Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005408.844ON1115111552540.0
ZYRO0G14256g8.844ON125996323200.0
Smik_13.178.844ON113190319030.0
YML117W (NAB6)8.844ON113489318780.0
Suva_13.268.844ON112289718680.0
NCAS0B002808.844ON108185717740.0
KAFR0A028508.844ON104288017710.0
TPHA0I002708.844ON1039107517100.0
Skud_13.248.844ON112875117050.0
KNAG0G034408.844ON1053110916680.0
KLTH0C03784g8.844ON997108316600.0
CAGL0B02365g8.844ON105085016490.0
SAKL0D01364g8.844ON108290815530.0
Kwal_27.102398.844ON914104715160.0
Ecym_46158.844ON106782913991e-175
ABL122C8.844ON104382613611e-169
Kpol_1068.58.844ON103255212081e-147
TBLA0B032808.844ON136267612201e-146
KLLA0D01485g8.844ON115169710551e-124
NDAI0E002708.844ON11982869971e-115
NCAS0H010406.183ON6292254791e-49
KNAG0M004306.183ON4432254572e-48
TBLA0B052106.183ON7102254695e-48
SAKL0A05280g6.183ON5822054611e-47
KAFR0B066906.183ON5332014581e-47
Kpol_1002.696.183ON5902014592e-47
AFL061C6.183ON5232054544e-47
KLLA0E19031g6.183ON6522054588e-47
Ecym_22336.183ON5762054522e-46
NDAI0F022606.183ON6802014534e-46
Kwal_27.111586.183ON5672054432e-45
CAGL0C01419g6.183ON6392014443e-45
Smik_6.3906.183ON6252014425e-45
Skud_16.946.183ON6142014416e-45
ZYRO0G08140g6.183ON6322014426e-45
Suva_16.1236.183ON5962014406e-45
YPL184C (MRN1)6.183ON6122014409e-45
TPHA0J022106.183ON5932014371e-44
TDEL0G016206.183ON5842014344e-44
KLTH0H04906g6.183ON5692054316e-44
ZYRO0F07238g8.670ON389221870.11
Ecym_24038.670ON375255860.15
KAFR0A038308.670ON374214850.22
Smik_15.4268.670ON371229810.55
ACR135C8.670ON37670781.5
Suva_8.2928.670ON37071771.6
Suva_4.398.466ON34836744.5
Skud_4.478.466ON34330726.9
SAKL0F10076g7.297ON45352727.0
KAFR0D016608.797ON21283717.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00540
         (1115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....  2028   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   898   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   737   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   728   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   724   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     687   0.0  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   686   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   663   0.0  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   661   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   647   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   644   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   639   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   602   0.0  
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   588   0.0  
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   543   e-175
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   528   e-169
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   469   e-147
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   474   e-146
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   410   e-124
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     388   e-115
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   189   1e-49
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   180   2e-48
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   185   5e-48
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   182   1e-47
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   181   1e-47
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   181   2e-47
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   179   4e-47
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   181   8e-47
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   178   2e-46
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    179   4e-46
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   175   2e-45
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   175   3e-45
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   174   5e-45
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   174   6e-45
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   174   6e-45
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   174   6e-45
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   174   9e-45
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   172   1e-44
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   171   4e-44
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   170   6e-44
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    38   0.11 
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    38   0.15 
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    37   0.22 
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    36   0.55 
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    35   1.5  
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    34   1.6  
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    33   4.5  
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    32   6.9  
SAKL0F10076g Chr6 complement(773641..775002) [1362 bp, 453 aa] {...    32   7.0  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    32   7.2  

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score = 2028 bits (5254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 998/1115 (89%), Positives = 998/1115 (89%)

Query: 1    MQSKESAXXXXXXXXXXXXXXXXXXEYNSPGIYQHMVPQFMNSQPMYYPTGPVMNAPPTP 60
            MQSKESA                  EYNSPGIYQHMVPQFMNSQPMYYPTGPVMNAPPTP
Sbjct: 1    MQSKESAQQPSLSPQQRHHQQQLHREYNSPGIYQHMVPQFMNSQPMYYPTGPVMNAPPTP 60

Query: 61   FDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXYSHNQSKSSSGRSFGKLA 120
            FDTAYGVTLLPSHLLMGSPFVSSPNLF               YSHNQSKSSSGRSFGKLA
Sbjct: 61   FDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQRLQQYSHNQSKSSSGRSFGKLA 120

Query: 121  TAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEF 180
            TAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEF
Sbjct: 121  TAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEF 180

Query: 181  RTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHVSILLSFFSKAICLDFYNS 240
            RTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHVSILLSFFSKAICLDFYNS
Sbjct: 181  RTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHVSILLSFFSKAICLDFYNS 240

Query: 241  VLQRLSEYKSDLDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXXXAFNITAAGSLRYDVI 300
            VLQRLSEYKSDLDSKALTLSFVSLEYKV                 AFNITAAGSLRYDVI
Sbjct: 241  VLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDIDKEDDSKPDAFNITAAGSLRYDVI 300

Query: 301  NRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAV 360
            NRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAV
Sbjct: 301  NRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAV 360

Query: 361  LTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGN 420
            LTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGN
Sbjct: 361  LTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGN 420

Query: 421  YRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHL 480
            YRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHL
Sbjct: 421  YRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHL 480

Query: 481  TNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAXXXXXXXX 540
            TNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDA        
Sbjct: 481  TNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAVPPSMVPM 540

Query: 541  XXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIH 600
                   YGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIH
Sbjct: 541  STMPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIH 600

Query: 601  PRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKV 660
            PRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKV
Sbjct: 601  PRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKV 660

Query: 661  GWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLR 720
            GWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLR
Sbjct: 661  GWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLR 720

Query: 721  DDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIG 780
            DDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIG
Sbjct: 721  DDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIG 780

Query: 781  YGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFL 840
            YGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFL
Sbjct: 781  YGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFL 840

Query: 841  QFGSLGITIDSNGXXXXXXXXXXXXXXXXXXXSNSPKKTVEQASGKESDQEEQELLKLSN 900
            QFGSLGITIDSNG                   SNSPKKTVEQASGKESDQEEQELLKLSN
Sbjct: 841  QFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSPKKTVEQASGKESDQEEQELLKLSN 900

Query: 901  KSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKSDASSDVELIIXXXXXXXXXX 960
            KSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKSDASSDVELII          
Sbjct: 901  KSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKSDASSDVELIINSPEEEESNF 960

Query: 961  XXXXXRGFRKNDRRKLANCAEGASSKERFKSTTNDVXXXXXXXXXEANPPMAPATISRNY 1020
                 RGFRKNDRRKLANCAEGASSKERFKSTTNDV         EANPPMAPATISRNY
Sbjct: 961  KSKSNRGFRKNDRRKLANCAEGASSKERFKSTTNDVSSALSSSSLEANPPMAPATISRNY 1020

Query: 1021 SLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTXXXXXXXXXHGKSIPGSDVMA 1080
            SLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQT         HGKSIPGSDVMA
Sbjct: 1021 SLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTRRRRYPNRRHGKSIPGSDVMA 1080

Query: 1081 QYLAQLQHSTFIYAANILGASNDGDNNYLDENADS 1115
            QYLAQLQHSTFIYAANILGASNDGDNNYLDENADS
Sbjct: 1081 QYLAQLQHSTFIYAANILGASNDGDNNYLDENADS 1115

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
            {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
            YML117W NAB6 Putative RNA-binding protein based on
            computational analysis of large-scale protein-protein
            interaction data
          Length = 1259

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/963 (50%), Positives = 610/963 (63%), Gaps = 87/963 (9%)

Query: 146  RGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTN 205
            R  H +  Q+  A K FK+PF++TYR+LPKG+DE+RTRSLLFENV+GS+DL+SFV+ ++ 
Sbjct: 195  RNRHRRRAQNEQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSR 254

Query: 206  YGPVESVYLFKSEGDHV--SILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVS 263
            YGPVES+Y+FK   D    S+LLSF S+ ICLD YNSVLQRL+E+K+ L SK+LT+SFVS
Sbjct: 255  YGPVESIYMFKDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVS 314

Query: 264  LEYKVX----------------------XXXXXXXXXXXXXXXXAFNITAAGSLRYDVIN 301
            L+Y+                                        A+N+T   SL+YD++N
Sbjct: 315  LKYRKHVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVN 374

Query: 302  RGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVL 361
            RGATRS+ +       K +L+D++L+FL   NN RYVLESI L+ A EP KHFP+NYA+L
Sbjct: 375  RGATRSVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAIL 434

Query: 362  TFLNIFMAVEILDYIRLH-SQKLDISKCFFISIQ--PQIP-DGKRLSVSSA--------S 409
            TFLNI MAVE+LDY+R + + +    KCFF+S+   PQ   DG  ++ S++        S
Sbjct: 435  TFLNISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGS 494

Query: 410  NGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYK 469
             G +     G Y SKNAS++SL S GS ISLDQEID ++  L+  ++    + V  + Y 
Sbjct: 495  AGIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHT----ITVAVDEYP 550

Query: 470  DPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQD 529
             P F   +DHL+N +V EA++LD+Q++ P PQEV     ++P+QD PL   +  AP +  
Sbjct: 551  KPFFAEFSDHLSNASVLEASALDTQISSPHPQEV-----IVPSQDSPL---VGGAPPLDA 602

Query: 530  VD-----AXXXXXXXXXXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASS 584
            V      A                G YM P   R+N  M KPITQSLQ+Q+ATSAEVA+S
Sbjct: 603  VHPAATPALSSQVLPLQPHMAMNSGIYMEPFG-RRNKTMIKPITQSLQKQFATSAEVANS 661

Query: 585  MGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYT 644
            MGGGIGNRTVYIGNIHPRS+ EDICNVVRGGILQ+++FL +K ICFVTF+EAS AVQFYT
Sbjct: 662  MGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYT 721

Query: 645  NAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQY 704
            NAFIDPIVLHGNMLKVGWGHHSGPLPKS++LAVTVGASRNVYVSLP+FAFKDKYI DPQY
Sbjct: 722  NAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQY 781

Query: 705  EEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGG 764
            + Y+ +++LP EEQLR+DF+ +GDIEQIN+L+DGHCCWVNF NIS+AIKLVEE+KY  G 
Sbjct: 782  QRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGE 841

Query: 765  NFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQH 824
             F+K    RY GL+IGYGKDRCGNVNKN I+GKNSRFYKKVKKPS+NIRLS+MEEER++H
Sbjct: 842  AFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKH 901

Query: 825  EETLRRQQENNSEKFLQFGSLGITIDS------------NGXXXXXXXXXXXXXXXXXXX 872
            EETLR Q +NN EK LQFGSLGI ++             NG                   
Sbjct: 902  EETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKTSYERSLNGEEEEEQEEVEPNEAEKANG 961

Query: 873  SNSPKK-----------------TVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQG 915
                +K                 +    SG++  +EE+ELLKLSNKSQ   GL I    G
Sbjct: 962  EGGREKDEDNNQEPMNPISKDGNSENHGSGEKYQEEEKELLKLSNKSQIIDGLGIAAVAG 1021

Query: 916  QS---TREKEATKLTRNHSENDETSAKSDASSDVELIIXXXXXXXXXXXXXXXRGFRKND 972
                    ++   L R H   DE S  S  SS+VELI+               +  +   
Sbjct: 1022 NGKDMVASQDQDILDRAHESGDEESLDSGVSSNVELILHSPLEGDSNNQKKHEKNNKPFK 1081

Query: 973  RRKLANC-AEGASSKERFKSTTNDVXXXXXXXXXEANPPMAPATISRNYSLMFKQQYNHE 1031
             +KL N  A G      + S+  +            NPP+AP+TISRNYSLM K Q  H 
Sbjct: 1082 SKKLENVSATGTGDVSNYNSSLGEGASAVSNPSISMNPPIAPSTISRNYSLMMKTQNGHP 1141

Query: 1032 KLR 1034
              R
Sbjct: 1142 HPR 1144

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/46 (69%), Positives = 41/46 (89%)

Query: 1069 HGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDENAD 1114
            + K+IPGSDVMAQYLAQLQHSTF+YAANILGA+ +GD +Y ++N +
Sbjct: 1213 NAKAIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTE 1258

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 41/71 (57%), Gaps = 24/71 (33%)

Query: 39  QFMNSQPMYYPTGPVMN-----APPTP-----------------FDTAYGVTLLPSHLLM 76
           + M + PM +P  PV +     APP P                 FDTAYG+TLLPSHLL+
Sbjct: 45  RVMANSPMAFP--PVGSLQAQYAPPQPAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLI 102

Query: 77  GSPFVSSPNLF 87
           GSPFVSSP+LF
Sbjct: 103 GSPFVSSPDLF 113

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/903 (45%), Positives = 537/903 (59%), Gaps = 130/903 (14%)

Query: 44  QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXY 103
            P YY   P+ N PPTPFDTAYG +LLPSHLLMGSPFVSSPN+                Y
Sbjct: 51  HPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAY 110

Query: 104 SHNQSKSSSGRSFGKLATAYP----VPPS----------LNSPPASRNALHN-------- 141
           S   S  ++                V PS            +  ++RN+ HN        
Sbjct: 111 SRPVSNHNNYNGNNNSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHNNKGCDNRN 170

Query: 142 ----RGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLH 197
               R   R + +  I S    +R   PF + Y++LP G+D +RTRSLL ENVD S DLH
Sbjct: 171 SSGRRTSTRNNIFDDISSELLLQR---PFRINYKILPTGDDAYRTRSLLIENVDRSTDLH 227

Query: 198 SFVTNFTNYGPVESVYLFKSE---------GDHVSILLSFFSKAICLDFYNSVLQRLSEY 248
           S V NF     +ES Y+  +E           ++SIL+SF +++ CL+FYN++LQRLSE+
Sbjct: 228 SIVKNFVKSNTLESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEF 287

Query: 249 KSDLDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXXXAFNIT-----AAGSLRYDVINRG 303
           K+ L S++L L FV L Y                     +IT      + SL +D+ N+ 
Sbjct: 288 KTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKD 347

Query: 304 ATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTF 363
           ATRSI++ FK+P    EL +KKL+FL + NN RY+LESID+V  D PS  FP+NYAVLTF
Sbjct: 348 ATRSIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTF 407

Query: 364 LNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSA--------------- 408
           LNIFMA+E+LDY++ +S+KL ISKCF++S+ P +    R SV++                
Sbjct: 408 LNIFMAIEVLDYLKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSV 467

Query: 409 -------------------------SNGRSMESISGNYRSKNASVTSLESSGSIISLDQE 443
                                    SN  +  S+ GN    N S+ SL SS   +SL++E
Sbjct: 468 PVENNNDNNNSNNHKSNISDANTHNSNNSTRASLYGN---SNVSLASLPSS---VSLNEE 521

Query: 444 IDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEV 503
           ID +T KLQ +      LE+  ++Y+ P+   H+ HL+NV +S+      Q     P  +
Sbjct: 522 IDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPL 581

Query: 504 TVNEYVLPNQDMPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYGCYMPPP---NVRQN 560
            +NE +  N      N  N +   Q + A                    P P    ++ N
Sbjct: 582 PLNERMFMNDS----NHSNGSIVPQQLMAT-------------------PSPVSSTIQMN 618

Query: 561 GN-MTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQN 619
              +  PITQSL++ +  SA+VASSMG  +GNRT+YIGNI+PRSR EDICNVVRGGILQ+
Sbjct: 619 QRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQS 678

Query: 620 VKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTV 679
           +K++ EKRICFVTF+EA +AVQFY N+FIDPIVLHGNML+VGWGH+SGPLPKSI+LAVT+
Sbjct: 679 IKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTI 738

Query: 680 GASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGH 739
           GASRNVYVSLPEFAFK+K+I+DPQY++ ++   LPD EQLR+DFS YGDIEQINYL+D H
Sbjct: 739 GASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSH 798

Query: 740 CCWVNFTNISAAIKLVEEVKYEGGGN-----------FYKMLGGRYDGLVIGYGKDRCGN 788
           CCW+NF NIS+AI LVEE+  E   +             K  GGRY+GL+I YGKDRCGN
Sbjct: 799 CCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGN 858

Query: 789 VNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGIT 848
           +NKN +AGKNSRFYKKVK+PS+NIRLSK+EE RRQ+E     ++E   +K L   SLGI+
Sbjct: 859 INKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND---KKERAFDKALNLESLGIS 915

Query: 849 IDS 851
           +DS
Sbjct: 916 LDS 918

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 59/105 (56%), Gaps = 24/105 (22%)

Query: 1009 PPMAPATISRNYSLMFKQQYNHEKLRDF--EGESFDDESQQESNFDFESTQQTXXXXXXX 1066
            PP AP+T+S N     + + N   +RD    GE+  +  +   +F               
Sbjct: 1049 PPRAPSTLSYN-----RSKKNETPIRDIVPNGETTSNRKKNRGSF--------------- 1088

Query: 1067 XXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
                ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN + +E
Sbjct: 1089 -PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNTHTEE 1131

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/893 (45%), Positives = 536/893 (60%), Gaps = 108/893 (12%)

Query: 44  QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXY 103
            P YY   P+ N PPTPFDTAYG +L PSHLLMGSPFVSSPN+                Y
Sbjct: 51  HPAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAY 110

Query: 104 S-----HNQSKSSSGRSFGKLATAYPVPPSL---------NSPPASRNALHNRGPRRGSH 149
           S     HN    +S  +          P +           +  ++RN  HN      + 
Sbjct: 111 SRPVSNHNGYNGNSNSNQNNTNNGMVTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTR 170

Query: 150 YKSIQSSDASKRFKD----------PFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSF 199
             S + + A     D          PF + Y+VLP G+D +RTRSLL ENVD SIDLHS 
Sbjct: 171 NNSGRRTFARNNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSI 230

Query: 200 VTNFTNYGPVESVYLFKS---------EGDHVSILLSFFSKAICLDFYNSVLQRLSEYKS 250
           V NF     +ES YL +          E  ++SIL+SF +K  CL+FYN++LQRLSE+K+
Sbjct: 231 VKNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKT 290

Query: 251 DLDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXXXAFNIT-----AAGSLRYDVINRGAT 305
            L S+AL L FV L Y                     +IT      + SL +++ N+ AT
Sbjct: 291 FLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDAT 350

Query: 306 RSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLN 365
           RSI+I FK+P  K +L  KKL+FL +  N RY+LESIDLV  D PS  FP+NYAVLTFLN
Sbjct: 351 RSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLN 410

Query: 366 IFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGR------SMESISG 419
           I MA+E+LDY++ +S+ L ISKCF++S+ P +    R SV++   G+      S+ S++ 
Sbjct: 411 ISMAIEVLDYLKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTA 470

Query: 420 NYRSKN-----------ASVTSLESSGSI-ISL-----------------DQEIDEMTYK 450
              + +           + +T+L ++ SI +S+                 ++EID +  K
Sbjct: 471 GNNNDSNNNGNNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLSSSVSLNEEIDMLATK 530

Query: 451 LQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVL 510
           LQ V      LE+   +Y+ P+ E H+ HL+NV +S+      Q +   P  + +NE++ 
Sbjct: 531 LQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMF 590

Query: 511 PNQDMPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYGCYMPPPNVRQNGN-MTKPITQ 569
            N      N  N A   Q + A                      PN++ N   +  PITQ
Sbjct: 591 MNDS----NQSNGAIIPQQLIATPSPVS----------------PNLQMNQRVLPNPITQ 630

Query: 570 SLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRIC 629
           SL++ +  SA+VASSMG  IGNRT+YIGNI+PRS+ EDICNVVRGGILQ++K++ EK+IC
Sbjct: 631 SLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKIC 690

Query: 630 FVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSL 689
           FVTF+EA +AVQFY N+FIDPIVLHGNML+VGWGH+SGPLPK I+LAVT+GASRNVYVSL
Sbjct: 691 FVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVSL 750

Query: 690 PEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNIS 749
           PEFAFK+K+I+DPQY++ ++   LPD EQLR+DFS YGDIEQINYL+D HCCW+NF NIS
Sbjct: 751 PEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNIS 810

Query: 750 AAIKLVEE------VKYEGGGNFYKM-----LGGRYDGLVIGYGKDRCGNVNKNFIAGKN 798
           +AI LVEE      V+ E G    K       GGRY GL+I YGKDRCGN+NKN IAGKN
Sbjct: 811 SAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGKN 870

Query: 799 SRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDS 851
           SRFYKKVK+PS+NIRLSK+EE+RRQ+E     ++E   +K L   SLGI++D+
Sbjct: 871 SRFYKKVKRPSYNIRLSKLEEKRRQNE---IDEKEKAFDKPLNLESLGISLDA 920

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 62/105 (59%), Gaps = 24/105 (22%)

Query: 1009 PPMAPATISRNYSLMFKQQYNHEKLRDF--EGESFDDESQQESNFDFESTQQTXXXXXXX 1066
            PP AP+T+S N+S     + N   ++D    GE+ ++  ++  +F               
Sbjct: 1052 PPRAPSTLSYNHS-----KNNETPMQDIFTNGETANNRKKKRGSF--------------- 1091

Query: 1067 XXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
                ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN + DE
Sbjct: 1092 -ARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNTHPDE 1134

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/897 (45%), Positives = 531/897 (59%), Gaps = 128/897 (14%)

Query: 44  QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXY 103
            P YY   P+ N PPTPFDTAYG +LLPSHLLMGSPFVSSPN+                Y
Sbjct: 51  HPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAY 110

Query: 104 SHNQSKSS---------------------------SGRSF--GKLATAYPVPPSLNSPPA 134
           S   S  +                           +GR+    K   A  V  +++    
Sbjct: 111 SRPISSQNSYNANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYE 170

Query: 135 SRNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSI 194
           +RN+    G R  S        D     + PF + Y++LP G+D +RTRSLL ENVD S 
Sbjct: 171 TRNS---SGRRTSSRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSA 227

Query: 195 DLHSFVTNFTNYGPVESVYLF---------KSEGDHVSILLSFFSKAICLDFYNSVLQRL 245
           DLHS V NF     +ES Y+          K E  ++SIL+SF ++  CL+FYN++LQRL
Sbjct: 228 DLHSLVKNFVKSNALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRL 287

Query: 246 SEYKSDLDSKALTLSFVSLEYK-------VXXXXXXXXXXXXXXXXXAFNITAAGSLRYD 298
           SE+K+ L SK+L L FV L Y        V                 +  I+A  SL +D
Sbjct: 288 SEFKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISA--SLHHD 345

Query: 299 VINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNY 358
           V N+ ATRSI+I FK+P  K EL  +KL+FL +  N RY+LESID+V  D PS  FP+NY
Sbjct: 346 VENKDATRSIIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENY 405

Query: 359 AVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESIS 418
            VLTFLNIFMA+E+LDY++ +S+KL ISKCF++S+ P +     +S + +S     ES S
Sbjct: 406 VVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLTPLM-----VSSARSSVASIYESKS 460

Query: 419 GNYRSKNASVTSLESSGSIISL-----------------------------DQEIDEMTY 449
            ++R    SV +  ++                                   ++EI+ +T 
Sbjct: 461 SSHRLSTPSVPAGNNNDINNINNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTT 520

Query: 450 KLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYV 509
           KLQ ++    ILEVT ++Y  P    H+ HL+N+ +S+      Q T   P  + +NE++
Sbjct: 521 KLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHM 580

Query: 510 L---PNQD--MPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYGCYMPPPNVRQNGNMT 564
                NQ     +   +  APS Q                        P P + Q   + 
Sbjct: 581 FMTDSNQSNGTIVSQQLITAPSPQS-----------------------PNPQMNQRV-LP 616

Query: 565 KPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLA 624
            PITQSL++ +  SA+VASSMG  IGNRT+YIGNI+PRSR EDICNVVRGGILQN+K++A
Sbjct: 617 NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIA 676

Query: 625 EKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRN 684
           EKRICFVTF+EA++AVQFY N+FIDPIVLHGNML+VGWGH+SGPLPKSI+LAVT+GASRN
Sbjct: 677 EKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 736

Query: 685 VYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVN 744
           VYVSLPEFAFK+K+I+DPQY++ ++   LPD EQLR+DFS YGDIEQINYL+D HCCW+N
Sbjct: 737 VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 796

Query: 745 FTNISAAIKLVEEVKYEGGGN-----------FYKMLGGRYDGLVIGYGKDRCGNVNKNF 793
           F NIS+AI LVEE+  E  G+             +   GRY GL+I YGKDRCGN+NKN 
Sbjct: 797 FMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNL 856

Query: 794 IAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITID 850
           +AGKNSRFYKKVK+PS+NIRLSK+EE RRQ+E      ++ + +K L   SLGI++D
Sbjct: 857 VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNE----NDKKESFDKVLNLESLGISLD 909

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 62/105 (59%), Gaps = 24/105 (22%)

Query: 1009 PPMAPATISRNYSLMFKQQYNHEKLRD--FEGESFDDESQQESNFDFESTQQTXXXXXXX 1066
            PP AP+T+S N+S     + N   ++D     E  D+++++  +F               
Sbjct: 1040 PPRAPSTLSHNHS-----KKNQMPIQDAGINAEVTDNKTKKRGSF--------------- 1079

Query: 1067 XXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
                ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN Y DE
Sbjct: 1080 -PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNAYSDE 1122

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/857 (44%), Positives = 524/857 (61%), Gaps = 79/857 (9%)

Query: 39  QFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXX 98
           Q+  +Q  YY T P+ N PPTPFDTAYG TLLPSHLLMGSPFV++P              
Sbjct: 61  QYFPTQQPYYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATP---------TTGHS 111

Query: 99  XXXXYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKS-IQSSD 157
               +      + +  SF ++ +   V    N P A R    N   RR S Y+S +  +D
Sbjct: 112 QSAIFQQPYMMTPNRASFSQIPSMLNVG---NPPSARRQGNQNDPNRRRSSYRSKVPETD 168

Query: 158 ASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFK- 216
               F  PF ++Y++LP G+D +RTRSLLFENV  SI+LH+F+T F  + P+ESVYL   
Sbjct: 169 PKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINH 228

Query: 217 -------SEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVX 269
                   + +  SILLSF ++ +CL FYN+VLQRL E+K+ L S+ L LSFVS++Y+  
Sbjct: 229 HDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDE 288

Query: 270 XXXXXXXXXXXXXXXXAFNITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFL 329
                             +     S+ +++ N  ATRSI+I FK PCS+ EL DKKL+FL
Sbjct: 289 NEEEETNIVDEP------SFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFL 342

Query: 330 KKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCF 389
            +ENN+RY+LESIDLV   +    FP++YA+LTF+NI MA+EI DY+++H  +  I  C 
Sbjct: 343 NQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCM 402

Query: 390 FISIQPQ---IPDGKRLSVSSASNGRSMESISGNYRS----KNASVTSLESS-GSIISLD 441
           F+ + P+       KR S+ S  N  + E++S   +     KN+S+ SL S+    +S +
Sbjct: 403 FVQVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDE 462

Query: 442 QEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAAS---LDSQLTMP 498
           +++D+++ KL+S N ++ IL V T  Y  PSF  H +HL N T+S ++S    + QL   
Sbjct: 463 EKLDKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQQLPYS 522

Query: 499 ----SPQEVTVNEYVLP-NQDMP-LPN----------DMNYAPSVQDVDAXXXXXXXXXX 542
                 Q   V    LP N   P +PN          +MNY   +   +           
Sbjct: 523 YEEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPN----------- 571

Query: 543 XXXXXYGCYMPPP------NVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYI 596
                 G ++  P      N   N N   PI+++L++   T+++V +S+G   GNRT+YI
Sbjct: 572 ------GYFVNDPAFSMNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYI 625

Query: 597 GNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGN 656
           GNI+ RS+ EDICNVVRGGILQNVK++  K ICF+TF+EASAA+ FY N+FIDPIVLH +
Sbjct: 626 GNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNH 685

Query: 657 MLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDE 716
            LK+GWG++  PLPK++ALAVTVGASRNVYVSLPEFAFKDK+I DP+Y+EY++K++LP  
Sbjct: 686 TLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQA 745

Query: 717 EQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDG 776
           +QLR DFS YG IEQINYL D HCCWVNF NISAAI+LVE+        F +    RYDG
Sbjct: 746 DQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDG 805

Query: 777 LVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLR--RQQEN 834
           L+I YGKDRCGNVNK+ ++ KNSRFYKKVK  S N++L ++EE+R+   E L   R+  +
Sbjct: 806 LIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSS 865

Query: 835 NSEKFLQFGSLGITIDS 851
           +  +  +  + GI ID+
Sbjct: 866 SDGQLSKLDAFGIGIDT 882

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (85%), Gaps = 1/42 (2%)

Query: 1070 GKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
             + IPGSDVMAQYLAQLQHSTF+YAANILGAS + D +Y DE
Sbjct: 1038 ARVIPGSDVMAQYLAQLQHSTFMYAANILGASAE-DGSYYDE 1078

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/880 (45%), Positives = 535/880 (60%), Gaps = 123/880 (13%)

Query: 44  QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXY 103
           Q  YY   P+ NAPPTPFDTAYG TLLPSHLLMGSPF+SSPN+                 
Sbjct: 61  QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV--PTPQQQYFLQQQFNT 118

Query: 104 SHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDAS---- 159
           ++N   S+  +SF K++         N P +SR++  +   +R S   +  +++ S    
Sbjct: 119 NNNNGSSTPRKSFFKVS---------NRPISSRSSRFSE--KRKSFIINNPTTNNSNNNN 167

Query: 160 -------KRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESV 212
                  K F +P  ++Y +LPKG+D +RTRSLLFENVD +I+LHSF+TNF     +ES+
Sbjct: 168 NNKEILEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESI 227

Query: 213 YLF--KSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXX 270
           YL   K++ +   I+LSF S+ ICLDFYN+VLQRL E+K  L+S++L L+FVSL+Y    
Sbjct: 228 YLVPNKNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTT 287

Query: 271 XXXXXXXXXXXXXXXAFNITAAGSLRYDVINRGATRSIMITFKTPCS---------KDEL 321
                                  SL ++++ R ATRS+ I     CS         K++L
Sbjct: 288 RD-----------------NQGPSLEFNIVTRDATRSLAIEL---CSNENDSLILEKEQL 327

Query: 322 IDKKL-EFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHS 380
            +K L E L+ + N RYVLESIDLV+ D+ +K F +NYA+L+FLNI MA+EI+DYI++ S
Sbjct: 328 FEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVIS 387

Query: 381 QKLDISKCFFISIQPQIPD---GKRLSVSSASNGRSMESISGNYRSKNASVTSLESS--- 434
            KL+I KC F++IQP I +       ++SSA+N +S  S  GN    N   T    +   
Sbjct: 388 SKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIQSSVSSEGNNNQNNNGSTFFHKNSIN 447

Query: 435 -----GSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAA 489
                 S +S+D+E+  +  KL+ +  K   L++   +Y +P F   TDHL NVT+S   
Sbjct: 448 SLLSSESSVSIDEEVISIADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT 507

Query: 490 SLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYG 549
            LD     P  QE+ +N       DM        +PS + +D                  
Sbjct: 508 QLDQIPGTPRTQEIYIN-------DM--------SPSFEGIDMMNSSSTMLSGNGTFISN 552

Query: 550 CYMPPPN----VRQNGNMTK----------PITQSLQRQYATSAEVASSMGGGIGNRTVY 595
             M  P+    + QN  + +          PIT SL+ Q +TSA+VAS+MG   GNRT+Y
Sbjct: 553 TPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIY 612

Query: 596 IGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHG 655
           IGNI+PRS+ EDICNVVRGGILQ++KF+  K ICFVTF+EA+AAVQFY NAFIDPIVLHG
Sbjct: 613 IGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHG 672

Query: 656 NMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPD 715
           N LK+GWG++SGPLPKSIALAVT+GASRNVYVSLPEFAFKDKYI DP+++EY++KF+LPD
Sbjct: 673 NTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPD 732

Query: 716 EEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYD 775
            EQLR DFS YG  EQINYL+D HCCWVNF NIS+AIKLVEE   +    F +    RY+
Sbjct: 733 PEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATND-FDRFNEKFDERYN 791

Query: 776 GLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHE---------- 825
           GLVI YGKDRCGN+NKN IAGKNSRFYK   + + N +LSK+EE+RR H+          
Sbjct: 792 GLVINYGKDRCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLEEKRRDHDRRENGFKHVY 849

Query: 826 --------ETLRRQQENNSE------KFLQFGSLGITIDS 851
                   E++    ++N E      KFLQ  SLGI+++S
Sbjct: 850 NDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLES 889

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 2/40 (5%)

Query: 1072 SIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
            +IPGSDVMAQYLAQLQHSTF+YAANILGAS  G+  Y DE
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGAS--GEEEYYDE 1033

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1075 (38%), Positives = 570/1075 (53%), Gaps = 198/1075 (18%)

Query: 61   FDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXYSHNQSKSSSGRSFGKLA 120
            FD AYG TLLPSH+LM SPFVS+PN                 Y   Q+  S G S+ +  
Sbjct: 112  FDYAYGTTLLPSHILMNSPFVSTPN---------------KSYLSFQASPSRGISYNRRN 156

Query: 121  T---AYPVPPSLNSPPASRNALHNRGPR-RGSHYKSIQSSDASKRFKDPF--------IL 168
            +    +P PP + SP    + + ++  R +  +Y+ + + D  KR ++ F         +
Sbjct: 157  SNQMVFPNPPIITSP----HLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKI 212

Query: 169  TYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDH----VSI 224
            +Y++LPKG+D + TRSLLFEN++ SIDLH+F+  F NYG +ESVY+  S   H     SI
Sbjct: 213  SYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSI 272

Query: 225  LLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXX 284
            LLSF S++ICLDFYNSVLQ+LSEYK+ L+S+ L LSFVSL Y                  
Sbjct: 273  LLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQK 332

Query: 285  XAFNITAAGSLRYDVINRGATRSIMITFKTPCSK-DELIDKKLEFLKKENNTRYVLESID 343
               +      ++Y V N GATRS+ I F     K D+ I+  L FL    N RY++ES+ 
Sbjct: 333  NETDFELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLY 392

Query: 344  LVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRL 403
            +V  +     FP +Y +L+FLNI M +E+L YIR  +    I  C ++S      D  + 
Sbjct: 393  IVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSF-----DRTKH 447

Query: 404  SVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEID-------------EMTYK 450
            +VS+++     +S+S    S   +  +LES    I+ + E+D             E+  K
Sbjct: 448  AVSNSN----RQSLSKKGTSDTLNTYTLESP---INHNTEVDMNDIPSIYDENEIEIANK 500

Query: 451  LQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVL 510
            L  +  + +   +  +NY +P  E   +HL NV++S    + +     SP          
Sbjct: 501  LSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSP---------- 550

Query: 511  PNQDMPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYGCYMPPPNVRQNGNM--TKPIT 568
                          PS    +                Y       N++   N     P+ 
Sbjct: 551  --------------PSGYMENMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLP 596

Query: 569  QSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRI 628
            Q+LQ Q+ATSAE+AS MGGG+GNRT++IGNI+PRS+TEDICNV RGGI+Q VK++ EK I
Sbjct: 597  QTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNI 656

Query: 629  CFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVS 688
            CFV F++  AA QFY N+FIDPI+LH N LK+GWG H GPLPK+I LAVT GASRNVYVS
Sbjct: 657  CFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVS 716

Query: 689  LPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNI 748
            LPEFAFKDKYI DP Y+EY+ K+ LP E+QLR+DFS +G++EQIN+L D HCCW+NFTNI
Sbjct: 717  LPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNI 776

Query: 749  SAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKP 808
             +AIKLVE VK E   NF++    RY GL+IGYGKDRCGNVNK+ ++ KNSR+++KVKKP
Sbjct: 777  RSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKP 836

Query: 809  SFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGXXXXXXXXXXXXXXX 868
            S+NIRL ++EEER++++E   +Q +N   K +   SLGIT                    
Sbjct: 837  SYNIRLQQLEEERKRNDEI--KQIDN---KRINLDSLGITT------------------- 872

Query: 869  XXXXSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREKEATKLTR 928
                  SP + +          +E E L L+        L +    G    E E+     
Sbjct: 873  ------SPNQNI----------QEDETLSLA-------KLKLTSDTGFKNSENES----- 904

Query: 929  NHSENDETSAKSDASSDVELIIXXXXXXXXXXXXXXXRGFR--KNDRRKLANCAEGASSK 986
                 D   + S++S+DVELII                GF+  +N + K  N   G   K
Sbjct: 905  -----DIDDSASNSSTDVELII-----------NSPGNGFKSHRNRKPKPNNLDLGERPK 948

Query: 987  ERFKSTTNDVXXXXXXXXXEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQ 1046
                               +A+ PMAP  +S +Y                          
Sbjct: 949  -------------VDAIVFKADGPMAPNKLSHDY-----------------------HRT 972

Query: 1047 QESNFDFESTQQTXXXXXXXXXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGAS 1101
              +  D   +++T         H K IPGSDVM+QYLAQ+QHSTF+YAAN+L AS
Sbjct: 973  HNTRVDNPRSERT-----RKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNAS 1022

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/751 (47%), Positives = 477/751 (63%), Gaps = 89/751 (11%)

Query: 162 FKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVY-------- 213
            + PF + Y++LP G+D +RTRSLL ENVD S DLHS V NF  +  +ES Y        
Sbjct: 192 LQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKND 251

Query: 214 -LFKSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYK---VX 269
            L   E +++S+L+SF +++ CL+FYN++LQRLSE+K  L SK+L L FV L Y+   + 
Sbjct: 252 DLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLS 311

Query: 270 XXXXXXXXXXXXXXXXAFN--ITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLE 327
                           A N  +  + SL +DV N+ ATRSI+I FK+   K EL  K+L+
Sbjct: 312 TFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRKRLQ 371

Query: 328 FLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISK 387
           FL +  N RY+LESIDLV  D PS  FP+NYAVLTFLNIFMAVE+LDY++  S+ L+ISK
Sbjct: 372 FLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISK 431

Query: 388 CFFISIQPQIPDG---------------KRLSVSSASNGRSMESISGNYRSKNASVTSLE 432
           CF++S+ P +                  +RLSV S   G   ++ + + +   +S+ +  
Sbjct: 432 CFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKNDNNNNSNKGNISSINAQN 491

Query: 433 SSGSIIS------------------LDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFE 474
           ++ SI S                  L++EID +T KLQ +      LE+T+++Y  P+  
Sbjct: 492 NNSSIGSSIYGNSNISLTSLSSSVSLNEEIDLLTTKLQGIELDGTSLEITSHDYSTPTIN 551

Query: 475 GHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAXX 534
            H+ HL+N+ +S+            P  + +NE +  N      N  N A   Q + A  
Sbjct: 552 EHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDS----NQSNGAVIPQQLIAA- 606

Query: 535 XXXXXXXXXXXXXYGCYMPPP---NVRQNGN-MTKPITQSLQRQYATSAEVASSMGGGIG 590
                             P P   N++ N   +   ITQSL++ +  SA+VASSMG  +G
Sbjct: 607 ------------------PSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVG 648

Query: 591 NRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDP 650
           NRT+YIGNI+PRSR EDICNVVRGGILQ++K++ EKRI FVTF+EA +AVQFY N+FIDP
Sbjct: 649 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDP 708

Query: 651 IVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKK 710
           IVLHGNML+VGWGH+SGPLPKSI+LAVT+GASRNVYVSLPEFAFK+K+I+DPQY++ ++ 
Sbjct: 709 IVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHET 768

Query: 711 FRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVK------YEGGG 764
             LPD EQLR+DFS YGDIEQINYL+D HCCW+NF NIS+AI LVEE+       ++GG 
Sbjct: 769 LALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGE 828

Query: 765 NFYKMLG-----GRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEE 819
              K  G     GRY GL+I YGKDRCGN+NKN +AGKNSRFYKKVK+PS+NIRLSK+EE
Sbjct: 829 VIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEE 888

Query: 820 ERRQHEETLRRQQENNSEKFLQFGSLGITID 850
            RRQ+E      ++ + +K L   SLGI++D
Sbjct: 889 RRRQNE----NDKKESFDKVLNLESLGISLD 915

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 59/103 (57%), Gaps = 21/103 (20%)

Query: 1009 PPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTXXXXXXXXX 1068
            PP AP+T+S          Y+H K  +    SF D    E+  + E  + +         
Sbjct: 1047 PPRAPSTLS----------YDHLKKSE---TSFQDSRNAETANNRERKRGSLPRH----- 1088

Query: 1069 HGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
              ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN Y +E
Sbjct: 1089 --RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNAYSEE 1128

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1109 (38%), Positives = 591/1109 (53%), Gaps = 157/1109 (14%)

Query: 35   HMVPQFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXX 94
            H  PQ  N    + P  P+ N  PTPFDTAYG TLLPSHLLMGSPFVS+PNL        
Sbjct: 70   HPFPQ--NFAQNFPPNSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNL-------- 119

Query: 95   XXXXXXXXYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQ 154
                    Y+  +  S +G + G  +  Y       + P   N L               
Sbjct: 120  ----PQTNYTAQRKGSHTGMANGTGSMNY-----YRTDPQIINGL--------------- 155

Query: 155  SSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYL 214
                   F+ PF ++Y++LPKG+D +RTRSLL  N+D  +DLH+FV+ F     VESVY+
Sbjct: 156  -------FQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYI 208

Query: 215  FK--SEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXXXX 272
             K   + +    LLSF S  ICL+FYN+VLQRL E+K  L + +L LSFVS+  +     
Sbjct: 209  TKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQR----- 263

Query: 273  XXXXXXXXXXXXXAFNITAAGSLRYDVINR-GATRSIMITF---KTPCSKDELIDKKLEF 328
                         A +     +L +D+  + GATRSI I F       ++DEL++KKL+F
Sbjct: 264  PTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKF 323

Query: 329  LKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKC 388
            L  E N RY+LE I +      +K F +NYA++TFL+I MA+EI+DY++L+ ++L ++K 
Sbjct: 324  LS-EGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKF 382

Query: 389  FFISIQ--PQIPDGKRLSVSSASNGRSMESISGNYRSK------NASVTSLESSGSIISL 440
            F++ +   PQ           A++  S    S     K      N S+ SL SS S  SL
Sbjct: 383  FYVQVTHPPQQSPAASQKKPHANDTESNRDTSPPNSKKDQEFFPNNSMLSLVSSESSTSL 442

Query: 441  DQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSP 500
              ++D +  KL+S+  +++ L++   +Y +P FE  ++H   +  S        +  P  
Sbjct: 443  ADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQS 502

Query: 501  QEVTVNEY-VLPNQ--DMP---LPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYGCYMPP 554
               T   +   PN     P   LP D+N++ SV ++                    ++  
Sbjct: 503  SISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPPGFIPATPSGPMSPQQQQLFLNS 562

Query: 555  PNVRQN---GNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNV 611
               +++   G    PIT SL+ Q  TS +VA++MG    NRT+YIGNI+PRSR EDICNV
Sbjct: 563  QRQQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNV 622

Query: 612  VRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPK 671
            VRGGILQN+KF+  K ICF+TF+EASAAVQFY NAFIDPIVLHGN LK+GWG ++GPLPK
Sbjct: 623  VRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPK 682

Query: 672  SIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQ 731
             IALAVT+GASRNVY+SLPE AFKDKYI DP+++ Y++ F+LP +E LR DF HYG IEQ
Sbjct: 683  PIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQ 742

Query: 732  INYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNK 791
            IN LND HCCWVNF NIS+AI+LVE+   +   +F ++   RY+GLVI YGKDRCGN+N+
Sbjct: 743  INMLNDSHCCWVNFMNISSAIRLVEDASTK-QDHFNQLFDHRYEGLVINYGKDRCGNINR 801

Query: 792  NFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDS 851
            N +AGK S+++KKVKK + ++RLS++EE+RR +++  RR+  N           G   + 
Sbjct: 802  NLVAGKTSKYHKKVKKHTRDVRLSQLEEKRR-NQDAERREMVN-----------GTIPEE 849

Query: 852  NGXXXXXXXXXXXXXXXXXXXSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIV 911
            N                       P       +G    ++E  L  L        G++I+
Sbjct: 850  N-----------------------PFDAFAINTGSAEKKDELSLDSL--------GISIM 878

Query: 912  ESQGQSTREKEATKLTRNHSENDETSA---------KSDASSDVELIIXXXXXXXXXXXX 962
            E +  S        L  +H+    T A          S +SSD+ELII            
Sbjct: 879  EVESASPISPVMGDL-EDHTNGSYTDAGIAPLNYTNNSGSSSDIELIINP---------- 927

Query: 963  XXXRGFRKNDRRKLANCAEGASSKERFKSTTNDVXXXXXXXXXEANPPMAPATISRNYSL 1022
                    ND  +     EG  S       ++              PP+AP TISR Y+ 
Sbjct: 928  -------PNDPNRSVGVLEGDPST--LSPPSDKRKLVALHEVSSPPPPLAPDTISRQYA- 977

Query: 1023 MFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTXXXXXXXXXHGKSIPGSDVMAQY 1082
              +  Y++E +    G    D    ++        +          + ++IPGSDVMAQY
Sbjct: 978  --EASYHNELV---TGNDHPDTGYGKA--------ENGRHRQQLPRNARTIPGSDVMAQY 1024

Query: 1083 LAQLQHSTFIYAANILGASNDGDNNYLDE 1111
            LAQLQHSTF+YAAN+LGASN+G   Y D+
Sbjct: 1025 LAQLQHSTFMYAANVLGASNEGTEQYDDQ 1053

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1083 (39%), Positives = 593/1083 (54%), Gaps = 147/1083 (13%)

Query: 47   YYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXYSHN 106
            YY    V  AP TPFDT+YGV+LLPSHLLM SPF+++P +                 SH 
Sbjct: 39   YYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGM----GSASPHRAGGSRSSHA 94

Query: 107  QSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPF 166
            QS S    +FG  +T   +PP    P   RN  H    R   H  S+Q        +  +
Sbjct: 95   QS-SYHTPNFG--STQLRMPP----PTEKRNFKHGSSYR---HNSSVQ--------QRAY 136

Query: 167  ILTYRVLPK----GNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHV 222
             + + +LP+    G DE+ TRSLLF N++    LH F+T F  +  VESVYL  S+    
Sbjct: 137  EVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ--QQ 194

Query: 223  SILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXXXXXXXXXXXXXX 282
            S+L+SF +K  CLDFYN VLQ+LSE+K +L SK LTL+F SL                  
Sbjct: 195  SVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLR----------------- 237

Query: 283  XXXAFNITAAGSL---RYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVL 339
                 ++    +L   + +V+  GATRS+++ F+       L+ K L F+  E   RYV+
Sbjct: 238  -----DVKTGPTLQEIKIEVLRAGATRSLILEFQDKVDL-ALLSKSLGFIVNEG-PRYVV 290

Query: 340  ESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPD 399
            E+I++V A   SKHF  +YA++ F++I MA+E ++Y++  S KL     F          
Sbjct: 291  EAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKF---------- 340

Query: 400  GKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKN 459
             + ++ +SAS     +++S +  ++ A   +   S S IS  + +  +  KLQ  +  + 
Sbjct: 341  -RYVNTTSASGKSEFQTLSSSQLNERALSNT---SDSDISGGESVASLGSKLQQTSLGEQ 396

Query: 460  ILEVTTNNYKDPSFEGHTDHLTNVTVSEAAS-------LDSQLTMPSPQEVTVNEYVLPN 512
             L V    Y  P  E  ++HL +VT+S+A +       L S  T P PQEV VN++    
Sbjct: 397  TLVVDPTQYGRPLVEERSEHLPHVTISKALNSKSSLNDLTSNTTSPQPQEVLVNDHE--- 453

Query: 513  QDMPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQ 572
                              D+                  Y P P      NM+KP+ Q+LQ
Sbjct: 454  ------------------DSSSRGSMVSLKQANSHGPAYPPIPGYPFYMNMSKPLGQTLQ 495

Query: 573  RQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVT 632
            +QY T+A+VA++MGGG+GNRTVYIGNI PRS+TEDICNVVRGGILQ+VK++  K ICFVT
Sbjct: 496  QQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVT 555

Query: 633  FVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEF 692
            F+EA++AVQF+ N+ I+PIVLHGN+LKVGWGHHSG LP+SI+LAVT+GASRNVYVSLPE 
Sbjct: 556  FIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEH 615

Query: 693  AFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAI 752
            AFKDK+I DP+Y+E+ +KF+LP +EQL +DFS +GDIE +N+L DGHCCW+NF NIS AI
Sbjct: 616  AFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAI 675

Query: 753  KLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNI 812
            KLVE+       +F++  G RY GL IGYGKDRCGNVNKN +A KNS+++KKVKK S+NI
Sbjct: 676  KLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNI 735

Query: 813  RLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGXXXXXXXXXXXXXXXXXXX 872
            RL K +++      T  + +    +K ++  + GI++                       
Sbjct: 736  RLRK-QQKGASDAPTEVKDEAKELDKPIKADAFGISVGDT-------------------- 774

Query: 873  SNSPKKTVEQASGKESDQEEQELLKLS--NKSQGAQGLNIVESQGQSTREKEATKLTRNH 930
                 + + + S +E   EE ELL+LS  N + G  G+++  S G+ T        T   
Sbjct: 775  -----QNLVRDSDEEQKLEEDELLRLSDLNNTGGGLGISLASSTGEETN-------TPVS 822

Query: 931  SENDETSAKSDASSDVELIIXXXXXXXXXXXXXXXRGFRKNDRRKLANCAEGASSKERFK 990
             E+ +  + S  SSDV++++                       R LAN  E  S+   F 
Sbjct: 823  DESSKEESVSSESSDVDILVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSA---FS 879

Query: 991  STTNDVXXXXXXXXXEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESN 1050
            +    V         +A PP+AP+T+SR Y+   K    H   R   G  F    +    
Sbjct: 880  AIIPRV----SSASLDAVPPLAPSTLSRQYTATSK----HNSRR---GSRFGTTEKSSPR 928

Query: 1051 FDFESTQQTXXXXXXXXXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLD 1110
            ++   +Q +           K+IPGSDVMAQYLAQLQHSTF+YAANILG  +DG+  + D
Sbjct: 929  YNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGV-DDGETVFYD 987

Query: 1111 ENA 1113
            EN 
Sbjct: 988  ENG 990

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/850 (42%), Positives = 506/850 (59%), Gaps = 87/850 (10%)

Query: 52  PVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXXYSHNQSKSS 111
           P  N PPTPFDTAYG +LLPSHLLMGSP +S+ NL                    Q + +
Sbjct: 45  PYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRN 104

Query: 112 SG---RSFGKLATAYPVPPSLNSPPAS--RNALHNRGPRRGSH------YKSIQSSDASK 160
           SG   +S G          SL+  P S  R   ++     GSH      +K     D +K
Sbjct: 105 SGFVLQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTK 164

Query: 161 RFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHS-FVTNFTNYGPVESVYLFK--- 216
           +   P  + YRVLP G+D ++TRSLLFENV  + ++ S F+    NY  VESVY+F+   
Sbjct: 165 KLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD 224

Query: 217 -------SEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVX 269
                  S+ D   + LSF S+   LDFYN+ LQRL ++K  L S  L++SFVS  Y   
Sbjct: 225 TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTD 284

Query: 270 XXXXXXXXXXXXXXXXAFNITAAG------SLRYDVINRGATRSIMITFKTPCSKDELID 323
                             NI  +       +L  ++ +  ATRSI I F +   +D L +
Sbjct: 285 EDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFE 344

Query: 324 KKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKL 383
           K L FL  ++N RY+LE++D+++A++ +  FP NY +LTF+NI MA+E+LDY++ +    
Sbjct: 345 K-LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTY 403

Query: 384 DISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQE 443
            +++CFF+S+    P  K    SS +      S  G   SK+ S  +L + G+ + +D+E
Sbjct: 404 SVNECFFVSL----PGCKSQRESSTTPVLGHISTEG---SKSVSEVNLANGGNTVMIDRE 456

Query: 444 IDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHL---TNVTV-----------SEAA 489
           ++ ++ +L S+  ++  L++  ++Y  P    H DH+   TN ++           +   
Sbjct: 457 LESLSDELASLKLEEKCLKIIRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEGNSGM 516

Query: 490 SLDSQLT-----MPSP----QEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAXXXXXXXX 540
            L   LT     + SP     + +++  +LPN  +P          V   DA        
Sbjct: 517 YLHDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLP----------VGGFDAPGKFPIEP 566

Query: 541 XXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIH 600
                       PP N     +  K ITQS++ +  TSA +A++MGG   NRTVYIGNI+
Sbjct: 567 ISG---------PPFN-----HTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNIN 612

Query: 601 PRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKV 660
           PRS+ EDICNVVRGGILQNVKF+ +KRICFVTF+EASAA QF  N+FIDPIVLHGN L+V
Sbjct: 613 PRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRV 672

Query: 661 GWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLR 720
           GWG+ SGPLPKSIALAVTVGA+RNVYVSLPE+AFKDK+I DP+Y+EY+++++LP +EQLR
Sbjct: 673 GWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLR 732

Query: 721 DDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIG 780
            DF+ YG+IEQINYL D HCCWVNF NI++AI+LVE++ +  G  F+K    RY+GL+I 
Sbjct: 733 KDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIIN 792

Query: 781 YGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFL 840
           YGKDRCGN+NKN IAGK S+FYKKVKKPS++IR+ KMEE+R+  E+ L  Q++N+    +
Sbjct: 793 YGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQEDNLLSQKKNS----I 848

Query: 841 QFGSLGITID 850
           Q  SLGI++D
Sbjct: 849 QLDSLGISVD 858

 Score = 63.2 bits (152), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 17/122 (13%)

Query: 981  EGASSKERFKSTTNDVXXXXXXXXXEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGES 1040
            E +SS  ++++T +              PP AP+TI+  Y     ++ ++    + +   
Sbjct: 935  ETSSSDRKYQTTNSRGDTFVPKTNLSHAPPRAPSTINMTY-----KKISYVPPLNGQAPK 989

Query: 1041 FD-DESQQESNFDFESTQQTXXXXXXXXXHGKSIPGSDVMAQYLAQLQHSTFIYAANILG 1099
             D  +  + ++ +F + Q T           + IPGSDVMAQYLAQLQHSTF+YAANILG
Sbjct: 990  MDYPKKYKRTHNNFPNQQPT-----------RPIPGSDVMAQYLAQLQHSTFMYAANILG 1038

Query: 1100 AS 1101
            AS
Sbjct: 1039 AS 1040

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/908 (40%), Positives = 516/908 (56%), Gaps = 123/908 (13%)

Query: 43  SQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXXXXX 102
           SQ  YY   P+ +AP TPFDT+YG TLLPSHLLMGSPF+S+P                  
Sbjct: 53  SQQGYYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNSSQQ 112

Query: 103 YSHNQSKSSSGRSFG----------KLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKS 152
             ++ + S++G++ G          K+   + +    + PP  +        +R +H + 
Sbjct: 113 QFYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRH 172

Query: 153 IQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESV 212
             +S  S    +P+++ +++LPKG+DE+ TRSLL  NV+ SI LH F+T F  +GP+ESV
Sbjct: 173 ETNSQPSS---EPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESV 229

Query: 213 YLFKSEGDHV-----------------------SILLSFFSKAICLDFYNSVLQRLSEYK 249
           Y+   E +                         SILLSF +K  CLDFYN+VLQ+LS++K
Sbjct: 230 YVVPEEEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFK 289

Query: 250 SDLDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXXXAFNITAAGSLRYDVINRGATRSIM 309
            DL+SK+LTL+FVSL                           +  +R DV+ +GATRSI 
Sbjct: 290 IDLNSKSLTLNFVSL--------------------------TSEDIRDDVLRKGATRSIA 323

Query: 310 ITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMA 369
           + FK   +  +L  + +E L   +N+R+V+E ID+V  + P+K+F  +YA++ F++I MA
Sbjct: 324 LEFKNSFTTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMA 381

Query: 370 VEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVT 429
           VE   Y+    +KL IS+ FF++                    S+ + S  +RS  A   
Sbjct: 382 VEASSYLLNWDEKLGISRLFFVT-------------------DSIINKSDYFRSAPA--- 419

Query: 430 SLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAA 489
           S ++S S +S+DQ ++  T KLQ +  K+  L +    Y     E H  HLT++++S+  
Sbjct: 420 SQDASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPL 479

Query: 490 SLDSQLTMPSPQEVTVNEYVLP-NQDMPLPNDMNYAPSVQDVDAXXXXXXXXXXXXXXXY 548
              +  +     +   N    P  Q+M L +  N   + +DV                  
Sbjct: 480 LSSNNNSSSVSLQGNQNLTSSPVTQEMYLHDTSN--STREDVMIQSSMASGTSN------ 531

Query: 549 GCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDI 608
             ++PPP      ++TKPI Q+LQ+Q  T+A+VAS+MGGG+GNRTVY+GNI+PRS+ EDI
Sbjct: 532 --FVPPP-PHYYMDVTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDI 588

Query: 609 CNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGP 668
           CNVVRGGILQ++KF   K +CFVTF+EA+AAVQF+ NA I+PIVLHGN+LKVGWGHH G 
Sbjct: 589 CNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGD 648

Query: 669 LPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGD 728
           L +SIALAVT+GASRNVYVSLPE+AFKDK+I DP+++E+ +K+ LP +EQLR DFS++G+
Sbjct: 649 LAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGE 708

Query: 729 IEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGN 788
           IEQINYL+DGHCCWVNF NI++AIKLVE+        F+     RY GL+IGYGKDRCGN
Sbjct: 709 IEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGN 768

Query: 789 VNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQH-EETLRRQQENNSEKFLQFGSLGI 847
           VNKN +A K SRF+KKVKK S+ IR+ K  +    + +E +   Q+N         + GI
Sbjct: 769 VNKNLVANKKSRFFKKVKKASYKIRMHKQNKAGGSNGQEPISSFQDN---------AFGI 819

Query: 848 TIDSNGXXXXXXXXXXXXXXXXXXXSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQG 907
            I   G                          V Q   +E + +   LLKL+N +   +G
Sbjct: 820 CISPRGIESEEVEAL---------------PDVPQNIEEEKNPQNNGLLKLANGNGIGEG 864

Query: 908 LNIVESQG 915
           L I  S G
Sbjct: 865 LGIEFSPG 872

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 60/111 (54%), Gaps = 15/111 (13%)

Query: 1006 EANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTXXXXXX 1065
            +A PP+AP+T+SR+YS+      N      +      D S++       +T         
Sbjct: 978  DAVPPLAPSTVSRHYSVASSHSNN-----SYHNNGRHDASKKRHGGGKGNTHHGRHRKS- 1031

Query: 1066 XXXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDN---NYLDENA 1113
                 K+IPGS VMAQYLAQLQHSTF+YAANILG +N GDN      DEN 
Sbjct: 1032 -----KAIPGSQVMAQYLAQLQHSTFMYAANILGVTN-GDNEDSTLYDENG 1076

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/1047 (37%), Positives = 562/1047 (53%), Gaps = 166/1047 (15%)

Query: 76   MGSPFVSSPNLFXXXXXXXXXXXXXXXYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPAS 135
            M SPF+++P +                + H  +KSS        +T   +PPS       
Sbjct: 1    MSSPFLATPGV-----------GHSSPHRHVTNKSSQAYK----STQLRMPPS------- 38

Query: 136  RNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTYRVLPK-GN---DEFRTRSLLFENVD 191
             +A+  RG RR  H K     D   R + P+ LT+ +LP+ GN   D+FRTRSL F N++
Sbjct: 39   -DAI--RGSRR--HNKEKHLYDEGTR-QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLN 92

Query: 192  GSIDLHSFVTNFTNYGPVESVYLFKSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSD 251
              + LH F+  F  +  +ESVY+   E    S+L+SF +K  CLDFYN +LQ+LSE+K +
Sbjct: 93   PDVRLHEFLATFHKFDRIESVYVVDRE--QQSVLVSFLTKETCLDFYNGILQKLSEFKKE 150

Query: 252  LDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXXXAFNITAAGSLRYDVINRGATRSIMIT 311
            L SK L+LSF S + KV                          ++++V+  GATRS+ + 
Sbjct: 151  LRSKELSLSFASPQ-KVESGPTLQ------------------EIKFEVLRAGATRSLGLE 191

Query: 312  FKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVE 371
            FK       L+ KK +F    +  RYV+ESI+ V  D+PSK+F  NYA++ F++I MAVE
Sbjct: 192  FKDEIDFASLL-KKFDFFDN-SGPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVE 249

Query: 372  ILDYIRLHS-QKLDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVTS 430
             ++Y+++ + +   ++K  +++             S+ ++G+S      N  S+ +    
Sbjct: 250  TMEYLKVQTPESFGLTKVSYVN-------------STFTSGKSEFQTFSN--SELSDQND 294

Query: 431  LESSGSIISL-DQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAA 489
            +E   SI S  D  + E +  +++    +    V  + Y  P  E H  H +++T+S+A 
Sbjct: 295  VEVQDSISSFEDITLSEGSMSVEN----EKAFTVLPSQYGPPVVEEHNQHCSHITISKAL 350

Query: 490  SL-------DSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAXXXXXXXXXX 542
            S         S +  P PQEV V+       +   P+  N   S+    +          
Sbjct: 351  SSKVSRNGSSSSIASPQPQEVLVS-------NSEAPSSRNSIVSLLSARSQ--------- 394

Query: 543  XXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPR 602
                  G   P P      +M+KP+ Q+LQ+QY  +A+VA++MGGG GNRTVYIGNI PR
Sbjct: 395  ------GPTYPVPGYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPR 448

Query: 603  SRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGW 662
            S+TEDICNVVRGGILQ+VK++  K ICFVTF+EA++AVQF+ N+ I+PIVLHG++LKVGW
Sbjct: 449  SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508

Query: 663  GHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDD 722
            GHHSG LP+SI+LAVT+GASRNVYVSLPE+AFKDK+I DP+Y+ + +KF+LP ++QL DD
Sbjct: 509  GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568

Query: 723  FSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYG 782
            FS +GDIE IN+L DGHCCW+NF NIS AIKLVE+       +F++    RY GL IGYG
Sbjct: 569  FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYG 628

Query: 783  KDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHEETLRRQQEN-----NSE 837
            KDRCGNVNKN ++ KNS+++KKVKK S+NIRL      RRQ +  +  Q ++     NSE
Sbjct: 629  KDRCGNVNKNLVSNKNSKYFKKVKKASYNIRL------RRQQKSDIEAQAKSGKGDENSE 682

Query: 838  KFLQFGSLGITIDSNGXXXXXXXXXXXXXXXXXXXSNSPKKTVEQASGKESDQEEQELLK 897
            K LQ  + GI++ S                          +   + S +E   EE ELL 
Sbjct: 683  KKLQVDAFGISVGS--------------------------QPDARYSDEEQKIEENELLL 716

Query: 898  LSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSAKSDASSDVELIIXXXXXXX 957
            LS  +    GL I  SQ  +  E       +N     +T + S  SS+V++++       
Sbjct: 717  LSKPNSAEGGLGISVSQDVTVTENNTACGGKN-----KTGSVSSGSSEVDILV----SAP 767

Query: 958  XXXXXXXXRGFRKNDRRKLANCAEGASSKERFKSTT-----NDVXXXXXXXXXEANPPMA 1012
                     G     R   A+  +    KER    +     +++         +A PP+A
Sbjct: 768  GSANTSQLEGGGPTQRTTAASNGK----KERSSGVSKLHCFSEIAPRVSKASLDAVPPLA 823

Query: 1013 PATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESNFDFESTQQTXXXXXXXXXHGKS 1072
            PA ++ +Y+   ++           G   D      S  D  S             + ++
Sbjct: 824  PAALNCHYNSAPRRSARK------NGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQA 877

Query: 1073 IPGSDVMAQYLAQLQHSTFIYAANILG 1099
            IPGS+VMAQYLAQLQHSTF+YAA+ILG
Sbjct: 878  IPGSNVMAQYLAQLQHSTFMYAADILG 904

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  543 bits (1399), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 338/829 (40%), Positives = 468/829 (56%), Gaps = 125/829 (15%)

Query: 38  PQFMNSQPMYYPTGPVMN----------APPTPFDTAYGVTLLPSHLLMGSPFVSSPNLF 87
           PQ ++ Q  ++P+G V +           P TPFD  YG +LLPSH+LMGSPFVS+P   
Sbjct: 55  PQQIHHQ-RFFPSGDVASSLSAAASMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP--- 110

Query: 88  XXXXXXXXXXXXXXXYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRG 147
                          +    S S+  RSF      YP PP L   P          PRR 
Sbjct: 111 --------MRPQGHFHPSASSHSNHSRSF----LYYPQPPILKPIP----------PRRR 148

Query: 148 SHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDG--SIDLHSFVTNFTN 205
             +        S    +P+ + +++LPKG DE+ TRSLLF N++   + D+H+F+TNF  
Sbjct: 149 KSF--------SLNHSEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIK 200

Query: 206 YGPVESVYLFKSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLE 265
           +GP+ES+YL     D  SILLSF +KA CLDFYN++LQR SE+KS L S  L++SFV  +
Sbjct: 201 FGPIESIYLLD---DSHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVCQD 257

Query: 266 YKVXXXXXXXXXXXXXXXXXAFNITAAGSLRYDVINRGATRSIMITFKTPCSK--DELID 323
                                F +     L+ +V+ RG TRS+ I F+    +   +LI 
Sbjct: 258 -----------------ETNWFRL-----LQMNVVTRGVTRSLCIEFEDQSMELTSDLIH 295

Query: 324 KKLEFLKKENNTRYVLESIDLVTADEP-SKHFPQNYAVLTFLNIFMAVEILDYIRLHSQK 382
           +K+ +L   +  R+V+E IDLV A  P +++F   Y ++ F+ I MA+E+ +Y++  SQK
Sbjct: 296 EKIPWLFFSH--RFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQK 353

Query: 383 --LDISKCFFISIQPQIPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISL 440
             L ISK  F+++     D       +A+NG   ES + +  S +  +++   S  ++ L
Sbjct: 354 KQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISN---SSDLVEL 410

Query: 441 DQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAAS---------- 490
              +D +   + S       L+V  + Y  P  E H DHL +VT+S  +           
Sbjct: 411 FHSLD-LALGIIS-------LQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVE 462

Query: 491 LDSQLTMPSPQEVTVNEYVL----PNQD--MP--LPNDMNY------APSVQDVDAXXXX 536
           +D      +P      + VL    P+ D   P  LPN++N        P    V      
Sbjct: 463 MDGGPNGGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQS 522

Query: 537 XXXXXXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYI 596
                       G     P+   +     PI Q+LQRQY T     +   GG  NRTVYI
Sbjct: 523 LSLHNPNDNGGAG-----PSYFMDPMSGAPINQALQRQYLT----GTGQVGGSNNRTVYI 573

Query: 597 GNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGN 656
           GNIHPRS+ EDICNVVRGGILQN+K++  KRICFVTF+EA+AA+QFY NA ++PIVLHGN
Sbjct: 574 GNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGN 633

Query: 657 MLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDE 716
           +L+VGWG  SG LPK+IALAVT+GASRNVYVSLPE++FK+KYI +P+++EY+ K++LP E
Sbjct: 634 ILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSE 693

Query: 717 EQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGN---FYKMLGGR 773
           EQLR DF+ YG +EQINYL+DGHCCWVNF NI+ AI+LVE+       N   F+    GR
Sbjct: 694 EQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGR 753

Query: 774 YDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERR 822
           Y  L+IGYGKDRCGNVNKN  A KNSRF+KK+KK +   + +K ++ +R
Sbjct: 754 YKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKR 802

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  528 bits (1361), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 325/826 (39%), Positives = 453/826 (54%), Gaps = 134/826 (16%)

Query: 40  FMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXXX 99
           F  ++ M    G +   P TPFD  YG +LLPSH+LMGSPF+S+P               
Sbjct: 43  FPGAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHS 102

Query: 100 XXXYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDAS 159
                H QS  SS          YP PP L   P          PRR    KS+     +
Sbjct: 103 SHSLHHAQSARSS-------FLYYPQPPMLKPIP----------PRRK---KSV-----T 137

Query: 160 KRFKDPFILTYRVLPKGNDEFRTRSLLFENVD--GSIDLHSFVTNFTNYGPVESVYLFKS 217
               +P+ + +++LPKG DE+ TRSLL  N++    +D+H+F+ +F  +GPVES+YL   
Sbjct: 138 LNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMD- 196

Query: 218 EGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXXXXXXXXX 277
             D+ SILLSF +KA CLDFYN++LQR SE+K+ L S  L++SFV  +            
Sbjct: 197 --DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQD------------ 242

Query: 278 XXXXXXXXAFNITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRY 337
                    F       L+ +V+ RGATRS+ + F+    +      +L+F     + R+
Sbjct: 243 -----ESSWFKY-----LQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRF 292

Query: 338 VLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQK--LDISKCFFISIQP 395
           VLE IDL+ A   ++HF   Y +L F++I MA+E+ D+++  SQK  L+IS+  F+++  
Sbjct: 293 VLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVNG 352

Query: 396 QIPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVN 455
                     ++A+NG   +S + +  S + S+++     ++           +    ++
Sbjct: 353 HHSKLSDEEAAAAANGLQQDSRTSSVSSISLSISNTADLAAL-----------FHSLDLS 401

Query: 456 SKKNILEVTTNNYKDPSFEGHTDHLTNV-------TVSEAASL---DSQLT--------- 496
                L+V  + Y  P  E H++HLT++       T+  +ASL   DS  T         
Sbjct: 402 LDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVS 461

Query: 497 -------------------MPSPQEVTVNEYVL----PNQDMPLPNDMNYAPSVQDVDAX 533
                              M  P E+ +N  V+      Q MP P       +  D +  
Sbjct: 462 SSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSDGNGG 521

Query: 534 XXXXXXXXXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRT 593
                                P+   +  +  PI Q+LQRQY   A    S   GI NRT
Sbjct: 522 S--------------------PSYFMDPMVGAPIGQTLQRQYLAGA----SQANGINNRT 557

Query: 594 VYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVL 653
           VYIGNIHPRS+ EDICNVVRGGILQ +K+++ KRICFVTF+E +AAVQFY NA ++PIVL
Sbjct: 558 VYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVL 617

Query: 654 HGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRL 713
           HGN+L+VGWG  SG LPK+IALAVT+GASRNVYVSLPE++FK+KYI +P+++ Y+ K++L
Sbjct: 618 HGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKL 677

Query: 714 PDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGN---FYKML 770
           P EEQLR DF+ YG +EQINYL DGHCCWVNF NI+ AI+LVE+       N   F+   
Sbjct: 678 PTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQF 737

Query: 771 GGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSK 816
            GRY  L+IGYGKDRCGNVNKN  A KNSRFYKK+KK S++++  K
Sbjct: 738 DGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGK 783

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 973  RRKLANCAEGASSKERFKSTTNDVXXXXXXXXXEANPPMAPATISRNYSLMFKQQYNHEK 1032
            R + +N A  AS  +++  +   +         +A PP+AP+++ ++   +  ++  H  
Sbjct: 908  RNQHSNAASSASYNQQY--SLGSLDHTSSAGSLDAPPPLAPSSMQQH---LADRRPRHTP 962

Query: 1033 LRDFEGESFDDESQQESNFDFESTQQTXXXXXXXXXHGKSIPGSDVMAQYLAQLQHSTFI 1092
             R  +  +    SQ  +N +++S ++            K I G DVM+QYL QL HSTF+
Sbjct: 963  GRSTDSSASQYNSQTPTNANYKSRRRRQAKFS------KPIAGQDVMSQYLEQLHHSTFL 1016

Query: 1093 YAANILGASNDGD--NNYLDENAD 1114
            YA NILGA+   +    Y D N +
Sbjct: 1017 YATNILGATTVQEPLGGYYDSNGN 1040

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  469 bits (1208), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/552 (46%), Positives = 336/552 (60%), Gaps = 78/552 (14%)

Query: 563  MTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKF 622
            M   + ++ + Q+ATSAE+A++MGGG GNRTVYIGNI+PRS+ EDICNVVRGG LQ +KF
Sbjct: 552  MLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKF 611

Query: 623  LAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGAS 682
              EK ICFVTF+EA++A QFY N+FIDPI+LH N L+VGWG HSGPLPKSI+LAVTVGAS
Sbjct: 612  FKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGAS 671

Query: 683  RNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCW 742
            RNVYVSLPE+AFKDK+I DP+Y+EY+ K+ LP EE+LR DFS++G++EQ+N+LNDGHCCW
Sbjct: 672  RNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCW 731

Query: 743  VNFTNISAAIKLVEEVKYEGGG-NFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRF 801
            +NF NI +AIKLVE V    GG  F++    RY GL+IGYGKDRCGNVNK+ I+GKNS+F
Sbjct: 732  INFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKF 791

Query: 802  YKKVKKPSFNIRLSKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGXXXXXXXX 861
            Y+KVKKPS+NIRL ++EEER+Q E      +   S K +   S GI              
Sbjct: 792  YRKVKKPSYNIRLQQLEEERKQEE------KNKISNKSINLNSFGI-------------- 831

Query: 862  XXXXXXXXXXXSNSPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREK 921
                              VE  S  ES+QEE ++           GL +  S+  S    
Sbjct: 832  -----------------QVETPSQNESEQEEPKI--------SLDGLGMSLSKPNS---- 862

Query: 922  EATKLTRNHSENDETSAKSDASSDVELIIXXXXXXXXXXXXXXXRGFRKNDRRKLANCAE 981
                   NH   +   + SD S+D+ELII               +  RKND     N   
Sbjct: 863  ------ENHDLKETDDSDSDISTDIELIIDPPVRENTKGNKNKKQNHRKNDMNNNLNFGN 916

Query: 982  GASSKERFKSTTNDVXXXXXXXXXEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESF 1041
                 +                  E++PP+APAT+SR++    KQ      L +      
Sbjct: 917  PPPVSKTL---------------LESSPPLAPATLSRDFQKSSKQL--SSDLTNLSTMDQ 959

Query: 1042 DDESQQESNFDFESTQQTXXXXXXXXXHGKSIPGSDVMAQYLAQLQHSTFIYAANILGAS 1101
            +D S+ +SN    ++ +          + K +PGSDVM+QYLAQLQHSTF+YAANILGAS
Sbjct: 960  NDMSENDSN----TSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGAS 1015

Query: 1102 NDGDNNYLDENA 1113
            +D +  + DEN 
Sbjct: 1016 SD-EPEFYDENV 1026

 Score =  306 bits (785), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 181/432 (41%), Positives = 237/432 (54%), Gaps = 86/432 (19%)

Query: 39  QFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFXXXXXXXXXXX 98
           Q  NS  +YY    + NAPPTPFD+AYG +LLPSHLLMGSPFVS+P +            
Sbjct: 104 QLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM------------ 151

Query: 99  XXXXYSHN---QSKSSSGRSFGKLATAYPVPPSLNSPPASR-----------------NA 138
               YS      S S  G S G+L++AYP PP++N PP+SR                 N 
Sbjct: 152 -GQSYSQQFARPSPSKGGNSMGRLSSAYPAPPTINLPPSSRAHASSNNNNNNNNSSSSNN 210

Query: 139 LHNRGPRRGSHYKSIQSSDASKRFK-------------DPFILTYRVLPKGNDEFRTRSL 185
            +N   RRG+H     +++   RF              + F ++Y+VLPKGNDE++TRSL
Sbjct: 211 NNNNNNRRGNHNSHRNTNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSL 270

Query: 186 LFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHV----------------------- 222
           LFENVD S+DLH F+  F N+GP+ESVYL  S G +                        
Sbjct: 271 LFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNAN 330

Query: 223 -----SILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXXXXXXXXX 277
                SILLSF S+ ICLDFYNSVLQRLSE+K+ L+S  LTLSFV L+YK          
Sbjct: 331 NHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYK--------NQ 382

Query: 278 XXXXXXXXAFNITAAGSLRYDVINRGATRSIMITFKTP-CSKDELIDKKLEFLKKENNTR 336
                    F+     SL YD+I RGATRSI + F  P  SK+  ++ KL FL    N R
Sbjct: 383 DRPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKR 442

Query: 337 YVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISI--- 393
           Y++ES+D++ A E   + P+N  +LTFLNI M V+++D IRL  +   ISKC F++    
Sbjct: 443 YIIESVDIINAAERDANLPKNTVILTFLNISMTVDVMDRIRLERKDSGISKCVFVTFNKE 502

Query: 394 QPQIPDGKRLSV 405
            P +P+ KRLS+
Sbjct: 503 NPTVPNMKRLSL 514

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  474 bits (1220), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 281/676 (41%), Positives = 379/676 (56%), Gaps = 119/676 (17%)

Query: 287  FNITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNT-RYVLESIDLV 345
            F +T A +L+ D++ RGATRS+++ F    SKD+LI++KL      N   RY+LESI LV
Sbjct: 424  FPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLV 483

Query: 346  TA--------------------DEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDI 385
                                  D P   F  NY +LTF NI MA+E  DY +    +L+I
Sbjct: 484  NIENNTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNI 543

Query: 386  SKCFFI--------------SIQPQIPDGKRLSVS-------------------SASNGR 412
              CFF+              +I    P  K  S+                    ++ N +
Sbjct: 544  FDCFFVSKTNYHKNSENSKSTISHSTPSSKISSIVNLPNEINNNNKSNVPITSLNSDNDK 603

Query: 413  SMESISG----------------------------NYRSKNASVTSLESSGSIISLDQEI 444
            S  SIS                             N   KN++VT  E     +S+DQEI
Sbjct: 604  SNVSISNDNISNDNTSNDNNNSNDNPINNNDITIRNKSRKNSNVTVHE-----LSMDQEI 658

Query: 445  DEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTMPSPQEVT 504
            + +  KL++++ K N L ++   Y  P  E     L N++++  ++ +  L    P E  
Sbjct: 659  EILNEKLKNIDLKDNELIISAKIYNQPIVEEFDQDLENISITNLSNSNYLLLNQQPFEFN 718

Query: 505  VNEYV----------------------LPNQDMPLPNDMNYAPSVQDVDAXXXXXXXXXX 542
            +N  +                      LP Q MP+P    +A +   +D           
Sbjct: 719  MNMNMTMNMNMNMNMNVNMNMNMNMNMLPPQSMPMPM---FAGNFDMIDPMDPQRSRQPS 775

Query: 543  XXXXXYGCYMPPPNVRQNGNMT-KPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHP 601
                       P   +     T   +TQ+L+  + TS E+++ +GGG GNRTVYIGNI+P
Sbjct: 776  VLFTATQQPQQPQQQQPQQQGTHNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINP 835

Query: 602  RSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVG 661
            RS+ ED+CNVVRGGILQ + FL +K ICFVTF+EA+ A QF+ NA+IDPIVLHGN+LKVG
Sbjct: 836  RSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVG 895

Query: 662  WGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRD 721
            WG+HSGPLPKSI+LAVT+GA+RNVYVSLPEFAFKDK+I +P YE+Y++ ++LP+E QLR 
Sbjct: 896  WGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRK 955

Query: 722  DFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGY 781
            DFS YG+IEQINYLNDGHCCW+NF NI++AI LVEEV  + G  F+    GRY+GL+IGY
Sbjct: 956  DFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGY 1015

Query: 782  GKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERR-QHEETLRRQQE--NNSE- 837
            GKDRCGNVNKN +A KNS+F+KKVKKP++ I+L K+EEERR Q E  LR   +  NNS+ 
Sbjct: 1016 GKDRCGNVNKNLVATKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQI 1075

Query: 838  --KFLQFGSLGITIDS 851
                +   SLGIT +S
Sbjct: 1076 RKPAVNLESLGITFES 1091

 Score =  180 bits (457), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 114/274 (41%), Positives = 150/274 (54%), Gaps = 55/274 (20%)

Query: 45  PMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL--FXXXXXXXXXXXXXXX 102
           P YY   P+ +APPTPFD +YG TLLPSHLLMGSPFVS+PN+  F               
Sbjct: 95  PTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRKS 152

Query: 103 YSHNQSKSSSGRSFGKLATA----------YPVPPS--LNSPP----------------- 133
           +S   S S+S  +    + +          YP+PP   L +PP                 
Sbjct: 153 FSRKNSNSNSISNSNSSSMSNLNLNSKYDNYPIPPVPILKNPPLNNQNIRNSRNNSNRIR 212

Query: 134 ----ASRNALHNRGPRRGSH--------------YKSIQSSDASKRFKDPFILTYRVLPK 175
                +R  L +    R S               Y S+   D +K  + P +++Y++LPK
Sbjct: 213 NNHIINRKLLKDDNSYRISQQTFKENPMIIEKPKYSSV--IDINKLLEIPLVVSYKILPK 270

Query: 176 GNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSE--GDHVSILLSFFSKAI 233
           G DEFRTRSLL EN++ SID  + V NF N+GP+ESVYL K      + SILLSF S+ I
Sbjct: 271 GTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLNPGSKYNSILLSFVSREI 330

Query: 234 CLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYK 267
           CLDFYN+VLQRL E+K++L SK+LTLSFV L+Y+
Sbjct: 331 CLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYE 364

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  410 bits (1055), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 261/697 (37%), Positives = 381/697 (54%), Gaps = 127/697 (18%)

Query: 170 YRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSE--GDHV----- 222
           Y +LPKGND +R+RSLLF NV+  +D+  F+       P+ES+YL K E  GD +     
Sbjct: 219 YSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIENLNT 278

Query: 223 -----------------------------------------------SILLSFFSKAICL 235
                                                          S LLSFF+K  CL
Sbjct: 279 SNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTKESCL 338

Query: 236 DFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVXXXXXXXXXXXXXXXXXAFNITAAGSL 295
           DFYN++LQR +E K+ + S  L ++FV ++                      +     +L
Sbjct: 339 DFYNNLLQRYAEIKNAVKSDQLAMNFVKIQD---------------------DEEWMANL 377

Query: 296 RYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLESIDLVTADEPSKHFP 355
           + +VI+ GATRS+ + F       + I   L FLK  N+ +YV+  +D+VT DE  K+F 
Sbjct: 378 KMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLK--NSGKYVVIDVDVVTTDERRKNFG 435

Query: 356 QNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSASNGRS-- 413
            +Y +L FL++ MA+E+ + +    +   +S+  F++         R   SSA + +   
Sbjct: 436 LHYCLLHFLSVTMALEVKELLETGDEA--VSRVSFVTPANSADKEMRRRRSSAISLKQEA 493

Query: 414 ---MESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKD 470
              M S     RS++++V SL  S  + +   +I    Y+    N   + L V  + YK+
Sbjct: 494 SPQMFSTDSRSRSRSSNV-SLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKE 552

Query: 471 PSFEGHTDHLTNVTVSEAASL---DSQLTMPSPQEVT--VNEYVLPNQDMPLPNDM--NY 523
           P       HL + ++S+  +L   +S  T  S   ++  ++   + + D P+P  M  N 
Sbjct: 553 PIVNEFDHHLNSWSISKPTTLYMHESGTTNFSSSNLSDDIDPLSISSHD-PVPQQMLLNE 611

Query: 524 APSVQDVDAXXXXXXXXXXXXXXXYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVAS 583
            P + +                      MPP            ITQ++Q QY+ S +   
Sbjct: 612 YPYIME--------------------PLMPPQ-----------ITQTIQNQYSKSIQ--- 637

Query: 584 SMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFY 643
           ++  G+ +RTVYIGNI+PRS+ EDICNVVRGGILQ++K+++ KRICFVTF+E +AAVQFY
Sbjct: 638 AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFY 697

Query: 644 TNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQ 703
            N  ++PI+LHGN+LKVGWG + GPLPK+IALAVTVGASRNVYVSLP+ AFKDK+I DPQ
Sbjct: 698 ANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQ 757

Query: 704 YEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGG 763
           ++EY  ++++P+  QL+ DF  YG +EQ+N+ +DGHCCW+NF NIS+AIKLVEE      
Sbjct: 758 FKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKD 817

Query: 764 GNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSR 800
             F+K   GRY GL+IGYGKDRCGN+N+N +  KN +
Sbjct: 818 NLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGK 854

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 27/33 (81%)

Query: 1071 KSIPGSDVMAQYLAQLQHSTFIYAANILGASND 1103
            K I GSDVM +YL QL H+TF+YAANILGA+ D
Sbjct: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/32 (65%), Positives = 27/32 (84%)

Query: 53 VMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSP 84
           ++ P TPFD  YG+TLLPSHLL+GSPFV++P
Sbjct: 65 TVSIPQTPFDPVYGITLLPSHLLVGSPFVNTP 96

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  388 bits (997), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 177/286 (61%), Positives = 228/286 (79%), Gaps = 2/286 (0%)

Query: 566 PITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAE 625
           PI ++L+ ++ TSA+VASSMG  +GNRT+YIGN++PRS+ ED+CNVVRGGILQ++K +A 
Sbjct: 702 PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761

Query: 626 KRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNV 685
           KRICFVTF+EASAAVQFY N+FIDP++LHGN LK+GWG++  PL KSIALAVT+GASRNV
Sbjct: 762 KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821

Query: 686 YVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNF 745
           YVSLPEFAFKDK++ DP+Y+E+++K++LP E+QLR DF+ YG IEQINYL+D HCCWVNF
Sbjct: 822 YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881

Query: 746 TNISAAIKLVEEVKYEGGGN-FYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKK 804
            NI++AIKLVE+V      N F K    RYDGL+I YGKDRCGNVN+N I+ KNSR Y+K
Sbjct: 882 MNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRK 941

Query: 805 VKKPSFNIRLSKMEEERRQHEETLRRQQEN-NSEKFLQFGSLGITI 849
           VKK S N +L +++E+RR  +E  +      N  K     +LGI +
Sbjct: 942 VKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGL 987

 Score =  266 bits (680), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 184/569 (32%), Positives = 273/569 (47%), Gaps = 102/569 (17%)

Query: 27  YNSPGIYQH---MVPQFMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSS 83
           +N   +YQH       F  +Q  YY   P+ NAPPTPFDTAYG TLLPSHLLMGSP+VS+
Sbjct: 50  HNPNMVYQHDPNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVST 109

Query: 84  PNLFXXXXXXXXXXXXXXXYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRG 143
           PN                 YS + + + + +SF +L +       LN P +  N   +  
Sbjct: 110 PN---GIVPSSQQQSQMFLYSQSPAGTPNRKSFSQLNSM------LNQPSSRSNFFTDSY 160

Query: 144 PRR--GSHYKSIQSSDASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVT 201
             R   +    I   D ++ F+ PF+++Y++LP G+D +RTRSLLF NV  SIDLHSF+ 
Sbjct: 161 NNRYQNNPQTRIPEVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIY 220

Query: 202 NFTNYGPVESVYLFKSEGDHV-----------SILLSFFSKAICLDFYNSVLQRLSEYKS 250
           +F  Y  +ES+YL  +  D             SILLSF S+ ICL FYN+VLQRL+E+K+
Sbjct: 221 DFVQYSSIESIYLISNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKT 280

Query: 251 DLDSKALTLSFVSLEY---------------KVXXXXXXXXXXXXXXXXXAFNITAAGSL 295
           +L SK+LTL+FV L Y               ++                   ++    +L
Sbjct: 281 NLQSKSLTLNFVILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNAL 340

Query: 296 RYDVINRGATRSIMITFKTPCSKDELIDKKLEFL-KKENNTRYVLESIDL--VTADEPS- 351
           ++D+IN  ATR IMI  KT C K+ L++K L FL   + N RY+LESIDL  +  +E S 
Sbjct: 341 KFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSS 400

Query: 352 ----------------------------------KHFPQNYAVLTFLNIFMAVEILDYIR 377
                                             + FP +YAVL+F+NI+MA+E+ DY++
Sbjct: 401 ENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLK 460

Query: 378 LHSQKLDISKCFFISIQ------------------PQIPDGKRLSVSSASNGRSMESISG 419
           L+  K  I+   ++ I+                      D   +  + +  G+  +S   
Sbjct: 461 LNGLKHGITNASYVQIKHVKKSLNSSSKRSSVTSTTDNKDKSEVDTNESVEGKDKKSEEA 520

Query: 420 NYRSKNASVTSLESSGSIISLDQEIDEMTY----KLQSVNSKKNILEVTTNNYKDPSFEG 475
             +S N  ++S+  S    + + E D        KLQ +  K+ I  +    Y  P F+ 
Sbjct: 521 --KSFNNKLSSITMSSPDTTYEGEDDIDIDIIISKLQKLKLKETIQVLDIATYNTPLFQS 578

Query: 476 HTDHLTNVTVSEAASLDSQLTMPSPQEVT 504
           H  H+ N+T+S     ++QL  P P  + 
Sbjct: 579 HDSHMANITLSIVNPFEAQLMRPPPSNIV 607

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%)

Query: 1071 KSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111
            + IPG+DVMAQYL QLQHSTF+YAANILG S + DN Y DE
Sbjct: 1155 RVIPGADVMAQYLTQLQHSTFMYAANILGVSAE-DNTYYDE 1194

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  189 bits (479), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/225 (43%), Positives = 145/225 (64%), Gaps = 23/225 (10%)

Query: 567 ITQSLQRQYATSAEVASSMGG--GIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLA 624
           I+ +L +Q A +A +A++ GG   +GNRTVY+GN+    + E+ICNVVRGG+LQ+VK L+
Sbjct: 421 ISNALLQQSAAAAAIATAAGGPNNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLS 480

Query: 625 EKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRN 684
           ++ +CFVTF++ +AA QFY  + +  + +     KVGWG HSGPLP ++ALAV+ GASRN
Sbjct: 481 DRYVCFVTFIDPTAAAQFYAMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRN 540

Query: 685 VYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVN 744
           VY+      F+   + DP         R+  E+ LR  F  YG++EQIN+L + +CC++N
Sbjct: 541 VYIG--NINFEKDAMRDP---------RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFIN 589

Query: 745 FTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNV 789
           FTNIS AI  ++++K              ++ L I +GKDRCGNV
Sbjct: 590 FTNISNAILALDKIKS----------NPHFEDLKINFGKDRCGNV 624

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 104/200 (52%), Gaps = 20/200 (10%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI      +++ + VR G++++VK + EK   F++FV+ S+A+ F+++A +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            + G  +K+GWG  +   P   A  +   A+RNV++        D    +P         
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI-------- 325

Query: 712 RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLG 771
               E +LR+D   +G+IE +  + +    +V+F++I++AIK V  +         + + 
Sbjct: 326 ---TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL---------RSMN 373

Query: 772 GRYDGLVIGYGKDRCGNVNK 791
             Y+   I YGKDRC  + K
Sbjct: 374 PYYENKKIAYGKDRCAFITK 393

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  180 bits (457), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/225 (42%), Positives = 138/225 (61%), Gaps = 25/225 (11%)

Query: 567 ITQSLQRQYATSAEVASSMGG--GIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLA 624
           ++  L +Q A +A +A+S GG   +GNRT+Y+GN+  R R E++CNVVRGG+LQ+VKFL 
Sbjct: 238 VSNVLLQQAAATAAIATSAGGPNNLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLP 297

Query: 625 EKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRN 684
           ++ +CFVTF + +AA QFY  A +  + +     K+GWG HSGPLP  +A A++ GASRN
Sbjct: 298 DRHVCFVTFADPTAAAQFYAMASLHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRN 357

Query: 685 VYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVN 744
           VY       F +    DP   E+       +E  LR   SH+G++EQ+N + +  C +VN
Sbjct: 358 VY-------FGNVNWQDPAVAEFF------EERHLRQAMSHFGEMEQVNAVPERRCVFVN 404

Query: 745 FTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNV 789
           FTN+ +AI  VE+VK             ++  L + YGKDRCGNV
Sbjct: 405 FTNLESAIAAVEQVKK----------WPQFQQLKVNYGKDRCGNV 439

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 35/204 (17%)

Query: 591 NRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDP 650
           +RTVY+GNI P     ++ + V+ G++++ +    K   FV+FV+ ++A+ F+++A ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 651 IVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKK 710
           + +    +K+GW   +   P       + GA+RNVY+                       
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG---------------------- 135

Query: 711 FRLPD---EEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFY 767
             LPD     +L  D S YG+I+ +  L+     +V+  +I  AI  V  ++ +      
Sbjct: 136 -NLPDGVSRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDN----- 189

Query: 768 KMLGGRYDGLVIGYGKDRCGNVNK 791
           K+   R     + +GKDRC  V K
Sbjct: 190 KIYSDRR----VSFGKDRCAYVTK 209

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  185 bits (469), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 139/225 (61%), Gaps = 22/225 (9%)

Query: 567 ITQSLQRQYATSAEVASSMGG--GIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLA 624
           I+ +L +Q A +A +A+S GG   +GNRTVY+GN+    + ++ICN VRGG+LQ++K L 
Sbjct: 501 ISNTLLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLT 560

Query: 625 EKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRN 684
           ++ +CFVTF++ +AA QFY  + +  + +     KVGWG HSGPLP  IALAV+ GASRN
Sbjct: 561 DRHVCFVTFIDPTAAAQFYAMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRN 620

Query: 685 VYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVN 744
           VY+   +F    K    P + E            LR+ F  YGD+EQIN+L + +CC++N
Sbjct: 621 VYLGNIDFENDIKLHNPPIFTEL----------SLRNIFQQYGDVEQINFLPEKNCCFIN 670

Query: 745 FTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNV 789
           FTNIS AI  +E++K              +  L I +GKDRCGN+
Sbjct: 671 FTNISNAILAIEKIKNNPD----------FKDLKINFGKDRCGNI 705

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 111/220 (50%), Gaps = 24/220 (10%)

Query: 587 GGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNA 646
           G   +RTVY+GNI      +D+ + VR G+++N+K L +K   F++FV+ S+A+ F+++A
Sbjct: 263 GNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDA 322

Query: 647 FIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVS-----------LPEFAFK 695
            +  + + G  +K+GWG  +   P      VT GA+RNVY+                +  
Sbjct: 323 ILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTS 382

Query: 696 DKYIYDPQYEEYNKKFRLPD----EEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAA 751
                +   ++  KK  + D    EE+LR+D   YG+I+ +  + D    +V+ ++I +A
Sbjct: 383 PSSPSNNTSDDLEKKKNIDDSPLTEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSA 442

Query: 752 IKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNK 791
           IK+V  +      N Y      Y    I YGKDRC  + K
Sbjct: 443 IKVVNNL---AQTNPY------YQNKRIFYGKDRCAFITK 473

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 132/205 (64%), Gaps = 21/205 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    + E+ICN VRGG+LQ+VK L+++ +CFVTF++ +AA QFY  + +
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +H    K+GWG HSG LP ++ALAV+ GASRN+YV   +F   D        E   
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAID--------ETGE 509

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
             F    E+ LR+ F  +G++EQIN+L++ +CC++NFTNIS AI  ++++K     N Y 
Sbjct: 510 TIFT---EQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIK----CNPY- 561

Query: 769 MLGGRYDGLVIGYGKDRCGNVNKNF 793
                +  L + +GKDRCGNV + F
Sbjct: 562 -----FKNLKVNFGKDRCGNVPRQF 581

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%), Gaps = 22/204 (10%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI P    + + + VR G+++ +K L ++   F++FV+ S+A+ F+++A +  +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSL----PEFAFKDKYIYDPQYEEY 707
            + G  +KVGWG  +   P   A   + GA+RNVY+      P+ A   ++  DP  E  
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNEE-- 276

Query: 708 NKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFY 767
                +  EE+LR D + +G+IE I  + D    +V+F++I +AIK+V  +         
Sbjct: 277 -----IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL--------- 322

Query: 768 KMLGGRYDGLVIGYGKDRCGNVNK 791
             +   Y    I YGKDRC  + K
Sbjct: 323 ASVNPYYTNKKIFYGKDRCAFITK 346

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  181 bits (458), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 129/201 (64%), Gaps = 25/201 (12%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRT+Y+GN+    + E+ICNVVRGG+LQN+K L+++  CF+TF++ +AA QFY  + +
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +  N  KVGWG HSGPL  ++ALA++ GASRN+Y+   +F  K++Y          
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYF--------- 463

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
                 +EE LR+ F  +G++EQIN+L +  CC+VNFTNI+ AI  ++++K         
Sbjct: 464 ------NEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSL------- 510

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                ++ L I +GKDRCGN+
Sbjct: 511 ---PEFEDLKINFGKDRCGNI 528

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 103/201 (51%), Gaps = 28/201 (13%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI      +++ + VR G++++VK L  K   F++F++   A+ F+++A +  +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTV-GASRNVYVSLPEFAFKDKYIYDPQYEEYNKK 710
            + G  +K+GWG  S  +   +A  +T  GA+RNVY+                  + N  
Sbjct: 188 NIRGKDIKIGWG-KSNHIDSIVAARITNDGATRNVYIG-----------------QLNDD 229

Query: 711 FRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKML 770
             +  E++L  D   +G+I+ I +L++    +V+F +IS AI +V+ +           L
Sbjct: 230 PTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNL---------SKL 280

Query: 771 GGRYDGLVIGYGKDRCGNVNK 791
             +Y    I YGKDRC  + K
Sbjct: 281 NEKYKNKRIFYGKDRCAFITK 301

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (63%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    + E+ICN VR G+LQ+VK L+++ +CFVTF++ +AA QFY  + +
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             ++L     KVGWG HSGPLP  IALAV+ GASRNVY+   +F            E+  
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE-----------EDSK 514

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
           +  R+  E+ LR  F  YG++EQIN+L   +CC++N+TNIS AI  ++++K     N Y 
Sbjct: 515 RNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIK----SNPY- 569

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGN+
Sbjct: 570 -----FKDLKINFGKDRCGNI 585

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 104/202 (51%), Gaps = 18/202 (8%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI      +++ + VR G++++VK L EK   F++FV+ S+A+ F+++A +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN--K 709
            + G  +K+GWG  +   P       T GA+RNVY+          Y      E  N  K
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG-------QLYTDAEVAESLNIPK 281

Query: 710 KFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKM 769
           +  +  EE+L  D   YGDI+ +  + +    +++F +I +AIK+V  +      N Y  
Sbjct: 282 ESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL---AASNRY-- 336

Query: 770 LGGRYDGLVIGYGKDRCGNVNK 791
               Y    I YGKDRC  + K
Sbjct: 337 ----YQNRKIFYGKDRCAFITK 354

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  179 bits (454), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 129/205 (62%), Gaps = 21/205 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRT+Y+GN+    + E+ICN VRGG+LQ++K L+++ +CFVTF++ +AA QFY  + +
Sbjct: 339 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSL 398

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +H    K+GWG HSGPLP  +ALAV+ GASRN+Y+   +FA  DK    P +    
Sbjct: 399 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFT--- 454

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
                  E  LR  F  +G++EQIN+L + +CC++NF NIS+AI  ++++K         
Sbjct: 455 -------EAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSI------- 500

Query: 769 MLGGRYDGLVIGYGKDRCGNVNKNF 793
                +  L I +GKDRCGNV + F
Sbjct: 501 ---PTFKDLKINFGKDRCGNVPRQF 522

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 109/203 (53%), Gaps = 20/203 (9%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GN+ P   T+++ + VR G+++ VK L EK   F++FVE ++A+ F+++A +  +
Sbjct: 103 RTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKRL 162

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKD---KYIYDPQYEEYN 708
            +    +K+GWG  +   P   A     GA+RNVY+       KD   ++  DP  E   
Sbjct: 163 NIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLN-TNKDICAQWGVDPNEE--- 218

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
               +  EE+LR+D S +G++E +  + +    +V+F++I AAIK+V  +          
Sbjct: 219 ----VITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLAN-------- 266

Query: 769 MLGGRYDGLVIGYGKDRCGNVNK 791
            +   Y    I YGKDRC  + K
Sbjct: 267 -INPYYAQKKIFYGKDRCAFITK 288

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  181 bits (458), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 127/205 (61%), Gaps = 21/205 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    + E+ICN +RGG+LQN+K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 469 LGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 528

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +H    K+GWG HSGPLP  IALAV+ GASRN+Y+    F            E+  
Sbjct: 529 HGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFE-----------EDAK 577

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
           ++  +  E+ LR  F  +G +EQIN+L + +CC++NF NIS AI  ++++K         
Sbjct: 578 QEESVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSN------- 630

Query: 769 MLGGRYDGLVIGYGKDRCGNVNKNF 793
                ++ L I +GKDRCGNV + F
Sbjct: 631 ---PHFNNLKINFGKDRCGNVPRQF 652

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 106/203 (52%), Gaps = 20/203 (9%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI      + + + VR G+++ VK L+EK   FV+FV+ + A+ F+++A +  +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKD---KYIYDPQYEEYN 708
            + G  +K+GWG      P   A     GA+RNVY+       KD   K+  DP      
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLN-TNKDSCEKWGADP------ 345

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
            K  L  +E+L DD S +G+IE I  + D    +V+FT+I AAIK V  +   G  + Y 
Sbjct: 346 -KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANI---GSIDPY- 400

Query: 769 MLGGRYDGLVIGYGKDRCGNVNK 791
                Y    + YGKDRC  + K
Sbjct: 401 -----YSNKKVFYGKDRCAFITK 418

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 128/205 (62%), Gaps = 21/205 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRT+Y+GN+    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 392 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 451

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +H    K+GWG HSGPLP  +ALAV+ GASRN+Y+   +F   D+ +  P +    
Sbjct: 452 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFT--- 507

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
                  E  LR  F  +G++EQIN+L + +CC++NF NIS+AI  ++++K         
Sbjct: 508 -------ETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSI------- 553

Query: 769 MLGGRYDGLVIGYGKDRCGNVNKNF 793
                +  L I +GKDRCGNV + F
Sbjct: 554 ---PTFKDLKINFGKDRCGNVPRQF 575

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 110/204 (53%), Gaps = 22/204 (10%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GN+ P   T ++ + VR G++++VK L EK   F++FV+ ++A+ F+++A +  +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYV----SLPEFAFKDKYIYDPQYEEY 707
            +    +K+GWG  +   P   A     GA+RNVY+    + P+     ++  DP  E  
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEETI 273

Query: 708 NKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFY 767
                   EE+LR+D + +G++E +  + +    +V+F++I +AIK+V  +      N Y
Sbjct: 274 T-------EEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANL---ANVNPY 323

Query: 768 KMLGGRYDGLVIGYGKDRCGNVNK 791
                 Y    I YGKDRC  + K
Sbjct: 324 ------YAQKKIFYGKDRCAFITK 341

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  179 bits (453), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 129/201 (64%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRT+Y+GN+    R E+ICNVVRGG+LQ+VK L ++ +CFVTF++ +AA QF+  + +
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +     KVGWG HSGPL  ++ALAV+ GASRN+Y+   +FA  DK   +P +    
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFT--- 611

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
                  E+ LR  FS YG++EQIN+L + +CC++NFTNIS AI  ++++K         
Sbjct: 612 -------EDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSN------- 657

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGN+
Sbjct: 658 ---PVFKDLKINFGKDRCGNI 675

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 109/232 (46%), Gaps = 41/232 (17%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI      +++ + VR G++++VK + EK   F++F++ ++A+ F+++A +  +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVS-LPEFAF---KDKYIYDPQYEEY 707
            ++G  +K+GWG  +   P      +  GA+RNV++  L   +F   K K    P    +
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 708 NKKFRLPDEE----------------------------QLRDDFSHYGDIEQINYLNDGH 739
           +    + +E                             +LR D + +GDI+ I  + D  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 740 CCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNK 791
             +++F +I++AIK V  +           +   Y    I YGKDRC  + K
Sbjct: 402 IAFIHFASITSAIKCVHNL---------NSMNDYYSTKKIFYGKDRCAFITK 444

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 127/205 (61%), Gaps = 21/205 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRT+Y+GN+    + E+ICNVVRGG+LQ++K L ++ +CFVTF++ +AA Q Y  A +
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +H    K+GWG HSG L  ++ALAV+ GASRN+Y+   +F   D     P + E N
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSETEHPIFTEQN 501

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
                     LR  F  +G++EQIN+L + +CC+VNFTNIS AI  ++++K         
Sbjct: 502 ----------LRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNN------- 544

Query: 769 MLGGRYDGLVIGYGKDRCGNVNKNF 793
               ++  L I +GKDRCGNV + +
Sbjct: 545 ---PQFSDLKINFGKDRCGNVPRQY 566

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 109/202 (53%), Gaps = 18/202 (8%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI P      + + VR G++++++ L EK   F++F++ S+A+ F+++A +  +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSL--PEFAFKDKYIYDPQYEEYNK 709
            + G  +K+GWG  +   P   +     GA+RNVY+     + +F  +   DP+ E    
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDE---- 261

Query: 710 KFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKM 769
              +  E++LRDD S YG+IE +  + +    +V+F +I +AIK+V  +      N Y  
Sbjct: 262 ---VVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL---AAVNPY-- 313

Query: 770 LGGRYDGLVIGYGKDRCGNVNK 791
               Y    I YGKDRC  + K
Sbjct: 314 ----YANKKIFYGKDRCAFITK 331

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  175 bits (444), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 124/201 (61%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
               +     KVGWG HSGPLP ++ALAV+ GASRNVY+   +F    K           
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----------- 563

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
           K+  + +E  LR  F  YG++EQIN+L +  CC++NFTNI+ AI  ++++K         
Sbjct: 564 KEQPIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSN------- 616

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGNV
Sbjct: 617 ---PHFKSLKINFGKDRCGNV 634

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 107/201 (53%), Gaps = 22/201 (10%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI P    +++ + VR G+++  K L EK   F++FVE S+A+ F+++A +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            +    +KVGWG  +   P   +  +  GA+RNVY+                 +  +K+ 
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIG------------QGNNDRSSKEN 331

Query: 712 RLP-DEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKML 770
           + P  EE+LR+D   YG+I+ I  + +    +V+F++I+ AIK+V  +  +    FY+  
Sbjct: 332 KEPLTEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNP--FYQEK 389

Query: 771 GGRYDGLVIGYGKDRCGNVNK 791
                   I YGKDRC  + K
Sbjct: 390 K-------IFYGKDRCAFITK 403

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  174 bits (442), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 128/201 (63%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+G++    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
               +     KVGWG HSGPLP ++ALAV+ GASRNVYV   +F      + D   +E  
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDF------VSDSLRDE-- 552

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
              R+  E  LR  F  YG++EQIN+L + +CC+VN+TNIS AI  ++++K     N Y 
Sbjct: 553 ---RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIK----SNPY- 604

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGNV
Sbjct: 605 -----FKDLKINFGKDRCGNV 620

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 104/200 (52%), Gaps = 24/200 (12%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GN+ P    +++ + VR G++++VK ++EK   F++FV+ SAA+ F+++A +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 712 RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLG 771
               EEQLR D   YG+I+ I  + +    +++F +I  AIK+V  +      N Y    
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIR---NPY---- 371

Query: 772 GRYDGLVIGYGKDRCGNVNK 791
             Y    I YGKDRC  + K
Sbjct: 372 --YQNKRIFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  174 bits (441), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (63%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+G++    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
               +     KVGWG HSGPLP ++ALAV+ GASRNVYV          Y+ D   +E  
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSVRDE-- 541

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
              R+  E +LR  F  YG++EQIN+L + +CC++N+TNIS AI  ++++K     N Y 
Sbjct: 542 ---RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIK----SNPY- 593

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGNV
Sbjct: 594 -----FKDLKINFGKDRCGNV 609

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 102/200 (51%), Gaps = 24/200 (12%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GN+ P    +++ + VR G++++VK + EK   F++FV+ SAA+ F+++A +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 712 RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLG 771
                EQLR D   YG+I+ I  + +    +++F +I  AIK+V  +      N Y    
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIR---NLY---- 360

Query: 772 GRYDGLVIGYGKDRCGNVNK 791
             Y    I YGKDRC  + K
Sbjct: 361 --YQNKRIFYGKDRCAFITK 378

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  174 bits (442), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 126/201 (62%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    + E+ICNVVRGG+LQNVK L+++ +CFVTF++ +AA QFY  + +
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             I +     +VGWG H G L  ++ALAV+ GASRNVYV    F  +D    DP +    
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIFT--- 563

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
                  E  LR  F  +G++EQINYL + +CC+VN+TNIS AI  ++++K   G   +K
Sbjct: 564 -------ESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIK---GHPVFK 613

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                   L I +GKDRCGNV
Sbjct: 614 -------DLKINFGKDRCGNV 627

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 102/201 (50%), Gaps = 15/201 (7%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           +TVY+GN       +++ + VR G++++V+ L +K   FV+FV+ SAA+ F+++A +  +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVT-VGASRNVYVSLPEFAFKDKYIYDPQYEEYNKK 710
            + G  +K+GWG  + P+   +A AV    A+RNVY+       K       Q    +  
Sbjct: 270 HIDGRDIKIGWGKPT-PIDPVVATAVANDNATRNVYIGQLNTGPK----LSSQVSPVDVT 324

Query: 711 FRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKML 770
             +  E++LR D   +G+I+ I  + +    +V+F +I  AIK V  +           +
Sbjct: 325 EPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLAN---------I 375

Query: 771 GGRYDGLVIGYGKDRCGNVNK 791
              Y    I YGKDRC  + K
Sbjct: 376 NPYYRNKKIFYGKDRCAFITK 396

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  174 bits (440), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 128/201 (63%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+G++    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
               +     KVGWG HSGPLP ++ALAV+ GASRNVYV   +FA       D   +E  
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA------SDSLNDE-- 523

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
              R+  E  LR  F  YG++EQIN+L + +CC++N+TNIS AI  ++++K     N Y 
Sbjct: 524 ---RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIK----SNPY- 575

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGNV
Sbjct: 576 -----FKDLKINFGKDRCGNV 591

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 103/200 (51%), Gaps = 24/200 (12%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GN+ P    +++ + VR G++++VK + EK   F++FV+ SAA+ F+++A +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++            
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 712 RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLG 771
               EEQLR D   YG+I+ I  + +    +++F +I  AIK+V  +      N Y    
Sbjct: 293 ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIR---NPY---- 342

Query: 772 GRYDGLVIGYGKDRCGNVNK 791
             Y    I YGKDRC  + K
Sbjct: 343 --YQNKRIFYGKDRCAFITK 360

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  174 bits (440), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 128/201 (63%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+G++    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA QFY  + +
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
               +     KVGWG HSGPLP ++ALAV+ GASRNVYV   +F      + D   +E  
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDF------VGDSLRDE-- 539

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
              R+  E  LR  F  YG++EQIN+L + +CC++N+TNIS AI  ++++K     N Y 
Sbjct: 540 ---RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIK----SNPY- 591

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGNV
Sbjct: 592 -----FKDLKINFGKDRCGNV 607

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 103/200 (51%), Gaps = 24/200 (12%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GN+ P    +++ + VR G++++VK + EK   FV+F++ SAA+ F+++A +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++            
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 308

Query: 712 RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLG 771
               EEQLR D   YG+I+ I  + +    +++F +I  AIK+V  +      N Y    
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIR---NPY---- 358

Query: 772 GRYDGLVIGYGKDRCGNVNK 791
             Y    I YGKDRC  + K
Sbjct: 359 --YQNKRIFYGKDRCAFITK 376

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  172 bits (437), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 121/201 (60%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    R EDICN +R G+LQN+K L+++ +CFVTF++  +A QFY  + I
Sbjct: 412 LGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSI 471

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
              VL     KVGWG HSGPL   + LAV+ GASRNVY+   +F             +  
Sbjct: 472 YGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFT-----------ADGT 520

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
           K+ R   +  LR  FS YG++EQIN+L   +CC+VN+TNI+ AI  ++++K         
Sbjct: 521 KRERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNN------- 573

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCGN+
Sbjct: 574 ---PTFKNLKINFGKDRCGNI 591

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 109/204 (53%), Gaps = 15/204 (7%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI P     D+ + VR G+++ VK L EK   F++F++ ++++ F+++A +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAV-TVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKK 710
            + G  +K+GWG  S PL   IA +V T GA+RN+++        +K   D     Y+  
Sbjct: 228 NIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNKQ-KDNDATIYHGS 285

Query: 711 FRLPD---EEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFY 767
               D   EE+LR D   YGDI+ I    +    +V+FT+I +AIK+V  +      N Y
Sbjct: 286 DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNL---SNSNPY 342

Query: 768 KMLGGRYDGLVIGYGKDRCGNVNK 791
                 Y    I YGKDRC  + K
Sbjct: 343 ------YSKKKIYYGKDRCAFITK 360

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  171 bits (434), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 124/201 (61%), Gaps = 21/201 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRTVY+GN+    + E+ICNVVRGGILQ +K L+++ +CFVTF++  AA QFY  + +
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             I +     +VGWG H GPLP +IALAV+ GASRNVY+   +F           YE+  
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-----------YEDSK 508

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
           ++  +   + LR  F  YG++EQ+N+L + +C +VN+TNIS AI  ++++K         
Sbjct: 509 RQEPIFTADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSN------- 561

Query: 769 MLGGRYDGLVIGYGKDRCGNV 789
                +  L I +GKDRCG +
Sbjct: 562 ---PLFKNLKINFGKDRCGTI 579

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 107/202 (52%), Gaps = 18/202 (8%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           +TVY+GNI P     ++ + VR G+++ VK L EK   F+TFV+ SAA+ F+++A +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSL--PEFAFKDKYIYDPQYEEYNK 709
            + G  +K+GWG  +   P       + GA+RNVY+ L   +     +   DP  E+   
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKIT- 281

Query: 710 KFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKM 769
                 EE+LR D   +G+I+ +  + +    +++F +I +A+K+V  +    G N Y  
Sbjct: 282 ------EEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL---AGINPY-- 330

Query: 770 LGGRYDGLVIGYGKDRCGNVNK 791
               Y+   I YGKDRC  + K
Sbjct: 331 ----YENKKIYYGKDRCAFITK 348

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  170 bits (431), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 124/205 (60%), Gaps = 21/205 (10%)

Query: 589 IGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFI 648
           +GNRT+Y+GN+    + E+ICN VRGG+LQ++K L ++ +CFVTF++ +AA Q Y    +
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 649 DPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYN 708
             + +H    K+GWG HSG L  ++ALAV+ GASRN+Y+   +F             +  
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-----------ADSE 493

Query: 709 KKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYK 768
           +   +  E+ LR  F  YG++EQIN+L +  CC+VNFTNIS AI  ++++K         
Sbjct: 494 RDVPVFTEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSN------- 546

Query: 769 MLGGRYDGLVIGYGKDRCGNVNKNF 793
               ++  L I +GKDRCGNV + +
Sbjct: 547 ---EQFKDLKINFGKDRCGNVPRQY 568

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 104/200 (52%), Gaps = 14/200 (7%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPI 651
           RTVY+GNI P     ++ + VR G++++V+ L EK   F++F++ S+A+ F+++A +  +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 652 VLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
            + G  +KVGWG  +   P   A     GA+RNVY+              PQ+    +  
Sbjct: 208 NIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIG----RLNTDRDLAPQFGADPRDL 263

Query: 712 RLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLG 771
            +  EE+LR D   YG+IE +  + +    +V+F++I +AIK+V  +           + 
Sbjct: 264 -IATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------ATVN 313

Query: 772 GRYDGLVIGYGKDRCGNVNK 791
             Y    I YGKDRC  V K
Sbjct: 314 PYYSNKKIFYGKDRCAFVTK 333

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 90/221 (40%), Gaps = 17/221 (7%)

Query: 575 YATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICF---- 630
           Y TS+     +   +  + + +GNI  R+    I   +  G L+N+    +         
Sbjct: 166 YVTSSSEDELLENNVRPKAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIE 225

Query: 631 VTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLP 690
           + F+   AA  F      +   ++G  L   WG  S    K         +S +      
Sbjct: 226 LDFLTHEAAYSFMKYGRTNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCR 285

Query: 691 EFAFKDKYIYDPQYEEYNKKFRLPDEE-----QLRDDFSHYGDIEQIN-YLNDGHCCWVN 744
               K KYI   +  +Y++ ++    E     +++ DF  +G+I +I   ++   C  +N
Sbjct: 286 SLIMK-KYINCTKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISIN 344

Query: 745 FTNISAAIKLVEEVKYEG-GGNFYKMLGGRYDGLVIGYGKD 784
           F N+ +A+K ++E  YE    + +K     ++   I YGKD
Sbjct: 345 FFNMESAMKAMKE--YENPNSDLHK---AYFNNWAIWYGKD 380

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 99/255 (38%), Gaps = 43/255 (16%)

Query: 555 PNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPR-SRTEDICNVVR 613
           P ++ +G+   P+   L    ++  E +  +  G+ +R + +    P  +  + + N V+
Sbjct: 130 PQLKYDGDY-DPVLGKLLINSSSEDEDSEWLESGLQDRNLVVIRDFPNGTGLKSVLNQVQ 188

Query: 614 GGILQNV-----KFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWG----- 663
           GG L+++     K   + +   + F+    A  F          ++G  L+  WG     
Sbjct: 189 GGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKWGIQSLS 248

Query: 664 --------HHSGPL----PKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKF 711
                    H   L    P S  L +    SRN   S   +     +I D   ++     
Sbjct: 249 ENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNPKHSTCHYPSPRSHICDLNIQD----- 303

Query: 712 RLPDEEQLRDDFSHYGDIEQIN-YLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKML 770
                  L++DF  +GDI  I+  ++   C  +NF +I  A+  ++  K     N    L
Sbjct: 304 -------LKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQAYK-----NINSPL 351

Query: 771 GGRY-DGLVIGYGKD 784
             +Y D   IGYGKD
Sbjct: 352 NRKYADTWTIGYGKD 366

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 88/214 (41%), Gaps = 36/214 (16%)

Query: 592 RTVYIGNIHPRSRTEDICNVVRGGILQNVKF-LAEKRICFV-----TFVEASAAVQFYTN 645
           R + I NI   +    + + V GG L+N+ F  AEK I  +     +F+ A AA  F   
Sbjct: 167 RNIVIKNIPSGTGLASVMSQVCGGPLENISFQTAEKSINILENVRLSFLTADAADAFMNY 226

Query: 646 AFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGA-------SRNVYVSLPEFAFKDKY 698
           +      ++G  L   W     PL +     +  G        S N+  SL       KY
Sbjct: 227 SKTRLFKVNGFNLITEWA----PLKQQPINNIYSGLEKQQAQFSTNICRSL----IMKKY 278

Query: 699 IYDPQYEEYNKKFRLP-------DEEQLRDDFSHYGDIEQIN-YLNDGHCCWVNFTNISA 750
              PQ +E  K  +         D   + +DF  +G I+++   ++   C  VN+ NI +
Sbjct: 279 ---PQKKEIKKYCKWMENTMDDFDPSIIVEDFGQFGRIQEVTPIISRKLCVAVNYYNILS 335

Query: 751 AIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYGKD 784
           A+K +E   YE   +  ++    Y    I +GKD
Sbjct: 336 ALKAIES--YEDPNS--ELHRKYYKSWAIWFGKD 365

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 95/229 (41%), Gaps = 22/229 (9%)

Query: 573 RQYATSAEVASSMGGGIGN------RTVYIGNIHPRSRTEDICNVVRGGILQNV---KFL 623
           ++YA     A+    GI N      R+V I +I   +    + + VRGG L+ +   ++ 
Sbjct: 139 KRYAMETTFANEKIAGIQNPAFLKTRSVSISDIPRGTGIASVLSQVRGGSLERIIVYRYD 198

Query: 624 AEKRICF---VTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSI---ALAV 677
             +R      + F+    A  F   A      ++G  LK  W          I   ++  
Sbjct: 199 TPERSLHKVDLFFLNYDGAQSFMRYANTSVFKVNGVRLKPEWIFLESTYENVIKEQSVNR 258

Query: 678 TVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQIN-YLN 736
            V   + +   L       K +++   ++ ++     +  +L  DF ++G+I +I   ++
Sbjct: 259 IVEEEKLISRCLIVKKSSTKTVFNKSNQDRSQNLETINVRELEKDFQNFGEILEITPIVS 318

Query: 737 DGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRY-DGLVIGYGKD 784
              C  + F +IS+A++ +EE + +G G     L  +Y     I YGKD
Sbjct: 319 RKLCVSIFFYDISSAMRAMEEYEQKGSG-----LNNKYFKTWTIWYGKD 362

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 717 EQLRDDFSHYGDIEQIN-YLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRY- 774
           ++L+ DFS +G+I  I+  ++   C  +NF +I +A+  ++  K     N    L  +Y 
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYK-----NANSPLNRKYA 357

Query: 775 DGLVIGYGKD 784
           +   IGYGKD
Sbjct: 358 ESWTIGYGKD 367

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 5/71 (7%)

Query: 715 DEEQLRDDFSHYGDIEQIN-YLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGR 773
           D ++L  DF ++G++ +I   ++   C  + F +IS+A++ +EE  YE  G++  +    
Sbjct: 295 DIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEE--YEQKGSY--LYNKY 350

Query: 774 YDGLVIGYGKD 784
           +    I YGKD
Sbjct: 351 FKTWTIWYGKD 361

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 716 EEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAA 751
           E ++R  FS  GDI++I Y+ D  C +V F + ++A
Sbjct: 157 ESRVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASA 192

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 716 EEQLRDDFSHYGDIEQINYLNDGHCCWVNF 745
           E ++R  FS  GDI++I Y+ D +C +V F
Sbjct: 157 ESRIRFVFSRLGDIDRIRYVEDKNCAFVKF 186

>SAKL0F10076g Chr6 complement(773641..775002) [1362 bp, 453 aa] {ON}
           similar to uniprot|Q12516 Saccharomyces cerevisiae
           YDL133W
          Length = 453

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 119 LATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPFILTY 170
           +  AY + PS   PP +  A   +   R +    +  +DA+K FKDPF+++Y
Sbjct: 56  ILNAYGLTPS-TVPPFALEAQFKKLKLREAQIAPVVVNDANKHFKDPFLVSY 106

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 592 RTVYIGNIHPRSRTEDICNV-VRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDP 650
           RTVY+GNI PR   ED+  + V+ G ++ + +  +K    +   +  A ++F  ++ +D 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDK---VLDTHQGYAFIEFLNDSTVDY 63

Query: 651 IV-LHGNMLKVGWGHHSGPLPKS 672
           ++ L GN   V     S  + KS
Sbjct: 64  VLKLFGNTNLVSLYERSLKIRKS 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 110,834,241
Number of extensions: 4799412
Number of successful extensions: 16577
Number of sequences better than 10.0: 102
Number of HSP's gapped: 16906
Number of HSP's successfully gapped: 165
Length of query: 1115
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 995
Effective length of database: 39,721,479
Effective search space: 39522871605
Effective search space used: 39522871605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)