct: 97  YKQKWGMVFLLVMCGFWSSL---GSPIYYPALRQLEKEFNMDENKVNVTVVVYLLFQGIA 153

Query: 117 ILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLGISFVLP 175
             +SG L D++G + ++L G +   + S+  GL+ + S+    F+  R  Q +GIS  + 
Sbjct: 154 PTVSGGLADVFGRRPIILGGMVIYVVASI--GLACAPSYGVICFL--RCIQSIGISPTIA 209

Query: 176 NLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIA 235
              G+VG+ +     R   V +  G+   +G  FG L   V+  R   DW   F+   I 
Sbjct: 210 ISSGVVGD-FTLKHERGTFVGATSGLVL-LGQCFGSLIGAVLTAR--WDWRAIFWFLAIG 265

Query: 236 AFLTTIISYFVIPNS 250
           + +  I++ F +P +
Sbjct: 266 SGVALIVAAFTLPET 280

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 105/245 (42%), Gaps = 24/245 (9%)

Query: 14  ALKSSHENEIERNL-------SREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLF 66
            L  +   EIE +L       S +DK+  T++       E ++P+   +Y + KW  V  
Sbjct: 51  TLSKTTTREIEGDLDSETSSHSSDDKVDPTQQ----ITAETKAPYTLLSYGQ-KWGMVAI 105

Query: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDI 126
           +  C      +  GS +    ++ LE++ +            + L  G    +SG L D 
Sbjct: 106 LTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADC 162

Query: 127 YGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIY 185
           +G + ++L G +   I S+  GL+ + S+    F+  R  Q +GIS  +    G+VG+ +
Sbjct: 163 FGRRPIILAGMLIYVIASI--GLACAPSYGVIIFL--RCIQSIGISPTIAISSGVVGD-F 217

Query: 186 KPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYF 245
                R   V +  G    +G  FG L   V+  R   DW   F+  TI      +I++ 
Sbjct: 218 TLKHERGTFVGATSGFVL-LGQCFGSLIGAVLTAR--WDWRAIFWFLTIGCGSCFLIAFL 274

Query: 246 VIPNS 250
           ++P +
Sbjct: 275 ILPET 279

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 109/258 (42%), Gaps = 25/258 (9%)

Query: 3   DRAAVNGGQVTA---LKSSHENEIERNLSRE------DKMLTTEKEAPVFVEEPESPWQD 53
           ++  + GG V +   L  +   EIE +L  E      D  +  +++      E  +P+  
Sbjct: 37  EKLNLEGGYVNSHGTLSKATTREIEGDLESETSSHSGDDKIDPQQQ---ITAETGAPYTL 93

Query: 54  PNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVS 113
            +Y + KW  V  +  C      +  GS +    ++ LE++ +            + L  
Sbjct: 94  LSYGQ-KWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQ 149

Query: 114 GSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLGISF 172
           G    ISG L D +G + ++L G +   + S+  GL+ + S+    F+  R  Q +GIS 
Sbjct: 150 GVSPTISGGLADCFGRRPIILAGMLIYVVASI--GLACAPSYGVIIFL--RCIQSIGISP 205

Query: 173 VLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAY 232
            +    G+VG+ +     R   V +  G    +G  FG L   V+  R   DW   F+  
Sbjct: 206 TIAISSGVVGD-FTLKHERGTFVGATSGFVL-LGQCFGSLIGAVLTARW--DWRSIFWFL 261

Query: 233 TIAAFLTTIISYFVIPNS 250
           TI      +I++ V+P +
Sbjct: 262 TIGCGSCFLIAFLVLPET 279

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 117/289 (40%), Gaps = 37/289 (12%)

Query: 4   RAAVNGGQVTALKSSH---------ENEIERNLSRE-----DKMLT----TEKEAPVFVE 45
           RA++ G  + A   +          E+ + R ++RE     D ++T     E+  P   +
Sbjct: 3   RASIRGTDLQADTETKKKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESFPDGSK 62

Query: 46  EPESPWQDPNY----FKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXX 101
           + +   +D  Y    ++ KW  V  + S       +  GS +    +K LE E D     
Sbjct: 63  QEQLSEEDVPYTLLTYRQKWFMVALLTS---AGFWSSLGSPIYYPALKELEAEFDVNEEL 119

Query: 102 XXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFI 160
                  + L  G    ISG L D+YG + ++LLG +   I S+  GL+ S S+    F+
Sbjct: 120 INITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVIASI--GLACSKSYGAVVFL 177

Query: 161 TSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIR 220
             R  Q  GIS ++    G+ G+ +   + R   V ++ G    +G  FG L    +   
Sbjct: 178 --RCLQSAGISPIIAINSGVAGD-FTVKSERGTFVGAVSGFTL-MGQAFGSLIGAALT-- 231

Query: 221 KDSDWPWAFYAYTIAAFLTTIISYFVI---PNSIPVNVNKFAMDWIGSA 266
              DW   F+   I      II  F++     +I  N++     WI  A
Sbjct: 232 AAYDWRAIFWFLVIGCGTCMIILCFLLIETKRTIVGNLSIRPKSWINIA 280

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 101/479 (21%), Positives = 170/479 (35%), Gaps = 61/479 (12%)

Query: 65  LFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLG 124
           L  L C    LLN A     +S +  L ++ D            + +    FI   GRLG
Sbjct: 33  LIFLGCTF-DLLNVAS---MISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLG 88

Query: 125 DIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNI 184
           DI G   +  +   +  I SL+C +     N   F   RA QG+  + ++P    ++  +
Sbjct: 89  DIVGNSILFTVSCFFFAILSLLCAVMP---NFPAFAVFRAIQGISAAGLVPCAYALIPML 145

Query: 185 YKPGTRRKNIVISLIGMCAPI--GATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTII 242
                 +K   I   G  + I  G   GG FA   +      +   FY      FL +I+
Sbjct: 146 APEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKI-----GYKGIFYLTFAVMFLISIV 200

Query: 243 SYFVI---------PNSIPVNVNKFAMDWIGSALGVSGLVLF-------NFVWNQSTV-- 284
           ++F           P          ++D+IGS + V+G +L           WN+     
Sbjct: 201 AFFFTYGVENLSEPPRKDQATNRVRSLDFIGSLIFVTGSILIVVGLTEGGESWNRPATYV 260

Query: 285 ------------VGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLL-PKEVTESRSIIM 331
                         W   Y                     + KV LL P +V   ++ I 
Sbjct: 261 TLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRY----FEKVQLLIPVDVLFMKNFIP 316

Query: 332 ILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVG 391
           I+ +           I+   Q+       SP++AG     + I   I      F   ++ 
Sbjct: 317 IVLAFALNNACLFSCIYIIDQYSQYEEKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLK 376

Query: 392 PAVLLFFSMIAFTCGSIILSVTPVH----ETYFRSCLGAMVILSFGMDLSFPAASIILSD 447
           P V +         GSIIL  T +H    + +++    +  ++ FG+ + +P A  I   
Sbjct: 377 PKVGVVLGFSLALAGSIIL--TQLHLIKEDMFWKIFFSSQALVGFGVAIFYPYALQIAVG 434

Query: 448 ELSMQYQGMAGSLVNTV----VNYSMSLFLGIGGTIERQINKSG--DRLLEGFRAALYF 500
               + +G+A  +  T     +  + S+   + G I+    KSG   +   GF+   YF
Sbjct: 435 GAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNIDGIRGKSGASQKFRTGFQNCTYF 493

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 99/423 (23%), Positives = 168/423 (39%), Gaps = 75/423 (17%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLG 169
           L S +F  I G++ DI+G K +L+   I   + SLICGLS SF      ++ +  F    
Sbjct: 167 LSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFE-----WLVAGRFIAGI 221

Query: 170 ISFVLPNLLGIVGNIYKPGTRR---KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWP 226
               + ++  I  +   P   R   + I     G+   +G   GG F+      +   W 
Sbjct: 222 GGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSD-----RSVGWR 276

Query: 227 WAFYAYTIAAFLTT--IISYFVIPNS-----IPVNVNKF--------AMDWIGSALGVSG 271
            +F      AF +T  II +  +P       + V+ N F        A+DWIG+   V  
Sbjct: 277 MSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLV-- 334

Query: 272 LVLFNFVWNQS---TVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRS 328
           L LF+F+   S     + + +                      K AK P+LP    + RS
Sbjct: 335 LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRS 394

Query: 329 IIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMV-SIVG----------C 377
              +L S ++ W        +    ++T+  Y P++  G   M  + +G           
Sbjct: 395 ---VLGSSLSNW--------FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTA 443

Query: 378 IAALTVGFSIKRVGPA---VLLFFSMIAFTCGSII-----LSVTPVHETYFRSCLGAMVI 429
             +L  G+ +K+ G     V+ F  + +  C  I+     +SV   +   F   LGA V+
Sbjct: 444 FGSLGAGYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVL 503

Query: 430 LSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDR 489
           ++  + L+  AA       +   +Q +  S+     +   +L + IGG I R+   S D 
Sbjct: 504 ITVAL-LAMIAA-------VPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRE---SLDN 552

Query: 490 LLE 492
           LL+
Sbjct: 553 LLK 555

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 103/242 (42%), Gaps = 25/242 (10%)

Query: 10  GQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLS 69
           G + +  SSH  +++ + +++   +TTE  AP  +            +  KW  V  +  
Sbjct: 61  GDLESETSSHSGDVKGDSTQQ---ITTEIGAPYTLLS----------YGQKWGMVAILTM 107

Query: 70  CMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGL 129
           C      +  GS +    ++ LE++ +            + L  G    +SG L D +G 
Sbjct: 108 C---GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGR 164

Query: 130 KKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPG 188
           + ++L G +   + S+  GL+ + S+    F+  R  Q +GIS  +    G+VG+ +   
Sbjct: 165 RPIILAGMLIYVVASI--GLACAPSYGVIIFL--RCIQSIGISPTIAISSGVVGD-FTLK 219

Query: 189 TRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIP 248
             R   V +  G    +G  FG L   V+  R   DW   F+  TI      +I++ ++P
Sbjct: 220 HERGTFVGATSGFVL-LGQCFGSLIGAVLTARW--DWRSIFWFLTIGCGSCFLIAFLILP 276

Query: 249 NS 250
            +
Sbjct: 277 ET 278

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 73/163 (44%), Gaps = 6/163 (3%)

Query: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDI 126
           VL+ +MG  L+   +T+  + +  +  +LD            + L   +F  + G+L DI
Sbjct: 44  VLALLMGSFLSALDTTIVATLLPTIASDLDASSQMSWIATA-YLLSCSAFQPLYGKLSDI 102

Query: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186
           +G K +L+L  +   +   ICG S +++N     T R   G+G       L  I  +   
Sbjct: 103 FGRKILLILSNLTFALGCAICG-SPWTNNVWVLSTGRFVAGIG-GGGQATLSTITTSDII 160

Query: 187 PGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAF 229
           P  R++ +   L+ +C  +G   G +     V+++   W WAF
Sbjct: 161 P-LRKRGVYQGLVNICFSLGCASGSVLGA--VLQQGIGWRWAF 200

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 102/264 (38%), Gaps = 21/264 (7%)

Query: 16  KSSHENEIERNLSRE---------DKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLF 66
           K S + EIE  LS E         +K    E+  P+  E P + +     F      V+F
Sbjct: 84  KISTKIEIENKLSNEFAYSTETEIEKQSVPEQAVPITEEIPYTKFTKAQQF------VIF 137

Query: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDI 126
            +   +G L    G+ + +  + +L+ E              F  +     L+ G   D 
Sbjct: 138 CIIVYIGFLGPMCGN-IYIPALPILQEEFQVTTTTINGTVSIFMGLFAFMPLVWGMFADF 196

Query: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186
            G K + ++     T+ +++  L+S   N       R  Q +G S  +    G V +I  
Sbjct: 197 GGRKFLYIISLFIFTVANIL--LASLPANIIALYLVRVLQVVGASAAISLGTGTVADISP 254

Query: 187 PGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFV 246
           P  R K++ + ++G    +G     + AG++++  +  W W F    I   +  +I   +
Sbjct: 255 PKHRGKSVALFMLG--PNMGPIIAPIIAGLILMNSN-QWRWLFGFSAICTGVALMIVIVI 311

Query: 247 IPNSIPVNVNKFAMDWIGSALGVS 270
           +P ++   V      W  S  G S
Sbjct: 312 LPETLRCIVGNNDPKWSRSQRGTS 335

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 79/171 (46%), Gaps = 21/171 (12%)

Query: 116 FILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLP 175
           FI   GR+GDI G   M+ +  +   I+SL+C +     N   F   RAFQG+  + ++P
Sbjct: 74  FIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCAVVP---NFIAFTVFRAFQGMAGAGIVP 130

Query: 176 NLLGIVGNIYK-PGTRRK-NIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYT 233
               +V  +++ P  +R  +I+ S+I   A +G   GG F    +  K      +F+ + 
Sbjct: 131 CAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGAFGETALGYK------SFFYFL 184

Query: 234 IAAFLTTIISYFVIPNSIPVNVNK----------FAMDWIGSALGVSGLVL 274
            AA L T     V+     + +N+          + +D IG  L +SG +L
Sbjct: 185 FAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFISGSIL 235

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 101/245 (41%), Gaps = 14/245 (5%)

Query: 7   VNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLF 66
           ++G    A     E ++E   S        +   P+   E  +P+   +Y + KW  V  
Sbjct: 48  IHGTLSKATTREIEGDLESETSSHSGDDKLDPSLPI-TTETGAPYTLLSYGQ-KWGMVAV 105

Query: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDI 126
           +  C      +  GS +    ++ LE+E +            + +  G    + G L D 
Sbjct: 106 LTMC---GFWSSLGSPIYYPALRQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADC 162

Query: 127 YGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIY 185
           +G + ++L G +   + S+  GL+ + S+    F+  R  Q +GIS  +    G+VG+ +
Sbjct: 163 FGRRPIILGGMLVYVVASV--GLACAPSYGVIIFL--RCVQSIGISPTIAISSGVVGD-F 217

Query: 186 KPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYF 245
                R   V +  G    +G  FG L   V+  R D  W   F+  TI      +I++F
Sbjct: 218 TLKHERGTFVGATSGFVL-LGQCFGSLIGAVLTARWD--WRSIFWFLTIGCGTCFLIAFF 274

Query: 246 VIPNS 250
           ++P +
Sbjct: 275 ILPET 279

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 74/171 (43%), Gaps = 7/171 (4%)

Query: 80  GSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIW 139
           GS +    +K LE++ +            + +  G    ISG L D+YG + ++L+G + 
Sbjct: 102 GSPIYYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLI 161

Query: 140 LTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLI 199
               S+  GL+  S +    +  R  Q  GIS ++    G+VG+ +     R   V ++ 
Sbjct: 162 YVCASI--GLAC-SQSYGVIVFLRCLQSAGISPIIAINSGVVGD-FTLKHERGTFVGAVS 217

Query: 200 GMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS 250
           G    +G  FG L    +      DW   F+  TI      II++ ++P +
Sbjct: 218 GFTL-MGQAFGSLIGAALT--AAFDWRAIFWFLTIGCGTCMIINFLILPET 265

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 102/253 (40%), Gaps = 13/253 (5%)

Query: 1   MFDRAAVNGGQVTALKSSHENEIERNLSRE---DKMLTTEKEAPVFVEEPESPWQDPNYF 57
           +++ +      VT  K+     +    +RE      L +++   +  E           +
Sbjct: 28  LYNDSDDKNDSVTHSKADLHGTLSHTRTRELSCSSDLESQQSHDINSENSNKVPHSLFTY 87

Query: 58  KGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFI 117
             KW  V  +  C      +  GS +    +K LE++ D            + +  G   
Sbjct: 88  NQKWMMVGVLTMC---GFWSSLGSPIYYPALKQLEKQFDVDENMVNVTVVVYLIFQGLSP 144

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
              G L D++G + ++L G +  T+ S+  GL+  S++    +  R  Q  GIS  +   
Sbjct: 145 TFCGGLADLFGRRPVILTGMLIYTVASI--GLAC-SNSYGVIVFLRCLQSAGISPTISIS 201

Query: 178 LGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAF 237
            G VG+ +   + R   V ++ G+   +G  FG L    +      +W   F+  TI   
Sbjct: 202 SGAVGD-FTVKSERGTFVGAVSGLVL-LGQAFGSLIGAALA--ASFNWRAIFWFLTIGCG 257

Query: 238 LTTIISYFVIPNS 250
           ++ ++++FV+P +
Sbjct: 258 VSMMVAFFVLPET 270

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 94/241 (39%), Gaps = 16/241 (6%)

Query: 15  LKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNY----FKGKWDEVLFVLSC 70
           LK +  +   R L  +D  + T  +  +   + E+    P +    +  KW  V  +  C
Sbjct: 48  LKGTLSHTTTRELHSDDSSIDTSLDGELSTPDEEAQEHTPPHSMLSYWNKWGMVAVLTMC 107

Query: 71  MMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLK 130
                L   GS +    +K LE++ +            + +  G    +SG L DIYG +
Sbjct: 108 GFWSSL---GSPIYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRR 164

Query: 131 KMLLLGYIWLTIWSL-ICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGT 189
            ++L G +   + S+ I   +S+       I  R  Q  GIS ++    G VG+ +    
Sbjct: 165 PVILFGMLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAISSGAVGD-FTVKA 219

Query: 190 RRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPN 249
            R   V ++ G+   +G  FG L    +      +W   F+   I       I+  V+P 
Sbjct: 220 ERGTFVGAVSGLVL-MGQAFGSLIGAALAAAY--NWRAIFWFLAIGCGACMAIAGIVLPE 276

Query: 250 S 250
           +
Sbjct: 277 T 277

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 95/236 (40%), Gaps = 15/236 (6%)

Query: 15  LKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQ 74
           L  +   E+E +       + T K++  +V    +P+   +Y + KW  V  +  C    
Sbjct: 61  LSRTQTREVEESDLESADDVKTIKDSQEYV----APYTLFSYSQ-KWIMVGLLTMC---G 112

Query: 75  LLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLL 134
             +  GS +    ++ LE++ D            + L  G    + G L DIYG + ++L
Sbjct: 113 FWSSLGSPIYYPALRQLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVIL 172

Query: 135 LGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNI 194
            G +   + S+    ++ S+    F+  R  Q  GIS ++    G VG+ +     R   
Sbjct: 173 FGMLVYIVASIALACAN-SYGVIIFL--RCLQSCGISPIIAISSGCVGD-FTMKAERGTF 228

Query: 195 VISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS 250
           V ++ G+   +G  FG L    +      DW   F+   I A     +   V+P +
Sbjct: 229 VGAVSGLVL-LGQAFGSLIGAALA--AAWDWRAIFWFLAIGAGCCLFVGILVLPET 281

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 83/192 (43%), Gaps = 13/192 (6%)

Query: 60  KWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILI 119
           KW  V  +  C +    N +     LS   ++ +E              F +  G    +
Sbjct: 79  KWSIVTVIFVCQLSMNFNGSVYPHALS---LISKEFHVSSQAANTSQMIFKVAYGFGCEL 135

Query: 120 SGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL-L 178
                + YG + ++ L   +  IW ++ G +    N    I +R F G GIS    ++ L
Sbjct: 136 WAPWSEEYGRRNIMQLSLFFTNIWQILGGKAP---NFGTIIVAR-FLG-GISQAGGSVTL 190

Query: 179 GIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFL 238
           G+V ++++P  +     ++ + + + +GA  G +F G+  + +   W W F+   I   +
Sbjct: 191 GVVADMWQP--QDHGYAVAYVVLASVLGAVIGPVFGGL--MEEHLSWHWNFWIQLIFGGV 246

Query: 239 TTIISYFVIPNS 250
           T ++ +F++P +
Sbjct: 247 TQLLHFFLVPET 258

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 74/171 (43%), Gaps = 7/171 (4%)

Query: 80  GSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIW 139
           GS +    +K LE++              + +  G    ISG L D+YG + ++L+G + 
Sbjct: 102 GSPIYYPALKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLI 161

Query: 140 LTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLI 199
               S+  GL+  S++    +  R  Q  GIS ++    G+VG+ +     R   V ++ 
Sbjct: 162 YVCASI--GLAC-SNSYGVIVFLRCLQSAGISPIIAINSGVVGD-FTVKQERGTFVGAVS 217

Query: 200 GMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS 250
           G    +G  FG L    +      DW   F+  TI      ++++ ++P +
Sbjct: 218 GFTL-MGQAFGSLIGAALT--AAFDWRAIFWFLTIGCGTCMLVNFLLLPET 265

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 98/237 (41%), Gaps = 27/237 (11%)

Query: 318 LLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGC 377
           L+P++V    + I I    +   G     I+   Q+   +   SP+ AG     V +V  
Sbjct: 310 LIPRDVLFMTNFIPITLGFLCNGGCLYSNIYIIDQYSQYVDKNSPLLAG-----VKLVPL 364

Query: 378 IAALTVGFSI---------KRVGPAVLLFFSMIAFTCGSIIL-SVTPVHET-YFRSCLGA 426
           I  + +G +I          R+G A L F SM+   CGSIIL  +  V E  Y++    +
Sbjct: 365 IITMVIGNTICASKSVKLRPRIGVA-LGFLSMV---CGSIILIQLHLVEENLYWKIMFCS 420

Query: 427 MVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTV----VNYSMSLFLGIGGTIERQ 482
            +++ FG  + +P A  ++  +     +G+A  +  T     +  + S+ + + G I + 
Sbjct: 421 QILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVSVLGNITQV 480

Query: 483 INK--SGDRLLEGFRAALYFAXXXXXXXXXXXXXFVLQKELMRSKSRKENELEYNGS 537
            ++  S +R  +GF+   YF              FV          +    LE NGS
Sbjct: 481 KSRPDSFERFRDGFQKCTYFTLASGAFGLVLTTFFVRGPRFSNGSPKDATALE-NGS 536

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 80/203 (39%), Gaps = 14/203 (6%)

Query: 52  QDPNYFK-GKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFP 110
             P Y + G+ ++ L ++ C      +     +    + V+E++ +            + 
Sbjct: 87  DSPPYSRFGRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKFNITEELVNITVVVYF 146

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGI 170
           +  G      G L D  G + ++L     + ++   C   + S N T  +  R  Q  GI
Sbjct: 147 IFQGLAPSFMGGLADSLGRRPVVLFS---ILVYCCACIGLALSQNYTQIVVLRCLQAAGI 203

Query: 171 SFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLF-AGVVVIRKDSDWPWA- 228
           S V+    GI G+I     R     +  +     IG+ FG L  AG+      S W W  
Sbjct: 204 SPVIAINSGICGDITTRAER--GAYVGYVSGFIVIGSAFGALIGAGL-----SSTWGWRS 256

Query: 229 -FYAYTIAAFLTTIISYFVIPNS 250
            F+  TI + +  +IS  V+P +
Sbjct: 257 IFWFLTIGSGICLMISIIVLPET 279

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 76/176 (43%), Gaps = 27/176 (15%)

Query: 116 FILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLP 175
           FI   GRLGDI G   +  +     T++SL+C +     +   F   RA QG+  + ++P
Sbjct: 79  FIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAV---VRDFPTFAVFRALQGISAAGIVP 135

Query: 176 NLLGIVGNIYKPGTRRKNIVISLIGMCAPIG-------------ATFGGL----FAGVVV 218
               ++  + +P   +K   I   G  + IG               + G+    FAG++V
Sbjct: 136 CGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFYLSFAGMLV 195

Query: 219 IRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVL 274
           +   +    +FY Y I       +    IP+  P      ++D++GS + VSG VL
Sbjct: 196 VSIAA----SFYTYRIEERKFLEVKVEDIPHDHP---KVASLDFVGSLIFVSGSVL 244

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 80/192 (41%), Gaps = 13/192 (6%)

Query: 62  DEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISG 121
            ++L V+ C      +    ++    + V+E++ +            + +  G    I G
Sbjct: 63  QKMLLVVQCAFTGFFSTVAGSIYYPVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMG 122

Query: 122 RLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIV 181
            L D +G + ++L  +  LT      GL+S SHN    +  R  Q  GIS V+    GI+
Sbjct: 123 GLADTFGRRPVVL--WAVLTYCCACIGLAS-SHNYAQILALRCLQAAGISPVIAINSGIM 179

Query: 182 GNIYKPGTRRKNIVISLIGMCAPIGATFGGLF-AGVVVIRKDSDWPWA--FYAYTIAAFL 238
           G++     R     + L+     +G  FG L  AG+      S W W   F+   I + +
Sbjct: 180 GDVTTKVER--GGYVGLVSGFQVVGTAFGALIGAGL-----SSRWGWRAIFWFLAIGSGI 232

Query: 239 TTIISYFVIPNS 250
             ++S  ++P +
Sbjct: 233 CLVVSALLLPET 244

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 84/230 (36%), Gaps = 66/230 (28%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L +  F L+ GRL  I GLK  L    +   I SLI  +   S++    I  R   G 
Sbjct: 51  YALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAV---SNSMGMIIGGRVVAGC 107

Query: 169 GISFVLPNLLGIVGNIYKPGT-----RRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDS 223
           G S       GI   ++  GT     R + +VI+++G+   +    G +  G     ++ 
Sbjct: 108 GGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGG--AFTENV 158

Query: 224 DWPWAFY--------AYTIAAFLTTIISYFVIPNSI------------------------ 251
            W W FY        A T+  F     SY     S+                        
Sbjct: 159 SWRWCFYINLPIGGVALTMLTF-----SYNTTEKSVQETLTYNCRQLQTYRYGQWVTASF 213

Query: 252 ---PVNVNKFAMDWIGSALGVSGLVLF---------NFVWNQSTVVGWAT 289
                N   F +D+IG AL  +G VLF          + WN  T++ + T
Sbjct: 214 WRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLT 263

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 84/219 (38%), Gaps = 52/219 (23%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L +  F+L+ GRL +I G  + L++  I   + SLI   S+ S++    I+ R   G 
Sbjct: 52  YALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLI---SALSNSMGTLISGRLIAGF 108

Query: 169 GISFVLPNLLGIVGNIYKPGTRRKNIVISLIG---MCAPIGATFGGLFAGVVVIRKDSDW 225
           G S +  +L  +VG        R  ++ +L     +   +G   GG F       +   W
Sbjct: 109 GGSGI-ESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAF------NEHLSW 161

Query: 226 PWAFY--------AYTIAAFLTT----------------IISYF---VIPNSI---PVNV 255
            W FY        A  I AF  T                I+SY    V   S       V
Sbjct: 162 RWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWKKAFKV 221

Query: 256 NKFAMDWIGSALGVSGLVLF---------NFVWNQSTVV 285
             F +D IG  L  +G  L          NF WN ST++
Sbjct: 222 FVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTII 260

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 69/170 (40%), Gaps = 19/170 (11%)

Query: 116 FILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLP 175
           FI   GRLGDI G   +  +      I SL+C +     N   F   RA QG+  + ++P
Sbjct: 80  FIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMP---NFPAFAVFRAIQGICAAGLVP 136

Query: 176 NLLGIVGNIYKPGTRRKNIVISLIGMCAPI--GATFGGLFAGVVVIRKDSDWPWAFYAYT 233
               ++  +      +K   I   G  + I  G   GG FA   +      +   FY   
Sbjct: 137 CAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFAATKI-----GYRGIFYLTF 191

Query: 234 IAAFLTTIISYFVI---------PNSIPVNVNKFAMDWIGSALGVSGLVL 274
               L ++I++F           P  I    +  ++D+IGS + V+G +L
Sbjct: 192 AVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSIL 241

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 128/332 (38%), Gaps = 42/332 (12%)

Query: 82  TMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLT 141
           T+T ST + +  E +            + + S SF  + G   D  G +  L       T
Sbjct: 71  TVTASTYQTIGNEFNQMSISNWITTA-YLITSTSFQPLYGSFSDALGRRNCLFFANAAFT 129

Query: 142 IWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR------KNIV 195
           I  L C LS+    + + ++            L  L  IV +   P ++R      +N+ 
Sbjct: 130 IGCLACSLST----NIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNL- 184

Query: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPV-- 253
             L+G  A  GA+FGG  A  +       W W F      + +++++  + +PN      
Sbjct: 185 --LLGFGAICGASFGGTIASTI------GWRWCFLIQVPISIISSVLMNYYVPNQKEYNH 236

Query: 254 -NVNKFA--------MDWIGSALGVSGLVLFNFVWN---QSTVVGWATGYXXXXXXXXXX 301
            N N F         +D  GS L ++GL L     +     + + W +            
Sbjct: 237 ENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIA 296

Query: 302 XXXXXXXXXXKYAKVPLLPKE-VTESRSIIMILASLMAGWGSFGIWIF---YYFQFVLTL 357
                     K     ++P E V+ S S +++L S++ G+ S+  ++F    +FQ VL  
Sbjct: 297 ILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFASYA-YLFTLPLFFQIVL-- 353

Query: 358 RNYSPVWAGGTFFMVSIVGCIAALTVGFSIKR 389
              S   AG    + S+   + +L  GFS+ +
Sbjct: 354 -GDSTAKAGLRLAIPSLFTPVGSLITGFSMSK 384

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 93/236 (39%), Gaps = 15/236 (6%)

Query: 40  APVFVEEPESPWQDPNYFKGKWDEVL-------FVLSCMMGQLLNQAGSTMTLSTMKVLE 92
           AP     PE P  D +Y       VL        V++  +G  L+   +T+  + +  + 
Sbjct: 10  APCLSPIPEIPTFDSSYDAAANHSVLTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIA 69

Query: 93  RELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSF 152
            +LD            + L   +F  + G+L DI+G K +L+   +   I   +CG S +
Sbjct: 70  SDLDASSQMSWIATS-YLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG-SPW 127

Query: 153 SHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGL 212
           + N       R   G+G   +         +I     R++ +   L  +C  +G   G +
Sbjct: 128 TTNIWILSAGRFIAGIGGGGLTTLSTITTSDIIP--LRKRGVYQGLGNICFSLGCASGSV 185

Query: 213 FAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALG 268
                V+++   W WAF      A ++ ++  FV+   +P +     + W+  A G
Sbjct: 186 LGA--VLQQGIGWRWAFLIQVPIALISGLLIVFVL--ELPSDSPGRGLIWLEHARG 237

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 91/244 (37%), Gaps = 32/244 (13%)

Query: 16  KSSHENEIERNLSRE----DKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCM 71
           +SS +++I+   S E    DK  T  ++ PV           P    G   +   V+ C 
Sbjct: 34  RSSFDHKIDEGESSEPFTDDKSNTEPEDVPV-----------PYTRFGPRAKFGLVMQCA 82

Query: 72  MGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKK 131
                +     +    + V+E++              + +  G    + G L D  G + 
Sbjct: 83  FTGFFSSIAGAIYYPVLTVIEKKFSITEEQVNITVVVYFIFQGLSPSLMGGLADSLGRRP 142

Query: 132 MLLLGYIWLTIWSLI-----CGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186
           ++L        WS++     C   + S N T  I  R  Q  GIS V+    GI+G++  
Sbjct: 143 VVL--------WSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTT 194

Query: 187 PGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFV 246
              R     +  +     +G+  G L    +  R   DW   F+   I +    ++S+FV
Sbjct: 195 KAER--GGYVGYVAGFQILGSALGALIGAALSSR--WDWRAIFWFLAIGSGACALVSFFV 250

Query: 247 IPNS 250
           +P +
Sbjct: 251 LPET 254

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 5/104 (4%)

Query: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180
           GR  D YG K  ++LG +   I  LI G S   +     + +R+  GL ++  +  +  I
Sbjct: 83  GRFSDEYGRKLTVILGMLGTCISLLILGFSKHFYQA---MIARSMMGL-LNGNIAVIRTI 138

Query: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSD 224
           VG +   G R + I  S I +    G   G +  G +V  KD+D
Sbjct: 139 VGELTTEG-RHQAIAFSTIPLLFQFGTVIGSIIGGFLVFHKDND 181

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 93/429 (21%), Positives = 156/429 (36%), Gaps = 59/429 (13%)

Query: 116 FILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLP 175
           FI   GRLGDI G   +  +      + SL+C +     N   F   RA QG+  + ++P
Sbjct: 80  FIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMP---NFPAFAVFRAIQGICAAGLVP 136

Query: 176 NLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIA 235
               ++  +      +K   I   G  + IG    GL  G         +   FY     
Sbjct: 137 CAYALIPILAPKEKVQKYFSIVSCGFSSTIGL---GLIIGGAFATTKIGYRGIFYLTFAV 193

Query: 236 AFLTTIISYFVI---------PNSIPVNVNKFAMDWIGSALGVSGLVLF-------NFVW 279
             L +II++F           P     + +  ++D+IGS + V+G +L           W
Sbjct: 194 MTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGESW 253

Query: 280 NQS-TVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVP----------LLPKEVTESRS 328
           N+  T V    G                     KY  +           L+P +V   ++
Sbjct: 254 NRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKVQLLIPIDVLFMKN 313

Query: 329 IIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSI- 387
            I I+ +           ++   Q+       SP+ AG     V +V  I  + +G ++ 
Sbjct: 314 FIPIVLAFALNNACLFSCLYIIDQYSQYAERNSPLLAG-----VKLVPLIICMVIGNALC 368

Query: 388 --------KRVGPAVLLFFSMIAFTCGSIIL-SVTPVHETYF-RSCLGAMVILSFGMDLS 437
                    RVG A+  F ++     GSIIL  +  V E  F +    A  ++ FG+ + 
Sbjct: 369 AFESTKLRPRVGVAIGFFLAL----AGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIF 424

Query: 438 FPAASIILSDELSMQYQGMAGSLVNTV----VNYSMSLFLGIGGTIERQINKSG--DRLL 491
           +P A  I       + +G+A  +  T     +  + S+   + G I     KS    +  
Sbjct: 425 YPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFR 484

Query: 492 EGFRAALYF 500
            GF+   YF
Sbjct: 485 TGFQNCSYF 493

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 87/210 (41%), Gaps = 14/210 (6%)

Query: 45  EEPESPWQDPNYFK-GKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXX 103
           +  E    +P Y + G+ +++  V+ C    L +    ++    + V+E+E         
Sbjct: 79  QHNEPTLDEPPYSRFGRKEKIFLVIQCAFTGLFSSIAGSIYYPVLSVMEKEFYITEEQVN 138

Query: 104 XXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSR 163
                + +       + G L D  G ++ ++L  I L   + I GL+  + N +  I  R
Sbjct: 139 VSVVVYFIFQALSPTLMGGLADSLG-RRPVVLSSIVLYFCACI-GLARCT-NYSQLIGLR 195

Query: 164 AFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLF-AGVVVIRKD 222
             Q  GIS V+    GI+G++     R     + L+     +G  FG L  AG+      
Sbjct: 196 CLQAAGISPVIAVNSGIMGDVTTKAERGG--YMGLVSGTQVLGTAFGALIGAGL-----S 248

Query: 223 SDWPWA--FYAYTIAAFLTTIISYFVIPNS 250
           S W W   F+   I + +  I+S  V+P +
Sbjct: 249 SRWSWRSIFWFLVIGSGICLIVSIIVLPET 278

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 88/229 (38%), Gaps = 13/229 (5%)

Query: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWD 62
           D   ++  + T   S    E + ++ R +K      E      EPE  +  P      + 
Sbjct: 54  DMTDISEIKDTDFDSDKSKEEQSSIVRNEK----HPETAFTALEPEIAYNPPYSAFSNYQ 109

Query: 63  EVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGR 122
            V  +L  +    L      + +  + +L+ E +            F  V      +   
Sbjct: 110 VVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFAVGPFLWAV 169

Query: 123 LGDIYGLKKMLLLGYIWLTIWSLICG--LSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180
             D +G +K L   YI+  + +LI    L++   +       R FQ +G S V+P  +G 
Sbjct: 170 HAD-FGGRKFL---YIFSLMIALIANVLLAAVPKHLAALYILRVFQAIGTSAVIPLGVGT 225

Query: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAF 229
           V ++  P  R K +   ++G    +G   G +F G++++  +  W W F
Sbjct: 226 VSDLISPMNRAKGVSYFMLG--PNMGPILGPIFGGLILMNGN-QWRWLF 271

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 80/195 (41%), Gaps = 12/195 (6%)

Query: 57  FKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSF 116
           +  KW  V  +  C      +  GS +    ++ LE+E              + L  G  
Sbjct: 109 YSQKWGMVAVLTMC---GFWSSLGSPIYYPALRQLEKEFHLNESQVNVTVVVYLLFQGIA 165

Query: 117 ILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS-SFSHNDTFFITSRAFQGLGISFVLP 175
              SG L D YG + ++L G +   + S+  GL+ + S+    F+  R  Q +GIS  + 
Sbjct: 166 PTFSGGLADRYGRRPIILGGMLVYVVASI--GLARAPSYGVIVFL--RIVQSIGISPTIA 221

Query: 176 NLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIA 235
              G+V + Y     R   V +  G    IG   G L   V+  R   DW   F+   I 
Sbjct: 222 ISSGVVSD-YTLKRERGTFVGATSGFVL-IGQGIGPLLGAVIAARW--DWRAIFWFLVIG 277

Query: 236 AFLTTIISYFVIPNS 250
              + +I++F++P +
Sbjct: 278 CGTSMLIAFFLLPET 292

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 15/140 (10%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L +  F+L+ GRL +I G K+ L++  I   I SLI   S+ S++    I+ R   G 
Sbjct: 52  YALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLI---SALSNSMATLISGRVVAGF 108

Query: 169 GISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWA 228
           G S +  +L  +VG        R  I+I+ + +   I    G    G     +   W W 
Sbjct: 109 GGSGI-ESLAFVVGTSIVRENHR-GIMITALAISYVIAEGVGPFIGG--AFNEHLSWRWC 164

Query: 229 FY--------AYTIAAFLTT 240
           FY        A+ I AF  T
Sbjct: 165 FYINLPIGAFAFIILAFCNT 184

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 47/245 (19%), Positives = 92/245 (37%), Gaps = 14/245 (5%)

Query: 10  GQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFK-GKWDEVLFVL 68
           G    ++S H ++ + ++     +    +       + E     P Y + G  ++++ V+
Sbjct: 23  GYTHKVRSYHNDDDDESVINISDINPKNQLCQTKSNQNEPDIASPPYSRFGTTEKMILVI 82

Query: 69  SCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYG 128
            C      +     +    + V+E E +            + +  G    I G L D  G
Sbjct: 83  QCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMG 142

Query: 129 LKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPG 188
            + ++L   +   ++   C   + SH     I  R  Q  GIS V+    GI+G+I    
Sbjct: 143 RRPVVLSSVL---VYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRA 199

Query: 189 TRRKNIVISLIGMCAPIGATFGGLF-AGVVVIRKDSDWPWA--FYAYTIAAFLTTIISYF 245
            R     +  +     IG+ FG L  AG+      + W W   F+   I + +  + S  
Sbjct: 200 ERGG--YVGYVSGFQVIGSAFGALIGAGL-----SATWSWRSIFWFLAIGSGVCLVASII 252

Query: 246 VIPNS 250
           ++P +
Sbjct: 253 ILPET 257

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 93/242 (38%), Gaps = 20/242 (8%)

Query: 16  KSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFK-GKWDEVLFVLSCMMGQ 74
           + S  N ++R+ S        E+       + ES +    Y +     ++L V+ C    
Sbjct: 20  EGSDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTG 79

Query: 75  LLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLL 134
             +    ++    + ++ER+ +            + +  G    I G L D +G + ++L
Sbjct: 80  FFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRPIVL 139

Query: 135 ---LGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR 191
              L Y    I  L C     +HN    +  R  Q  GIS V+    GI+G++     R 
Sbjct: 140 WAILAYFCACI-GLAC-----AHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVERG 193

Query: 192 KNIVISLIGMCAPIGATFGGLF-AGVVVIRKDSDWPWA--FYAYTIAAFLTTIISYFVIP 248
               + L+     +G  FG L  AG+      S W W   F+   I + +  + S  ++P
Sbjct: 194 G--YVGLVAGFQVVGTAFGALIGAGL-----SSKWGWRAIFWFLAIGSGICLVFSTLLMP 246

Query: 249 NS 250
            +
Sbjct: 247 ET 248

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 6/113 (5%)

Query: 143 WSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMC 202
           WS+I   + F  +    I  R   G       P ++ +V  IYKP  + K I  +L   C
Sbjct: 144 WSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRI--ALFFGC 201

Query: 203 APIGATFGGLFA-GVVVIRKDS---DWPWAFYAYTIAAFLTTIISYFVIPNSI 251
           A +   FGGL A G+  +   S    W W +    + +   +I  YF +P  I
Sbjct: 202 AALAGAFGGLIATGLATVNGASGLNGWRWLYIIEGLISITASIWIYFGLPTDI 254

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (44%), Gaps = 17/127 (13%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L S  F L+ GR+  + GLK  L+L  +   I SLI  +   S++    I  R   G 
Sbjct: 87  YSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAV---SNSMGMLIAGRVVAGA 143

Query: 169 GISFVLPNLLGIVGNIYKPGT-----RRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDS 223
           G S       GI   +Y  GT     R + +VI ++   A +G+  GG   G   + + +
Sbjct: 144 GGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTF-AFVGSNAGGPILG-GALNEHA 194

Query: 224 DWPWAFY 230
            W W F+
Sbjct: 195 SWRWCFF 201

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 73/172 (42%), Gaps = 9/172 (5%)

Query: 80  GSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIW 139
           GS +    +K LE++ +            + L  G    ISG L D+YG + ++L G + 
Sbjct: 106 GSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLI 165

Query: 140 LTIWSLICGLSSF-SHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISL 198
             + S+  G++   S+    F+  R  Q +GIS  +    G+V + +     R   V + 
Sbjct: 166 FVVASI--GIAKAPSYGVIVFL--RCIQSIGISPTIAISSGVVSD-FTVKRERGTFVGAT 220

Query: 199 IGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNS 250
            G+   IG   G L     VI     W   F+  TI      II +F++P +
Sbjct: 221 SGLVL-IGQGIGPLLGA--VITAALHWRAVFWFLTIGCGSCMIIGFFLLPET 269

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 100/250 (40%), Gaps = 18/250 (7%)

Query: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEK--EAPVFVEEPESPWQDPNYFKGK 60
           D  ++  G+V  L    ++         D ++T +K  E    +   E+P+   +Y + K
Sbjct: 9   DDISIESGEVPRLIHGDDST-----KHGDMVMTNDKPIENNGTISRNEAPYTLLSYGQ-K 62

Query: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILIS 120
           W  V  +  C     L   GS +    ++ LE+E +            + L  G     S
Sbjct: 63  WGMVALLTMCTFWSSL---GSPIYYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFS 119

Query: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGI 180
           G L DIYG + ++++G I     S+  GL+  S++    +  R  Q   IS  +    G 
Sbjct: 120 GGLADIYGRRPVIVIGMIIYVAVSV--GLAC-SNSYGVLVFLRILQSACISPTIAISSGF 176

Query: 181 VGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTT 240
           VG+ +     R   V +  G  A +G  FG L    +      DW   F+   I   +  
Sbjct: 177 VGD-FTLKFERGTFVGATSGF-ALLGQAFGSLIGAALA--AAWDWRAIFWFLVIGCGVCM 232

Query: 241 IISYFVIPNS 250
           +I + ++P +
Sbjct: 233 LIIFTLLPET 242

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 83/359 (23%), Positives = 135/359 (37%), Gaps = 54/359 (15%)

Query: 62  DEVLFV-LSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILIS 120
           D++L + LS  +G  L  A  T+  + M  +  E +            + L S +F  + 
Sbjct: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATA-YLLSSATFQPLY 134

Query: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTF--FITSRAFQGLGISFVLPNLL 178
           G+L DI+G K +L+L  I   +  L+CGL+      +F   + +R   G+G   V     
Sbjct: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP-----SFWGLVGARFISGIGGGGVTSMCS 189

Query: 179 GIVGNIYKPGTRR--KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFY-AYTIA 235
             + +I     R   + +     G+    G   GG F+          W  AF     ++
Sbjct: 190 ITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFS-----DHGGGWRMAFLIQVPLS 244

Query: 236 AFLTTIISYF--VIPNSIPVNV-----NK-FAMDWIGSALGVSGLVLF---------NFV 278
           A  + +I+ F  + P S  VN      NK  ++DWIG++  V  L LF            
Sbjct: 245 ALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVTASLGGKEIA 304

Query: 279 WNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKEVTESRSIIMILASLMA 338
           +N  T V    G                       AK P+LP     +RS   +L S  +
Sbjct: 305 FNSKTFVALCIGSSLACAFFIGVELYG--------AKDPILPLSFLRNRS---VLGSSFS 353

Query: 339 GW------GSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVG 391
            W       +   ++  Y+  VL   N +P   G           + +L  G+ +KR G
Sbjct: 354 NWFCMMAMMTTSYYLPIYYSGVL---NMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG 409

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 14/86 (16%)

Query: 155 NDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFA 214
           N T + +SR  Q LG +  LP + G +    +P          L+G+   + ATF GL  
Sbjct: 372 NSTVYASSRLIQALGTAGQLPKIFGYMDRKGRP----------LVGIA--VSATF-GLLG 418

Query: 215 GVVVIRKDSD-WPWAFYAYTIAAFLT 239
            +V  +K S+ + W F   ++AAF+T
Sbjct: 419 FLVATKKQSEVFTWLFALCSVAAFVT 444

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 7/122 (5%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L      L+ GR   I G K  LL+  +     SLI   S+ S++    I  R   G+
Sbjct: 162 YSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLI---SAISNSMNMLIGGRVVAGI 218

Query: 169 GISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWA 228
           G S +  +L  ++ +   P  R + I+IS++     + A  G    G +       W W 
Sbjct: 219 GGSGI-QSLCFVIASTLTPD-RSRVIIISVLSCSYAVAAVVGPFLGGALTTHV--TWRWC 274

Query: 229 FY 230
           FY
Sbjct: 275 FY 276

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186
           YG  +++ L  ++  IW ++ GL+    N    I +R   G+ ++     L G+V +++ 
Sbjct: 123 YGRWRVMQLSLLFSNIWQILGGLAP---NFGTIIVARFLGGMSLAGGSVTL-GVVADMFD 178

Query: 187 PGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFV 246
           P        ++ I + +  G+  G +F G+  +++   W W F+   I   +  I+ +F+
Sbjct: 179 PIDH--GYAVAFIVLSSVCGSVIGPIFGGL--MQEHLSWHWNFWIQLIFNGVAQILHFFI 234

Query: 247 IPNS 250
           +P +
Sbjct: 235 VPET 238

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 113/324 (34%), Gaps = 65/324 (20%)

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
           LI GR   I G +  L+L  +     SLI  L+S S N   F   R   G+G S  L  L
Sbjct: 90  LIWGRFASIIGFQHSLILAILIFEAGSLIAALAS-SMNMLIF--GRVVAGVGGS-GLQTL 145

Query: 178 LGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFY------A 231
             ++G     G R + +VIS++     + A  G +  G         W W FY       
Sbjct: 146 CFVIG-CTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTH--VTWRWCFYINLPIGG 202

Query: 232 YTIAAFLTT-----------------IISYFVIPN-SIPVNVNK------FAMDWIGSAL 267
             I  FL T                  IS F        VN  +      F  D+ G AL
Sbjct: 203 LAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFAL 262

Query: 268 GVSGLVLF---------NFVWNQSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKY----- 313
             +GLVLF          + WN   V+     Y                    K+     
Sbjct: 263 CSAGLVLFLLGLTFGGNKYSWNSGQVI----TYLVLGVLLFIFSLVYDFFLFDKFNPEPD 318

Query: 314 --AKVPLLPKEVTESRSII---MILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGT 368
             +  PLL + +    +II   M+   L  G+    I+   +FQ +      S  W  G 
Sbjct: 319 NISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFA----SSAWKAGL 374

Query: 369 FFM-VSIVGCIAALTVGFSIKRVG 391
             + + I   IAA+  G   K++G
Sbjct: 375 HLIPIVITNVIAAIASGVITKKLG 398

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 7/113 (6%)

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
           L+ GR+  I G K  +L   I   I SLI G+   +++    I  R   G+G S +    
Sbjct: 131 LLWGRIASIIGFKSCMLAAIIIFEIGSLISGV---ANSMNMLIGGRVIAGVGGSGIQSLA 187

Query: 178 LGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFY 230
             I  N+     RR+ ++I+ +     + +  G    G       + W W FY
Sbjct: 188 FVIGSNLVDE--RRRGLIIACMSSAFAVASVIGPFLGGAFTTH--ATWRWCFY 236

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 69/161 (42%), Gaps = 12/161 (7%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGI 170
           L S  F  + G+L DI+G K +L+   +      +ICG+   S++    +  R   G+G 
Sbjct: 443 LSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGM---SNSLNMLVWGRFVAGIGG 499

Query: 171 SFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFY 230
             +       V +I     R + +   +      +G  FGG+  G+ V  +   W   F+
Sbjct: 500 GGITSMTTITVSDIVP--LRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQ-YGWRMVFW 556

Query: 231 AYTIAAFLTT--IISYFVIPN----SIPVNVNKFAMDWIGS 265
           +    + L+T  I S+ V+P      + +      +DW+GS
Sbjct: 557 SQVPVSGLSTLLICSFLVVPRIKNYEVSLGRKLMRVDWLGS 597

>Skud_12.13 Chr12 (16964..18559) [1596 bp, 531 aa] {ON} YLL055W
           (REAL)
          Length = 531

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 4/123 (3%)

Query: 140 LTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLI 199
           L  W++I  LS  + N +  +  R F GL  S V+P L+  +G  +   T R        
Sbjct: 131 LAAWTVIIFLSCTARNFSGLVALRFFLGLTESVVIPILITTMGMFFD-ATERAAAQPFFF 189

Query: 200 GMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIA--AFLTTIISYFVIPNSIPVNVNK 257
             C       G +  GV+ I+  S   W  +   I    F+ TI+     PN+ P +V  
Sbjct: 190 AACMGSPIPTGFIAYGVLHIKNPSISLWKIFTIIIGGLTFIMTIVVILWFPNN-PADVKF 248

Query: 258 FAM 260
           F++
Sbjct: 249 FSV 251

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 77/186 (41%), Gaps = 13/186 (6%)

Query: 71  MMGQLLNQAG------STMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLG 124
           MM  LL  AG      S      ++ L+RE              + L  G    +   L 
Sbjct: 70  MMVALLTSAGFWSSLGSPAVYPALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLA 129

Query: 125 DIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNI 184
           D YG + ++L+G +   + S+  G++  S++    I  R  Q  GIS ++    G+VG+ 
Sbjct: 130 DTYGRRPVILMGMLIFIVSSI--GIAC-SNSFALVIALRCIQSSGISPIIAINSGVVGD- 185

Query: 185 YKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISY 244
           +   + R   + ++ G+   +G  FG L    +      +W   F+  TI   +  + ++
Sbjct: 186 FTLKSERGTFIGAVSGLTL-LGQAFGSLIGASLT--AAYNWRAVFWFMTIGCGVCFLANF 242

Query: 245 FVIPNS 250
             +P +
Sbjct: 243 LFLPET 248

>KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 508

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 46/113 (40%), Gaps = 6/113 (5%)

Query: 143 WSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMC 202
           WS+I   S F  +    I  R   G       P ++ +V  IYKP  + K I  +    C
Sbjct: 144 WSIITLCSGFVKSYHSLIALRVLLGAFEGGYFPAMVLLVSMIYKPEEQAKRI--AFFFSC 201

Query: 203 APIGATFGGLFA-GVVVIRKD---SDWPWAFYAYTIAAFLTTIISYFVIPNSI 251
           A +   FGGL A G+  +      + W W +    + +    +  YF +P  +
Sbjct: 202 AALAGAFGGLIATGLATVHGAGGLNGWRWLYIIEGLVSTTAAVWIYFGLPTDV 254

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 13/143 (9%)

Query: 313 YAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMV 372
           +A V  +P E+  +R++I   +   A + SF IW  Y+F+      N S   A     + 
Sbjct: 328 FAPVSFIPWELLTNRTVIFTYSMAAAMYCSFYIWDSYFFRHHCRF-NLSTARATYITNIY 386

Query: 373 SIVGCIAALTVGFSIKRVG--PAVLLFFS--MIAFTCGSIILSVTPVHETYFRSCLGAMV 428
           SI  C  AL VG  I+  G   ++ LF+   +    CG +I   +P       S LG +V
Sbjct: 387 SIGSCFCALVVGVIIRCYGRLKSIALFWGVPITMLGCGLMIKYRSP------DSNLGLIV 440

Query: 429 ILSFGMDLSFPAASIILSDELSM 451
           +    + ++F   ++++ +++++
Sbjct: 441 MCQ--LFIAFGGGALVICEQMTV 461

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 125/312 (40%), Gaps = 41/312 (13%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGI 170
           + S SF  + G   D  G +  L       TI  L CG   FS N       RA  G+G 
Sbjct: 13  ITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACG---FSKNIYMLSFMRALTGIGG 69

Query: 171 SFVLPNLLGIVGNIYKPGTRR------KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSD 224
             ++  L  IV +   P ++R      +N+   L+G  A  GA+FGG  A  +       
Sbjct: 70  GGLI-TLSTIVNSDVIPSSKRGIFQAFQNL---LLGFGAICGASFGGTIASSI------G 119

Query: 225 WPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFA-----------MDWIGSALGVSGLV 273
           W W F      + +++I+  + +PN    N    +           +D +GS L ++GL 
Sbjct: 120 WRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGLT 179

Query: 274 LFNFVWN---QSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKE-VTESRSI 329
           L     +    ++ + W +                      K +   ++P E V  S S+
Sbjct: 180 LQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSV 239

Query: 330 IMILASLMAGWGSFGIWIF---YYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFS 386
           +++  S++ G+ S+  ++F    +FQ VL     S   AG    + S+   + +L  GFS
Sbjct: 240 VVLSISILVGFASYA-YLFTLPLFFQIVL---GDSTAKAGLRLTIPSLFTPVGSLITGFS 295

Query: 387 IKRVGPAVLLFF 398
           + +     LL +
Sbjct: 296 MSKYNCLRLLLY 307

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 7/122 (5%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L +  F L+ GR   I+G K  L++  I   I SL+  +   S++    I  R   G 
Sbjct: 64  YSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAV---SNSMDMIIGGRVIAGC 120

Query: 169 GISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWA 228
           G S +   +  I  ++    TR    +++L+ +   + +  G    G   + +   W W 
Sbjct: 121 GASGIQTLVFAIATSLVDEHTR--GTIVTLLSLSYAVASALGPYIGG--ALTEYVTWRWC 176

Query: 229 FY 230
           FY
Sbjct: 177 FY 178

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 14/175 (8%)

Query: 52  QDPNYFK----GKWDEVL----FVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXX 103
           QD   F     GK  EV+     +LS  M   L     T+  + M  +  E         
Sbjct: 27  QDCKIFDSDEFGKLQEVMPRLPMLLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQW 86

Query: 104 XXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSR 163
                F L S  F  I G+L D+ G + +L+L Y   +++ L C +++++ N   F   R
Sbjct: 87  VATS-FLLTSTVFQPIYGKLSDVTGRRFVLVLAY---SLFLLGCLVTAYARNIWEFAFGR 142

Query: 164 AFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVV 218
           A  G+G   +    +  +G+++    + ++I  S   +   IG   G    G+ +
Sbjct: 143 AICGIGAGGIPTMCVITMGDMFS--VKEQSIYQSYAHIIYTIGEVLGAPIGGIAL 195

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 178 LGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAF 237
           LG+  +++ P        ++ + +C+  G   G +F G+  + +   W W F+   I   
Sbjct: 226 LGVAADMWDPADH--GYAVAFVVLCSVGGTVIGPIFGGL--MEEHLSWHWNFWIQLIFNG 281

Query: 238 LTTIISYFVIPNS 250
           +T ++ +F++P +
Sbjct: 282 VTQVLHFFIVPET 294

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 116 FILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLG 169
           FI   GRLGDI G  ++  +      I SL+CGL     N   F   RA QG+ 
Sbjct: 80  FIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMP---NFEAFAVMRALQGIA 130

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/255 (18%), Positives = 103/255 (40%), Gaps = 10/255 (3%)

Query: 8   NGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFV 67
           N  ++       +  I++N + E +   + KE+P++    + P+     F+     ++ +
Sbjct: 28  NADKILQEVDLSDPNIDKNDTFELRQQVSIKESPLYYLR-DIPYSAYTSFQVSLIFLIVI 86

Query: 68  LSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIY 127
            +  +G L   AG+   +  + +L++E +            F        L  G L D  
Sbjct: 87  YNGFLGPL---AGNVF-IPALPLLQKEFNVSETTINATVSVFMATFSISPLFWGALADKG 142

Query: 128 GLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKP 187
           G K + ++    + I +++  L+S        I  R  Q    S V+    G V ++  P
Sbjct: 143 GRKILYIISISLMVIINIL--LASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPP 200

Query: 188 GTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVI 247
             R K +   ++G    +G     + AG++++  +++W W F    I + L  I+   ++
Sbjct: 201 KDRGKAMAYFMLG--PNLGPILAPIIAGLILL-DNNNWRWLFGFLCIVSGLGLIMVILLL 257

Query: 248 PNSIPVNVNKFAMDW 262
           P ++   V      W
Sbjct: 258 PETLRCIVGNGDRQW 272

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 119/303 (39%), Gaps = 41/303 (13%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGI 170
           + S SF  + G   D  G +  L       TI  L CG SS    + + ++         
Sbjct: 13  ITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSS----NIYMLSFMRALTGIG 68

Query: 171 SFVLPNLLGIVGNIYKPGTRR------KNIVISLIGMCAPIGATFGGLFAGVVVIRKDSD 224
              L  L  IV +   P ++R      +N+   L+G  A  GA+FGG  A  +       
Sbjct: 69  GGGLITLSTIVNSDVIPTSKRGIFQAFQNL---LLGFGAICGASFGGTIASTI------G 119

Query: 225 WPWAFYAYTIAAFLTTIISYFVIPNSIPV---NVNKF--------AMDWIGSALGVSGLV 273
           W W F      + +++I+  + +PN       N N F         +D +GS L ++GL 
Sbjct: 120 WRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGLT 179

Query: 274 LFNFVWN---QSTVVGWATGYXXXXXXXXXXXXXXXXXXXXKYAKVPLLPKE-VTESRSI 329
           L     +    ++ + W +                      K     ++P E V+ S S 
Sbjct: 180 LQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSF 239

Query: 330 IMILASLMAGWGSFGIWIF---YYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFS 386
           +++  S++ G+ S+  ++F    +FQ VL     S   AG    + S+   + +L  GFS
Sbjct: 240 VVLSISILVGFASYA-YLFTLPLFFQIVL---GDSTAKAGLRLTIPSLFTPVGSLITGFS 295

Query: 387 IKR 389
           + +
Sbjct: 296 MSK 298

>Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON}
           YCR098C (REAL)
          Length = 521

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 60/146 (41%), Gaps = 5/146 (3%)

Query: 119 ISGRLGDIYGLKKMLLLGYIWLTIWSLI--CGLSSFSHNDTFFITSRAFQGLGISFVLPN 176
           I     D  G K  L++G+    ++ LI  C     S     FI   A   +  +    N
Sbjct: 327 IGAYFSDRIGRKYTLMIGFSGYIVFGLIIGCAYDQLSKITPLFIIFYALMNMLGNAGPGN 386

Query: 177 LLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAA 236
           +LG++ +     T  + +   +  +   IG+  G        IR +    W F    I  
Sbjct: 387 MLGVISS-ESSATAVRGVFYGISAVTGKIGSVVG--VECFQPIRDNLGARWTFIIAAICG 443

Query: 237 FLTTIISYFVIPNSIPVNVNKFAMDW 262
            +  +I+YF++P+S+  ++ K  +D+
Sbjct: 444 LVGVVITYFLVPHSLDSDLMKQDVDF 469

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS 150
           L S +F  + G++ DI+G K +L+   +   +  LICGLS
Sbjct: 175 LSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 112 VSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGIS 171
           ++GS I+    L + +G K  +++  +W T+ +++C   + SH+       R   G+G+ 
Sbjct: 154 MAGSMIMTP--LNEWFGRKASIIISCVWYTVGAILC---AASHDHHLMYAGRFMLGVGVG 208

Query: 172 FVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYA 231
            +    +GI  +   P + R N+V SL      +G  FG +     VI  D    W F  
Sbjct: 209 -IEGGCVGIYISESVPSSVRGNLV-SLYQFNIALGELFGYIIG---VIFFDVKGGWRFMV 263

Query: 232 YTIAAFLTT-IISYFVIPNS 250
            +   F T  +I  F +P S
Sbjct: 264 GSSLVFSTALLIGLFFLPES 283

>YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}
           GIT1Plasma membrane permease, mediates uptake of
           glycerophosphoinositol and glycerophosphocholine as
           sources of the nutrients inositol and phosphate;
           expression and transport rate are regulated by phosphate
           and inositol availability
          Length = 518

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 56/141 (39%), Gaps = 5/141 (3%)

Query: 119 ISGRLGDIYGLKKMLLLGYIWLTIWSLI--CGLSSFSHNDTFFITSRAFQGLGISFVLPN 176
           I   L D  G K  L+ G+    I+ LI  C           FI   AF  +  +    +
Sbjct: 324 IGAYLSDRIGRKYTLMFGFSGYIIFGLIIGCAYDQLKKITPLFIIFYAFMNMLGNAGPGD 383

Query: 177 LLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAA 236
           +LG++ +     T  + +   L  +   IG+  G        IR +    W F    I  
Sbjct: 384 MLGVISS-EASATAVRGVFYGLSAVTGKIGSVVG--VECFQPIRDNLGARWTFIIAAICG 440

Query: 237 FLTTIISYFVIPNSIPVNVNK 257
            +  II+YF +P+S+  ++ K
Sbjct: 441 LIGIIITYFFVPHSLESDLMK 461

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 91/240 (37%), Gaps = 24/240 (10%)

Query: 24  ERNLSREDKML-TTEKEA---PVFVEEPESPWQD----PNY--FKGKWDEVLFVLSCMMG 73
           E +    DKM+ T E EA   P++         D    P Y  F  K+   L VL C   
Sbjct: 32  EVDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMAL-VLQCAYT 90

Query: 74  QLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKML 133
            L +     +    + V+E++              + +  G    + G L D  G + ++
Sbjct: 91  GLFSTMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPVV 150

Query: 134 LLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKN 193
           L     +T++   C   + +      +  R  Q  GIS V+    GI+G++     R   
Sbjct: 151 LFA---VTVYFGACIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAERGG- 206

Query: 194 IVISLIGMCAPIGATFGGLF-AGVVVIRKDSDWPWA--FYAYTIAAFLTTIISYFVIPNS 250
             +  I     +G+ FG L  AG+      S W W   F+   I + +  + S  ++P +
Sbjct: 207 -YVGYISGFQVLGSAFGALIGAGL-----SSRWGWRSIFWFLAIGSGVCLVFSIIMLPET 260

>Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON}
           YCR098C (REAL)
          Length = 518

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 55/141 (39%), Gaps = 5/141 (3%)

Query: 119 ISGRLGDIYGLKKMLLLGYIWLTIWSLI--CGLSSFSHNDTFFITSRAFQGLGISFVLPN 176
           I   L D  G K  L+ G+    I+ LI  C           FI   AF  +  +    +
Sbjct: 324 IGAYLSDRIGRKYTLMFGFSGYIIFGLIIGCAYDQLKEITPLFIIFYAFMNMLGNAGPGD 383

Query: 177 LLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAA 236
           +LG++ +     T  + +   L  +   IG+  G        IR +    W F    I  
Sbjct: 384 MLGVISS-EASATAVRGVFYGLSAVTGKIGSVVG--VECFQPIRDNLGARWTFIIAAICG 440

Query: 237 FLTTIISYFVIPNSIPVNVNK 257
               II+YF +P+S+  ++ K
Sbjct: 441 LFGIIITYFFVPHSLENDLMK 461

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 9/142 (6%)

Query: 110 PLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLG 169
           PL + +  +I   L + +G K  +++  IW T+ +++C  S+  H        R   G+G
Sbjct: 146 PLGAMAGSVIMSPLNEWFGRKSSIMISCIWYTVGAILCAASTSHH---LMYAGRFILGVG 202

Query: 170 ISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAF 229
           +  +    +GI  +   P T R N+V S+      +G  FG +   V VI  D    W F
Sbjct: 203 VG-IEGGCVGIYVSESVPSTVRGNLV-SMYQFNIALGELFGYI---VGVIFFDVHGGWRF 257

Query: 230 YAYTIAAFLTT-IISYFVIPNS 250
              +   F T  ++  F +P S
Sbjct: 258 MVGSSLVFSTILLVGMFFLPES 279

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           F L + +F  + G+L D+ G K  LL+ Y +L I    C L+  + N T F  +RA  G+
Sbjct: 79  FLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG---CLLTCLARNVTEFAVARAICGI 135

Query: 169 GISFVLPNLLGIVGNIYKPGTR-----RKNIVISLIGMCAPIGATFGGLF 213
           G   +       V +I     R       NIV    GM   +GA  GGLF
Sbjct: 136 GGGGINACSSITVSDICTAKERGIYQGYANIVF---GMGQMLGAPLGGLF 182

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 11/115 (9%)

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
           L+ GR G + G K  +LL  +   + SLI   ++   + T  I  R   G+G S +    
Sbjct: 128 LLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAAT---SMTMLIGGRVISGIGGSGIQTLC 184

Query: 178 LGIVGNIYKPGTRRKNI-VISLIGMCAPIGATF-GGLFAGVVVIRKDSDWPWAFY 230
             I   +    TR   I ++S     A +   F GG FA  V       W W FY
Sbjct: 185 FVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAFATHVT------WRWCFY 233

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 68/160 (42%), Gaps = 24/160 (15%)

Query: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFV--LPNLL 178
           G+L DI+G K +LL   +   +  L+CG +       + +  R   G+G   +  +P++ 
Sbjct: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAP---TVWWLLAGRFVAGIGGGGLTSMPSI- 263

Query: 179 GIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFL 238
            I+ +I     R +     L  +C  +G T GG   G +   +   W   F    +AA +
Sbjct: 264 -IISDIVP--LRSRASYQDLFNICYVLGITLGGSMGGWLA--EYGGWRLVFLLQVVAALI 318

Query: 239 TT--IISYFVIP-----------NSIPVNVNKFAMDWIGS 265
           +   I ++ ++P           N   +    + MDW+G+
Sbjct: 319 SGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGT 358

>Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]
           {ON} YBR180W (DTR1) - dityrosine transporter MFS-MDR
           [contig 22] FULL
          Length = 567

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 62/154 (40%), Gaps = 5/154 (3%)

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
           LI     D  G K + ++  +   I +++      +    FF+  R  Q    S V+   
Sbjct: 164 LIWASFADFGGRKILYMISLLLTVIVNVLLAAVPVNTGALFFL--RVMQAFASSSVMALG 221

Query: 178 LGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAF 237
            G V +I  P  R K I   ++G    +G     + AG++++R  S W W F   +I + 
Sbjct: 222 AGTVSDIRPPQVRGKAIAYFMLG--PNMGPILAPIIAGLILMR-GSYWRWLFGFTSILSG 278

Query: 238 LTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSG 271
           +  I     +P ++   V      WI +   V G
Sbjct: 279 IGLIAVIVFLPETLRCIVGNGDPKWIDTEDEVVG 312

>TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 100/258 (38%), Gaps = 28/258 (10%)

Query: 16  KSSHENEIERNLSREDKMLTTEKEA-------------PVFVE--EPESPWQDPNYFKGK 60
           KS    E+E++L +   +   +  A             P  V+   P+ P ++P  +K  
Sbjct: 58  KSDISTEVEKDLEKNSCIQNCDSMAESSLKGKEGTEFDPFLVDWHGPDDP-ENPLNWK-P 115

Query: 61  WDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILIS 120
           W + L +   M+   +N  GS++     + ++RE              + L  G   +I 
Sbjct: 116 WKKGLIMFEVMLLTSINYMGSSIYTPGQEEIQREFHVGHVVATLNLSMYVLGYGIGPMIL 175

Query: 121 GRLGDI--YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLL 178
             L +   +G   + ++     TI+ +  G ++  HN    I  R   G+  S  L    
Sbjct: 176 SPLSEYARFGRLHIYIISMFLFTIFQI--GAAT-VHNIGGLIVIRFISGILCSPALATGG 232

Query: 179 GIVGNIYKPGTRRKNIVISLIG-MCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAF 237
           G + +   P T  + I +  +G M AP+ A    L    +V+ KD  W W F+     + 
Sbjct: 233 GTLADFLDPKTLPRYIGLWSLGFMSAPVSAP---LLGACMVVAKD--WRWIFWLLLFMSV 287

Query: 238 LTTIISYFVIPNSIPVNV 255
              ++  F  P +   N+
Sbjct: 288 ALFVMLIFFFPETHHGNI 305

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 13/125 (10%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L +   +LI GR+    G K  +L   +   I SLI  L+S   +    I  R   G+
Sbjct: 105 YSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALAS---SMNMLIGGRVIAGI 161

Query: 169 GISFVLPNLLGIVGNIYKPGTRRK---NIVISLIGMCAPIGATFGGLFAGVVVIRKDSDW 225
           G    + +L  ++G+     ++R     I+ S   + + +G   GG+F   V       W
Sbjct: 162 G-GCGIQSLSFVIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVT------W 214

Query: 226 PWAFY 230
            W FY
Sbjct: 215 RWCFY 219

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 49/260 (18%), Positives = 103/260 (39%), Gaps = 34/260 (13%)

Query: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKG--- 59
           ++  +N     A  +S  NEI+ ++S +D + + E +   F  E E P  DP   K    
Sbjct: 19  EQEIINSMDDKATDTSSRNEIDNSISDKDSLSSFEVK---FDNESEIP--DPEDIKRILP 73

Query: 60  -KWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLER-ELDXXXXXXXXXXXXFPLVSGSFI 117
                ++ ++  +   ++    S  TL + ++++   +             F L  G   
Sbjct: 74  IYRKYIIGMVITLTSMVITIISSCWTLISDRIMDHFHISHEVSVLGISFYIFGLGVGPLF 133

Query: 118 LISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNL 177
           L    L ++YG +K  ++   +  +W  +             I S+  +G+     L   
Sbjct: 134 L--SPLSELYGRRKTFIISLFFSIVWQCLV------------IWSKTIEGVMFGRFLSGF 179

Query: 178 LG-----IVGNIYKPGTRRKNIVISL-IGMCAP-IGATFGGLFAGVVVIRKDSDWPWAFY 230
            G     + G ++     +KNI I + I   +P +G   G + +G +     +++ W F 
Sbjct: 180 FGSAFLSVAGGLFTDIFEKKNIGIPITIYTTSPMLGPALGPIISGAL---HGTNYKWTFI 236

Query: 231 AYTIAAFLTTIISYFVIPNS 250
              +A+ L+ I    ++P +
Sbjct: 237 TMLLASGLSFICVILLVPET 256

>Smik_12.5 Chr12 (12023..13618) [1596 bp, 531 aa] {ON} YLL055W
           (REAL)
          Length = 531

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 9/130 (6%)

Query: 140 LTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLI 199
           L  W+++  LS  ++N +  +  R F GL  S V+P L+  +G  +    R         
Sbjct: 131 LATWTILIFLSCTAYNFSGVVALRFFLGLTESVVIPILITTMGMFFDASERAAAQPFFFA 190

Query: 200 G-MCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIA--AFLTTIISYFVIPNSIPVNVN 256
             M +PI   F  +  GV+ I   S   W  +   I    F+ TII     PN+ P +  
Sbjct: 191 ACMGSPIPTGF--IAYGVLHIANPSISLWKIFTIIIGGLTFIMTIIVILWFPNN-PADAK 247

Query: 257 KFAMD---WI 263
            F+++   WI
Sbjct: 248 FFSLEERVWI 257

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 26/40 (65%)

Query: 111 LVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLS 150
           L S +F  + G++ DI+G + ++++  ++  +  LICGLS
Sbjct: 107 LSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS 146

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 13/138 (9%)

Query: 123 LGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVG 182
           L D  G + + +L +  L ++S+    ++FS N   FI  R   G   + V     G + 
Sbjct: 154 LADKNGRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGAASASVQSVGAGTIA 210

Query: 183 NIYKPGTRRKNIVISLIG-MCAPIGATFGGLFAGVVVIRKDSDWPWAFYAY--TIAAFLT 239
           ++Y P  R +N+    +G + AP+      + + ++V R    W W    +   I A LT
Sbjct: 211 DLYVPEERGRNLGYYYLGPLMAPL---LSPIVSSLLVNR----WSWRSTQWFMVILAALT 263

Query: 240 TIISYFVIPNSIPVNVNK 257
            ++  F +P ++    NK
Sbjct: 264 FLLLVFALPETLRTQDNK 281

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 59/127 (46%), Gaps = 14/127 (11%)

Query: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL---GISFVLPNLLGIVGN 183
           YG   ++ L  ++  IW ++ G +    N    I +R   GL   G S  L    G+V +
Sbjct: 121 YGRWIVMQLSLLFSNIWQILGGKAP---NFGAIIVARGLCGLSQAGGSVTL----GVVAD 173

Query: 184 IYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIIS 243
           ++ P        ++ I + +  G+  G +F G+  +++   W W F+   I   ++ I+ 
Sbjct: 174 LWDPS--EHGYAVAYIVLASVGGSVLGPVFGGL--MQEHLSWHWNFWIQLIFNGVSQILH 229

Query: 244 YFVIPNS 250
           +F++P +
Sbjct: 230 FFLVPET 236

>TDEL0G00210 Chr7 complement(40994..42586) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 46/115 (40%), Gaps = 12/115 (10%)

Query: 142 IWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKN---IVISL 198
           +W++I  L   ++N    I  R F G   S  +P L   +     P  +        +S 
Sbjct: 149 LWTIIIFLHCVAYNHQGIIALRFFLGFVESVAVPTLNITMNQFLTPDEKNSYGPIWYVSS 208

Query: 199 IGMCAPIGATFGGLFAGVVVIRKDSDWP-WAFYAYTI--AAFLTTIISYFVIPNS 250
           IG+  P+G      F    ++   S  P W  +   I    FL TII +F  PN+
Sbjct: 209 IGVSIPVG------FIAYGILHAKSSVPIWKLFMIIIGGCTFLLTIIIFFFYPNN 257

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 15/126 (11%)

Query: 109 FPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGL 168
           + L +   +LI GR+  + G K   L   +   + SL+   S+ +++    I  R   G+
Sbjct: 87  YSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLV---SALANSMDMLIGGRVIAGI 143

Query: 169 GISFVLPNLLGIVGNIYKPGTRRKNIVISLI----GMCAPIGATFGGLFAGVVVIRKDSD 224
           G S V   +  I   + +   R + ++I+++    G+ + +G   GG F   V       
Sbjct: 144 GGSGVQSLVFVISSTLVEE--RNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVT------ 195

Query: 225 WPWAFY 230
           W W FY
Sbjct: 196 WRWCFY 201

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 119/329 (36%), Gaps = 39/329 (11%)

Query: 82  TMTLSTMKVLERELDXXXXXXXXXXXXFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLT 141
           T+T ST + +  E +            + + S SF  + G   D  G +  L       T
Sbjct: 76  TITASTYQTIGNEFNQMSISSWITTA-YLITSTSFQPLYGSFSDALGRRNCLFFANAVFT 134

Query: 142 IWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRR------KNIV 195
           I  L C   SFS N  + ++            L  L  IV +   P ++R      +N+ 
Sbjct: 135 IGCLAC---SFSTN-IYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNL- 189

Query: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNV 255
             L+G  A  GA+FGG     +       W W F      + + +++  + +PN    + 
Sbjct: 190 --LLGFGAICGASFGGTITSTI------GWRWCFLIQVPISMIASLLMNYYVPNQKEYDD 241

Query: 256 NKF-----------AMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYXXXXXXXXXXXXX 304
            K             +D  GS L ++GL L     +      W                 
Sbjct: 242 QKINILLSSKKILKDIDITGSILIIAGLTLQLLYLSLGASFSWTNPPVLMLLLASIVIII 301

Query: 305 XXXXXXXKYAKVPLLPKE-VTESRSIIMILASLMAGWGSFGIWIF---YYFQFVLTLRNY 360
                  K     ++P E V  S S +++  S++ G+ S+  ++F    +FQ VL     
Sbjct: 302 LFILNERKTTARAIIPMELVNSSFSFVVLSISILVGFASYA-YLFTLPLFFQIVL---GD 357

Query: 361 SPVWAGGTFFMVSIVGCIAALTVGFSIKR 389
           S   AG    + S+   + +L  G S+ +
Sbjct: 358 STAKAGLRLTIPSLFTPVGSLITGISMSK 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,960,806
Number of extensions: 1837612
Number of successful extensions: 6551
Number of sequences better than 10.0: 179
Number of HSP's gapped: 6652
Number of HSP's successfully gapped: 186
Length of query: 537
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 423
Effective length of database: 40,409,475
Effective search space: 17093207925
Effective search space used: 17093207925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)