Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005308.845ON1301130163570.0
ZYRO0G14278g8.845ON1250115628850.0
SAKL0D01342g8.845ON1270118227640.0
KLTH0C03762g8.845ON1206111425550.0
Kwal_27.102328.845ON1209113624660.0
ABL121C8.845ON1285132523760.0
KLLA0D01452g8.845ON144597423350.0
KAFR0B039508.845ON1246119320760.0
Suva_13.4688.845ON141887620840.0
YMR280C (CAT8)8.845ON143389920410.0
Skud_13.4528.845ON143292720140.0
Smik_13.4938.845ON143394919980.0
NCAS0C003908.845ON116482919090.0
KNAG0J002508.845ON1237114218890.0
NDAI0K003908.845ON1495110417990.0
CAGL0M03025g8.845ON1254114116600.0
Ecym_46168.845ON157773216090.0
Kpol_1016.201.277ON1086612222e-17
ZYRO0G15136g1.277ON1027542213e-17
KAFR0A014801.277ON725552088e-16
Ecym_63401.277ON952482098e-16
AFR096W1.277ON852482089e-16
TPHA0I028201.277ON1044502081e-15
KLLA0F14322g1.277ON717552052e-15
YJL089W (SIP4)1.277ON829592052e-15
Smik_10.1531.277ON829562052e-15
KLTH0D03564g1.277ON862482052e-15
SAKL0D05654g1.277ON919482043e-15
Suva_6.1611.277ON832592025e-15
Skud_10.1251.277ON833592008e-15
TDEL0D014501.277ON945522009e-15
Kwal_26.7397singletonOFF201481851e-14
CAGL0L03377g1.277ON1209481936e-14
NDAI0G055301.277ON1186481882e-13
KNAG0B018401.277ON1072491831e-12
TBLA0D054201.277ON757481802e-12
NCAS0A094101.277ON932491641e-10
KNAG0B051205.235ON888821391e-07
KLLA0E13993gsingletonON678441292e-06
TBLA0G026102.231ON1000421283e-06
YPL248C (GAL4)6.279ON881471256e-06
Kpol_1018.306.279ON881511256e-06
Smik_6.4526.279ON878471247e-06
NDAI0F012206.279ON960451231e-05
KLLA0F04609g2.231ON916371231e-05
SAKL0G11902g5.235ON906481221e-05
SAKL0C02024gsingletonON898481221e-05
KLLA0C10923g5.235ON775481212e-05
KNAG0D006906.279ON875551212e-05
NCAS0D041906.279ON890451202e-05
KAFR0J017102.231ON848331202e-05
NCAS0B065502.231ON906331193e-05
KLTH0D07260g2.547ON979751193e-05
TDEL0C044802.231ON852451193e-05
KLTH0D02222gna 1ON847501193e-05
NDAI0B038502.231ON930411193e-05
KLTH0G09108g2.231ON782371193e-05
ZYRO0E08272g6.279ON794471193e-05
NCAS0D025405.235ON890441193e-05
Smik_9.392.231ON1012331193e-05
Skud_9.372.231ON954451193e-05
YIL130W (ASG1)2.231ON964331194e-05
Kwal_23.47542.231ON812371184e-05
Suva_9.592.231ON926331184e-05
NCAS0G011006.279ON935451175e-05
KLLA0C18953gna 2ON7031521175e-05
TPHA0F013802.231ON8901591175e-05
SAKL0E08998g2.231ON823411175e-05
CAGL0G08844g2.231ON847411175e-05
SAKL0A02860g6.279ON745451166e-05
SAKL0C03938g1.128ON780431166e-05
KNAG0E017602.231ON902331167e-05
Smik_1.137.17ON1046941167e-05
Kpol_1039.112.231ON992331167e-05
Ecym_7440na 3ON898421168e-05
KAFR0F014901.128ON658511159e-05
KAFR0J006905.235ON864441159e-05
NDAI0I023505.235ON889441141e-04
TPHA0H019806.279ON993471141e-04
Suva_16.596.279ON895451141e-04
Suva_10.945.235ON906441141e-04
TBLA0G018006.279ON1154451141e-04
NDAI0A087907.17ON1059331131e-04
Kwal_23.29055.235ON881481132e-04
YAL051W (OAF1)7.17ON1047941132e-04
TDEL0E039105.235ON862441132e-04
KLTH0G07898g5.235ON866481132e-04
ZYRO0A10956g5.235ON855441122e-04
NDAI0I007406.279ON1033451122e-04
KLTH0E14454gna 3ON902451122e-04
Kpol_495.213.109ON1085541122e-04
SAKL0H24860gna 4ON971651112e-04
KNAG0E002107.17ON948331113e-04
KAFR0F034104.113ON995381113e-04
ZYRO0E06270g2.565ON912471113e-04
TPHA0N002307.17ON1232331113e-04
KNAG0E041507.17ON1136751113e-04
Suva_1.147.17ON1045961103e-04
Smik_12.775.235ON903441103e-04
CAGL0M12298g7.17ON994461104e-04
KAFR0F010406.279ON834471094e-04
SAKL0B06732gna 3ON878461094e-04
Smik_2.438na 5ON469421084e-04
TDEL0E00160singletonON631431094e-04
KAFR0C049807.17ON951411095e-04
KLTH0H16170gna 6ON619331085e-04
YLR014C (PPR1)5.235ON904441085e-04
YBR297W (MAL33)na 5ON468421076e-04
Skud_1.107.17ON1040951086e-04
Suva_15.773.109ON1029591086e-04
ZYRO0C18150g1.128ON571601076e-04
TBLA0A012101.380ON1422301087e-04
TPHA0A045403.109ON1178781087e-04
SAKL0A09856g2.547ON1020501087e-04
AER370W2.231ON801331077e-04
KLTH0B00352gsingletonON934431077e-04
SAKL0D14520g7.17ON983411077e-04
Smik_18.8singletonON775381078e-04
KLLA0A02585gna 7ON370371058e-04
Skud_12.825.235ON899441069e-04
KLTH0H02684g6.279ON749451060.001
Ecym_53972.231ON826331060.001
YJL206C1.128ON7581611060.001
TBLA0C040504.113ON1207361060.001
Skud_15.546na 8ON542541050.001
NDAI0D00900singletonON865331060.001
Skud_15.643.109ON1032431060.001
Smik_13.1832.565ON911431060.001
TDEL0C056801.128ON6912061050.001
KAFR0I002307.17ON1045331060.001
Suva_13.1862.565ON894481050.001
CAGL0A00451g4.113ON1107421050.001
NDAI0F00110singletonON508331040.002
NDAI0G052601.380ON1581601050.002
KLLA0D12672g6.279ON865451040.002
SAKL0B04620gna 7ON362371030.002
AER183Cna 3ON879421040.002
Kpol_538.427.17ON1088421040.002
ADR403C7.17ON970461040.002
TDEL0D051503.109ON996471040.002
CAGL0J07150g7.17ON1022431040.002
ZYRO0C00726g7.17ON1035461040.002
SAKL0H00682gna 9ON922461030.002
ACL058Wna 4ON817851030.002
CAGL0I07755g3.109ON1053361030.002
SAKL0A00704gna 10ON718461030.002
Ecym_50177.17ON978331030.002
SAKL0D00264g8.879ON848291030.002
YGL013C (PDR1)4.113ON1068381030.002
KAFR0B014502.547ON1088711030.002
NCAS0D04860singletonON701391030.002
Ecym_2522na 10ON926421030.002
Smik_15.561na 8ON546471020.003
KLTH0E08778gna 11ON8731521020.003
TDEL0H043407.17ON989331020.003
Kwal_26.81092.547ON970501020.003
Kpol_260.25.59ON756561020.003
TBLA0E007007.17ON1274331020.003
KLLA0F22990g1.380ON1253301020.003
TPHA0A06090singletonON847331020.003
NCAS0A035804.113ON1113371020.003
SAKL0D01100g4.113ON940421020.003
TBLA0C062306.60ON795331020.003
Suva_6.2851.128ON7861581020.003
Skud_10.101.128ON8331611020.003
Suva_8.436na 8ON545381010.003
Suva_16.25singletonON14350950.003
YOR380W (RDR1)na 8ON546461010.003
SAKL0D14542gna 12ON946331020.003
SAKL0C09944g3.109ON1061571010.004
Smik_7.2774.113ON1069381010.004
Klac_YGOB_39601.128aON810681010.004
TBLA0G011308.879ON1132331010.004
YOR363C (PIP2)7.17ON996571010.004
TBLA0A058601.128aON810681010.004
Smik_17.27singletonON688331000.004
Kwal_47.17681na 11ON8541521010.004
Skud_2.427na 5ON468381000.004
Skud_7.2744.113ON1080381010.004
Smik_10.251.128ON7721641000.005
YOL089C (HAL9)3.109ON1030611010.005
NDAI0H019907.17ON1161331010.005
NCAS0A03070singletonON656331000.005
Skud_15.5327.17ON1000471000.005
TBLA0A097606.75ON1530431010.005
KLLA0C14212gna 9ON1040481000.005
CAGL0K05841g1.380ON1372301000.005
TPHA0N011006.154ON39745990.005
NCAS0A047502.547ON1141681000.005
KLLA0F09559gsingletonON658491000.005
KLLA0A09119g4.113ON1082441000.005
CAGL0B03421g1.380ON1355301000.006
Suva_8.4217.17ON100257990.006
KAFR0A021302.565ON70740990.006
YMR019W (STB4)2.565ON94943990.006
KAFR0I020301.380ON123330990.006
NCAS0C002208.879ON83929990.007
TBLA0D006307.389ON107743990.007
KNAG0I014501.380ON147630990.007
Kpol_467.11.380ON128930990.007
TPHA0C049808.879ON85244990.008
NCAS0A088401.380ON147866990.008
KNAG0A025508.423ON73038980.008
Kwal_26.7095na 1ON83851980.008
TPHA0C022208.416ON70276980.008
Ecym_27321.380ON119830980.009
NCAS0A076107.17ON102233980.009
Skud_11.1902.547ON117150980.009
KLLA0A10329gna 13ON63939980.009
CAGL0F07909g3.109ON104936980.009
TPHA0H012405.59ON87739980.009
TPHA0F008304.113ON119257980.009
Skud_5.331singletonON17038930.009
NCAS0C027308.423ON77539980.010
KNAG0A02300singletonON72931980.010
AFL160C6.279ON64847970.010
Smik_15.3426.60ON81053970.010
NDAI0D035504.113ON111842980.010
CAGL0F09229gna 14ON83533970.011
KLLA0C03201g1.128ON650158970.011
SAKL0D07898g1.380ON124430970.011
Kwal_YGOB_0.1391.380ON124030970.012
Ecym_8404na 4ON88568970.012
ZYRO0G22550gsingletonON72437970.012
Skud_13.1732.565ON92039970.012
YGR288W (MAL13)na 15ON47330960.012
TPHA0B036301.380ON142932970.012
TBLA0G00490singletonON91864970.013
YLR256W (HAP1)1.380ON150230970.013
Suva_7.2684.113ON100038970.013
KLTH0H11572g1.380ON123730970.014
TDEL0B004808.879ON83529960.014
Kwal_23.6537na 8ON55248960.014
Smik_11.2102.547ON116950960.014
Kwal_34.15751na 6ON62833960.015
NCAS0I002707.17ON94433960.015
KNAG0A071002.547ON128650960.015
AFR117C1.380ON115230960.015
KLLA0A03421gna 12ON88054960.015
NDAI0A034204.113ON110833960.016
KNAG0M00120singletonON88152960.016
KLLA0F19602g8.283ON60341960.016
TBLA0G005106.60ON93537960.016
ADR404Cna 12ON87533960.016
KLLA0F02750g3.109ON114836960.016
KLTH0E05786gna 14ON81749960.017
Ecym_72354.113ON94345960.017
NCAS0A016304.113ON104338960.018
NDAI0E034608.423ON94942960.018
NDAI0K001508.879ON95329960.018
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00530
         (1301 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...  2453   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...  1115   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...  1069   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   988   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   954   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   919   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   904   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   804   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   807   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   790   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   780   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   774   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     739   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   732   0.0  
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    697   0.0  
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   644   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   624   0.0  
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    90   2e-17
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    90   3e-17
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    85   8e-16
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    85   8e-16
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    85   9e-16
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    85   1e-15
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    84   2e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    84   2e-15
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    84   2e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    84   2e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    83   3e-15
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    82   5e-15
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    82   8e-15
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    82   9e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    76   1e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    79   6e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            77   2e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    75   1e-12
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    74   2e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    68   1e-10
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               58   1e-07
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   2e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    54   3e-06
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    53   6e-06
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    53   6e-06
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    52   7e-06
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    52   1e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    52   1e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    52   1e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    52   1e-05
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    51   2e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    51   2e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     51   2e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    51   2e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   3e-05
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    50   3e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    50   3e-05
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    50   3e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    50   3e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    50   3e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    50   3e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    50   3e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    50   3e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    50   3e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    50   4e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    50   4e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    50   4e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    50   5e-05
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    50   5e-05
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    50   5e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    50   5e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    50   5e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    49   6e-05
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    49   6e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   7e-05
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    49   7e-05
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    49   7e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    49   8e-05
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    49   9e-05
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    49   9e-05
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     49   1e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    49   1e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    49   1e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    49   1e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    49   1e-04
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    48   1e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    48   2e-04
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    48   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    48   2e-04
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    48   2e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    48   2e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    48   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    48   2e-04
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    48   2e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    47   2e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    47   3e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    47   3e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    47   3e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   3e-04
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    47   3e-04
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    47   3e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    47   3e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    47   4e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    47   4e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    47   4e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    46   4e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 47   4e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    47   5e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    46   5e-04
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    46   5e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    46   6e-04
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    46   6e-04
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    46   6e-04
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    46   6e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    46   7e-04
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    46   7e-04
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    46   7e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    46   7e-04
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    46   7e-04
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    46   7e-04
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    46   8e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    45   8e-04
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   9e-04
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    45   0.001
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    45   0.001
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    45   0.001
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   0.001
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    45   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.001
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    45   0.001
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    45   0.001
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    45   0.001
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.001
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    45   0.001
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    45   0.001
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 45   0.002
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    45   0.002
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    45   0.002
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.002
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    45   0.002
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    45   0.002
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    45   0.002
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    45   0.002
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    45   0.002
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    45   0.002
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    44   0.002
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    44   0.002
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    44   0.002
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    44   0.002
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    44   0.002
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.002
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    44   0.002
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    44   0.002
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               44   0.002
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    44   0.002
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    44   0.003
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    44   0.003
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    44   0.003
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    44   0.003
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    44   0.003
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    44   0.003
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    44   0.003
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    44   0.003
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    44   0.003
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    44   0.003
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.003
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    44   0.003
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    44   0.003
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    44   0.003
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    41   0.003
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    44   0.003
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    44   0.003
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    44   0.004
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    44   0.004
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    44   0.004
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.004
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    44   0.004
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             44   0.004
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.004
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    44   0.004
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    43   0.004
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    44   0.004
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    43   0.005
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    44   0.005
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    44   0.005
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               43   0.005
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    43   0.005
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    44   0.005
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    43   0.005
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    43   0.005
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    43   0.005
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    43   0.005
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    43   0.005
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    43   0.005
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    43   0.006
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    43   0.006
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    43   0.006
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    43   0.006
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    43   0.006
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       43   0.007
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    43   0.007
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              43   0.007
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    43   0.007
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    43   0.008
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    43   0.008
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    42   0.008
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    42   0.008
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    42   0.008
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.009
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    42   0.009
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    42   0.009
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    42   0.009
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    42   0.009
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    42   0.009
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    42   0.009
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    40   0.009
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.010
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.010
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.010
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    42   0.010
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    42   0.010
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.011
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    42   0.011
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.011
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.012
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    42   0.012
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.012
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    42   0.012
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    42   0.012
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    42   0.012
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                42   0.013
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    42   0.013
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    42   0.013
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    42   0.014
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.014
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    42   0.014
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    42   0.014
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    42   0.015
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    42   0.015
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    42   0.015
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    42   0.015
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    42   0.015
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    42   0.016
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      42   0.016
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.016
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    42   0.016
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    42   0.016
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    42   0.016
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    42   0.017
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    42   0.017
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    42   0.018
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     42   0.018
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    42   0.018
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    42   0.018
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    42   0.018
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    41   0.018
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    41   0.019
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    42   0.019
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    41   0.019
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    41   0.019
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    41   0.020
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    41   0.020
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    41   0.020
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    41   0.020
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    41   0.021
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    41   0.021
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    41   0.021
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    41   0.022
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    41   0.022
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    41   0.022
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    41   0.022
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    41   0.022
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    41   0.023
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    41   0.023
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    41   0.023
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    41   0.023
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    41   0.023
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    41   0.024
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    41   0.024
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    41   0.025
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               41   0.025
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    41   0.025
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    41   0.025
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               41   0.025
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    41   0.026
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    41   0.026
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.027
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    41   0.027
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    41   0.027
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               41   0.027
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.027
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    41   0.028
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    41   0.028
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    41   0.028
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    41   0.028
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    40   0.029
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    41   0.029
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    41   0.031
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    40   0.031
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    40   0.032
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    41   0.033
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    40   0.034
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    40   0.034
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    40   0.034
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    40   0.035
ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON} ...    40   0.036
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    40   0.036
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    40   0.037
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.040
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.041
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.043
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.043
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    40   0.044
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    40   0.044
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    40   0.045
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.045
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    40   0.047
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    40   0.048
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    40   0.048
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    40   0.048
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.049
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    40   0.049
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    40   0.051
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.052
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.054
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    40   0.054
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    40   0.055
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    40   0.055
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    40   0.055
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    40   0.056
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    39   0.056
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    40   0.057
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    40   0.058
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    40   0.059
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    40   0.059
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    40   0.059
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    40   0.060
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    40   0.060
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    40   0.060
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    40   0.063
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    40   0.065
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    40   0.066
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    40   0.066
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    39   0.068
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    39   0.070
SAKL0G19404g Chr7 (1667193..1670582) [3390 bp, 1129 aa] {ON} sim...    39   0.072
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    39   0.074
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    39   0.075
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    39   0.076
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    39   0.079
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.080
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    39   0.080
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.081
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    39   0.081
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    39   0.083
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.084
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    39   0.087
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.087
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       39   0.087
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.088
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    39   0.088
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.089
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    39   0.089
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    39   0.091
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    39   0.093
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.096
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               39   0.10 
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    39   0.10 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    39   0.10 
NCAS0F03850 Chr6 (772412..774649) [2238 bp, 745 aa] {ON} Anc_3.5...    39   0.10 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    39   0.11 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    39   0.11 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.11 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    39   0.11 
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    39   0.11 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    39   0.11 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    39   0.11 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.11 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    39   0.12 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.12 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    39   0.12 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    39   0.12 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.12 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    39   0.12 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    39   0.12 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    39   0.12 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    39   0.12 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    39   0.12 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    39   0.12 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    39   0.13 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    39   0.13 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    39   0.13 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    39   0.14 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.14 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.14 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    39   0.14 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    39   0.14 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.14 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.14 
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    39   0.14 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    39   0.14 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    39   0.14 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    38   0.14 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    39   0.15 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.15 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    39   0.15 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    39   0.15 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    38   0.15 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    38   0.16 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    38   0.16 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    38   0.16 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.16 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    38   0.17 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    38   0.17 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    38   0.17 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    38   0.17 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.18 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    38   0.18 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    38   0.18 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    38   0.19 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    38   0.19 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    38   0.19 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    38   0.19 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    38   0.19 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    38   0.19 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    38   0.20 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    38   0.20 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    38   0.20 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.20 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    38   0.20 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    38   0.21 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    38   0.21 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    38   0.21 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    38   0.21 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    38   0.21 
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    38   0.22 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.22 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     38   0.22 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    38   0.22 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    38   0.22 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    38   0.22 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    38   0.22 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    38   0.23 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    38   0.23 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    38   0.24 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    38   0.24 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.24 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    38   0.24 
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    38   0.24 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    38   0.24 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    38   0.25 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    38   0.25 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    38   0.25 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    38   0.25 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.26 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.27 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.27 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.27 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    37   0.28 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.28 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.28 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    37   0.30 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.30 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    37   0.30 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    37   0.31 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    37   0.31 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.32 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.32 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.32 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    37   0.33 
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             37   0.33 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    37   0.33 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    37   0.33 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.34 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.34 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    37   0.35 
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    37   0.35 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    37   0.36 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    37   0.36 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    37   0.37 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    37   0.38 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.38 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.38 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    37   0.38 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     37   0.38 
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    37   0.38 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.39 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.39 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.40 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    37   0.41 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.41 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    37   0.42 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.43 
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    37   0.43 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    37   0.44 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    34   0.44 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    37   0.45 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    37   0.45 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    37   0.45 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    37   0.45 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    37   0.46 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.46 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    37   0.46 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    37   0.47 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.47 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    37   0.48 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    37   0.49 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    37   0.50 
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    37   0.51 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    37   0.52 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    37   0.53 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    37   0.53 
KLLA0F02299g Chr6 (205549..208167) [2619 bp, 872 aa] {ON} conser...    37   0.55 
NCAS0I02410 Chr9 (451205..453964) [2760 bp, 919 aa] {ON} Anc_3.1...    37   0.56 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    37   0.56 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    37   0.57 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    37   0.59 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    37   0.59 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    36   0.62 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    36   0.62 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    36   0.63 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    36   0.64 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      36   0.66 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    36   0.66 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    36   0.67 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    36   0.67 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    36   0.69 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    36   0.69 
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    36   0.69 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    36   0.70 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    36   0.71 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    36   0.71 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.75 
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    36   0.78 
Skud_4.87 Chr4 (152240..153826) [1587 bp, 528 aa] {ON} YDL170W (...    36   0.80 
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    36   0.82 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    36   0.82 
NCAS0A00300 Chr1 (43991..46324) [2334 bp, 777 aa] {ON} Anc_1.26 ...    36   0.82 
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    36   0.83 
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    36   0.84 
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    36   0.84 
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    36   0.85 
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    36   0.88 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    36   0.89 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    36   0.89 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    36   0.90 
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    36   0.91 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    36   0.91 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   0.92 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    36   0.93 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    36   0.93 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      36   0.94 
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    36   0.94 
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    36   0.94 
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    36   0.97 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    36   0.97 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    36   0.99 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    36   0.99 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               36   0.99 
Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W...    35   1.1  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    35   1.1  
Ecym_5662 Chr5 complement(1338979..1341174) [2196 bp, 731 aa] {O...    35   1.1  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   1.1  
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    35   1.1  
KLTH0D01694g Chr4 (166143..168788) [2646 bp, 881 aa] {ON} conser...    35   1.1  
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    35   1.2  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.2  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    35   1.2  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   1.2  
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    35   1.2  
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    35   1.3  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    35   1.3  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    35   1.3  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    35   1.3  
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    35   1.3  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    35   1.4  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   1.4  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    35   1.4  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   1.4  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.4  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    35   1.4  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    35   1.5  
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    35   1.5  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   1.5  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.6  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    35   1.6  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    35   1.6  
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    35   1.6  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    35   1.7  
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    35   1.7  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    35   1.7  
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    35   1.8  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    35   1.8  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    35   1.9  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    35   1.9  
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    35   1.9  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     35   2.0  
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    35   2.1  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    35   2.1  
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    35   2.1  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   2.2  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   2.2  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    35   2.2  
Suva_10.457 Chr10 (799837..800427) [591 bp, 196 aa] {ON} YLR356W...    33   2.2  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    35   2.2  
AGL348W Chr7 (56615..58804) [2190 bp, 729 aa] {ON} NOHBY723; No ...    34   2.3  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    34   2.5  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    34   2.5  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    34   2.6  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   2.7  
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    34   2.7  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    34   2.8  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    34   2.9  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   3.0  
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    34   3.0  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    34   3.2  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    34   3.3  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    34   3.4  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   3.4  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    34   3.6  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    33   3.7  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    34   3.8  
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    34   3.8  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   3.9  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   3.9  
KLTH0F08074g Chr6 (701778..703685) [1908 bp, 635 aa] {ON} some s...    33   4.0  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    33   4.0  
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    33   4.2  
Smik_4.801 Chr4 complement(1403910..1406225) [2316 bp, 771 aa] {...    33   4.2  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    33   4.4  
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     33   4.6  
TPHA0J00190 Chr10 (44450..45142) [693 bp, 230 aa] {ON}                 33   4.7  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   4.9  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   5.0  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   5.4  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   5.6  
Suva_2.374 Chr2 complement(656129..658624) [2496 bp, 831 aa] {ON...    33   6.0  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    33   6.1  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   6.4  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    33   6.6  
Kpol_1002.43 s1002 complement(126474..128096) [1623 bp, 540 aa] ...    33   6.7  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    33   7.6  
KLTH0H16236g Chr8 (1400457..1402148) [1692 bp, 563 aa] {ON} cons...    33   7.8  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    33   7.8  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    33   7.8  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     32   8.1  
TBLA0F03550 Chr6 complement(875734..876630) [897 bp, 298 aa] {ON...    32   8.6  
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    33   8.9  
Kwal_23.3178 s23 (185722..187557) [1836 bp, 611 aa] {ON} YDR207C...    32   9.4  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    32   9.6  

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score = 2453 bits (6357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1210/1301 (93%), Positives = 1210/1301 (93%)

Query: 1    MKEMAAKDGGPKYIRTMXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDNGSEDVRSAKRK 60
            MKEMAAKDGGPKYIRTM                            LDDNGSEDVRSAKRK
Sbjct: 1    MKEMAAKDGGPKYIRTMGSQSLSGLNPLSSGGSSQVSISHSPSVLLDDNGSEDVRSAKRK 60

Query: 61   SPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCS 120
            SPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCS
Sbjct: 61   SPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCS 120

Query: 121  QCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFP 180
            QCAAVGFECRISDKLSRRAFPRGY                     CDIKEQQIHLVSHFP
Sbjct: 121  QCAAVGFECRISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDIKEQQIHLVSHFP 180

Query: 181  TNKKKIGGNDEQMLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHE 240
            TNKKKIGGNDEQMLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHE
Sbjct: 181  TNKKKIGGNDEQMLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHE 240

Query: 241  HTGKHRCDELDCNNKLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLA 300
            HTGKHRCDELDCNNKLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLA
Sbjct: 241  HTGKHRCDELDCNNKLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLA 300

Query: 301  TLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDEL 360
            TLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDEL
Sbjct: 301  TLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDEL 360

Query: 361  DYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHI 420
            DYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHI
Sbjct: 361  DYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHI 420

Query: 421  PILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTK 480
            PILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTK
Sbjct: 421  PILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTK 480

Query: 481  VKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVS 540
            VKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGV                YFVNTGNVS
Sbjct: 481  VKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFVNTGNVS 540

Query: 541  AIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600
            AIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLG
Sbjct: 541  AIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600

Query: 601  VPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFK 660
            VPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFK
Sbjct: 601  VPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFK 660

Query: 661  RGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQ 720
            RGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQ
Sbjct: 661  RGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQ 720

Query: 721  MVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLL 780
            MVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLL
Sbjct: 721  MVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLL 780

Query: 781  QQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDV 840
            QQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDV
Sbjct: 781  QQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDV 840

Query: 841  VKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRP 900
            VKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRP
Sbjct: 841  VKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRP 900

Query: 901  ILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESS 960
            ILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESS
Sbjct: 901  ILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESS 960

Query: 961  DTSNALVDKSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFFGGNM 1020
            DTSNALVDKSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFFGGNM
Sbjct: 961  DTSNALVDKSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFFGGNM 1020

Query: 1021 PAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDE 1080
            PAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDE
Sbjct: 1021 PAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDE 1080

Query: 1081 YYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFND 1140
            YYPSGTS                  GLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFND
Sbjct: 1081 YYPSGTSHINLTLFNNNANNHDDTFGLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFND 1140

Query: 1141 RLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASDRSGIILD 1200
            RLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASDRSGIILD
Sbjct: 1141 RLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASDRSGIILD 1200

Query: 1201 SSIPQSEDALSTLADRVNKTQSVPVPTLASHGYKNLPATQSEQLAHGIDSNDDNGPAMLT 1260
            SSIPQSEDALSTLADRVNKTQSVPVPTLASHGYKNLPATQSEQLAHGIDSNDDNGPAMLT
Sbjct: 1201 SSIPQSEDALSTLADRVNKTQSVPVPTLASHGYKNLPATQSEQLAHGIDSNDDNGPAMLT 1260

Query: 1261 LGSXXXXXXXXQMDYNSTSNTSNRVPQEANLSNLFHWQNSK 1301
            LGS        QMDYNSTSNTSNRVPQEANLSNLFHWQNSK
Sbjct: 1261 LGSRRGPRRRRQMDYNSTSNTSNRVPQEANLSNLFHWQNSK 1301

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score = 1115 bits (2885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/1156 (55%), Positives = 763/1156 (66%), Gaps = 121/1156 (10%)

Query: 91   AANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXX 150
            A + NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISD+LSRRAFPRGY      
Sbjct: 93   AGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEE 152

Query: 151  XXXXXXXXXXXXXXXCDIKEQQIHLVS--HFPTNKKKIGGNDEQMLQELTGANNGRLRIS 208
                           CDIKEQQIHL S  H P  ++K   +DE+ML+EL  AN G L IS
Sbjct: 153  RVRELEAENRRLVALCDIKEQQIHLFSQQHSPGGRRK---DDERMLRELQSANGGSLNIS 209

Query: 209  STNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNKLHSKPVSTNLNDP 268
            STNL+LLN    G        G     +   +    H CD L C  KLH KPVSTNLNDP
Sbjct: 210  STNLYLLNT---GSHQRQGPQGPQQQEQLTQQKRQPHVCDGLCCAGKLHVKPVSTNLNDP 266

Query: 269  TAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIH 328
            T++SFEQ+EAPGLPAV+ALTS+ATREQS QLATLVALSVPRSTEEILFIPQLLARI QI+
Sbjct: 267  TSVSFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIY 326

Query: 329  GFTSKQCLYSVSLLASLKNNLPGPQLVKWDELDYLKTTNLWEVDNLDKFFHETLKFNILR 388
            GFTSKQCLY+VSLL+SLK++LP P LVK + L+ L +TNLWE+D+L++FF E  KF +  
Sbjct: 327  GFTSKQCLYTVSLLSSLKSSLPEPHLVKHEPLETLASTNLWEMDDLEQFFAEIFKFKLES 386

Query: 389  PGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQ- 447
               S       L++ EI+EL+++FF+  ++HIPIL K+EF+ Y+++ K+++       + 
Sbjct: 387  KSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEFLKT 446

Query: 448  --EGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYYHRAIS 505
              +GP+  ARR KIISYKIF CI+  +CQ+GLL+K+K E +  A S + +L SYYH+AIS
Sbjct: 447  PLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENL-GATSKHHRLASYYHKAIS 505

Query: 506  LIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAV 565
            L+Y+NPYFGV                YF+N GNVSAIYELRGRVVSMAQQLRLHRCPSAV
Sbjct: 506  LVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAV 565

Query: 566  LGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVS 625
            LGG+GSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVA+NDDR V+
Sbjct: 566  LGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVN 625

Query: 626  LAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRG 685
            LAGQ IRLEG+V+ +SLAIIRF+KVLGNILD++FKRGMTES++K+++LIHENALDNWR G
Sbjct: 626  LAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHG 685

Query: 686  LPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVSYFLAKCMIHLPVVATRPLP 745
            LP ELIFE++VNGTIN+D+FN +KQ N TVE  E M LLV YFLAKCMIHLPVVATRPLP
Sbjct: 686  LPKELIFELDVNGTINIDEFNRLKQMNVTVERSENMTLLVMYFLAKCMIHLPVVATRPLP 745

Query: 746  SSDDPNSDIKEEEEVN-------DKNGESNFAI--RSSSSYVLLQQATNTMLNVLESLKS 796
            ++D  ++        N       D + E N A   RSSSSYVLLQQATNTMLNVLESLK+
Sbjct: 746  TNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKT 805

Query: 797  IYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVI 856
            ++LPLP N++RTKARFALLSARGSLEY KGGALFLDNK+LLLDV+K +EEDRKL++PGVI
Sbjct: 806  LFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVI 865

Query: 857  SWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRR 916
            SW+ LKLLDM+I+LLLQPPNT+V KLDRLLKKKLNYY+R+MGRP +K     QE   K  
Sbjct: 866  SWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTVK-----QEPASK-- 918

Query: 917  NSSDDKLSRSGTEENFRATNLTPISSK-SDGSPVEKKIKLEDESSDTSNALVDKSYTDDL 975
                               +LTP SSK  + +P  K+IK+E    +TS  L        +
Sbjct: 919  -----------------GHDLTPASSKDEEDTPAAKRIKIE----ETSIPLAVPQQQQHM 957

Query: 976  SSSANQPQVPASTQ------------------------------TAIAEALHLDPVLNNN 1005
             + A     P   Q                              TA AEAL LDPVLN+N
Sbjct: 958  QAPA-----PVMVQEKQQPQPQPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSN 1012

Query: 1006 I-LSVADLAAFFGGNMPAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGV 1064
            +    A     + G        QH + T   D    H+         SD  H        
Sbjct: 1013 VSFQNAPPTTLYDGPHDQPHQYQHHAQTQPQD---PHLDTRS-----SDKLH-------- 1056

Query: 1065 DGLFRVPSNADFLMDEYYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNFNVK 1124
             GLF+VPS ADFLMD+   S  +                    + G G   G+N   N+ 
Sbjct: 1057 -GLFKVPSTADFLMDDSANSQLNFLLGTTELGVLDPSQPSYTNNPGSGSAIGIN---NMP 1112

Query: 1125 GGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTH 1184
             G   +N   L    D+   N    T +   NSG  FNFAVDASLGLAPLL W+P     
Sbjct: 1113 SGLNLSNLFDLEGSTDQPPTNT-NATQATQANSGG-FNFAVDASLGLAPLLAWTP----- 1165

Query: 1185 GKTVSHASDRSGIILD 1200
                    D +GI+LD
Sbjct: 1166 --------DHNGIVLD 1173

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score = 1069 bits (2764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1182 (51%), Positives = 753/1182 (63%), Gaps = 129/1182 (10%)

Query: 86   TSVNSAAN-----SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAF 140
            TSV S A+     SN RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKLSRRAF
Sbjct: 70   TSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAF 129

Query: 141  PRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKK--KIGGN-DEQMLQEL 197
            PRGY                     CD+KE+Q+HLVS + +NK+  +I  N DEQ+LQ+L
Sbjct: 130  PRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKY-SNKRTSEISENEDEQILQQL 188

Query: 198  TGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNK-- 255
            + AN G LR+SSTNL+LLNK   G Q     + +D M+           C+ + CN+   
Sbjct: 189  SAANGGSLRVSSTNLYLLNKTTPGDQ----QDEEDQMSSKTTVD-----CNGVGCNHSHQ 239

Query: 256  --LHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEE 313
              +H KPVSTNLNDPT+ISFEQNEAPGLPAVKALTSMA  E S QLATLVALSVPRSTEE
Sbjct: 240  PNIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEE 299

Query: 314  ILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDELDYLKTTNLWEVDN 373
            IL IPQLLARI Q+HG TSKQ LY+ SLLASLK ++P   L     +D LK+TNLWEVD+
Sbjct: 300  ILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIP---LTLPTNVDMLKSTNLWEVDD 356

Query: 374  LDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYD 433
            + +FF    KF+I     +   + L  +  EID LV+ FF  W   IPILDK+EF++YY+
Sbjct: 357  VIQFFQTVFKFDIQAESSTTSQDHLIAT--EIDGLVSDFFSQWYNFIPILDKDEFYNYYN 414

Query: 434  KLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPY 493
            K K D+   P  F +  + F +RNK ISYKIF CIL  +CQMGL++KVK E +  A + Y
Sbjct: 415  KFKTDL-MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENL-PATNKY 472

Query: 494  VKLTSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMA 553
             +L +YY   +  + +NPYF +                YF+N G VS++Y+LRG+VVSM+
Sbjct: 473  SQLMAYYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMS 532

Query: 554  QQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECA 613
            QQLRLHRCPSAVLGG+GS ++K +QG+RR+LFWGIYYLDVFSALQLGVPRL+KD EIECA
Sbjct: 533  QQLRLHRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECA 592

Query: 614  LPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLAL 673
            LPVA+NDD++V+LAGQMI LEGRVS  SL++IRFAKVLGNILD++FKRGM+ S++K+++L
Sbjct: 593  LPVADNDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISL 652

Query: 674  IHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQ--NNATVENVEQMVLLVSYFLAK 731
            +HENALDNWRRGLP +L FE++VNGTINMD+FN +KQ   +  + + E   L+V YF+AK
Sbjct: 653  VHENALDNWRRGLPQQLKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAK 712

Query: 732  CMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVL 791
            CMIHLPVVA RPL   +DP      E+        +N   RSSSSYVLLQQATNT+LNV 
Sbjct: 713  CMIHLPVVAKRPL--VNDP------EQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVF 764

Query: 792  ESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLE 851
             SL+++Y P+P NV+RTK RF+LLSARGSLEY KGGALF DNKALLLD+VK +E D+KLE
Sbjct: 765  TSLRNVYPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLE 824

Query: 852  IPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEA 911
            +PG +SWH LKLLDM+ISL+LQP NTK EKL+++L++KLNYY+++  R        R   
Sbjct: 825  LPGTLSWHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNR--------RSNL 876

Query: 912  NGKRRNSSDDKLSRSGTEEN---FRATNLTPISSKSDGSPVEKKIKLEDESSDTSNALVD 968
             G R  SS    S+   +EN        LTP SSK D +P +KKIKLED       A+  
Sbjct: 877  GGGRSASSPGGNSKRKLDENQGSAEPPKLTPASSKGD-TPPDKKIKLEDTGFVPVRAVSQ 935

Query: 969  KSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFF---GGNMPAA-- 1023
             S +D       QP  P + Q +IAEA HLDPVLNNN  S  DL AFF    GN+PAA  
Sbjct: 936  HSQSDSEKFENFQP--PVAPQNSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALR 993

Query: 1024 -GGN-------QHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNAD 1075
             GG+         +S  N N  AP +   E                    GLF+VPSN D
Sbjct: 994  SGGSLFNIAATAAASGNNANSTAPSNTLNE--------------------GLFKVPSNGD 1033

Query: 1076 FLMDEYYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNFNVKGGHQSTNHSHL 1135
            FL D Y   G S                    S+G  +  G            S+ HS  
Sbjct: 1034 FLKDYYNVPGASSSQLNLLFLNNNA-------SNGKPQLNG------------SSAHS-- 1072

Query: 1136 TNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASDRS 1195
                        G     N N+G  F FAVDAS GLAPLL+WSP          +A++ S
Sbjct: 1073 ------------GTQAQNNDNNG--FGFAVDASWGLAPLLEWSPAGKPVDPGTCNANENS 1118

Query: 1196 GIILDSSIPQSEDALSTLADRVNKTQSVP-------VPTLAS 1230
             IILD+S    E  ++T     + T+S         VPTL S
Sbjct: 1119 -IILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPS 1159

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/1114 (50%), Positives = 706/1114 (63%), Gaps = 123/1114 (11%)

Query: 93   NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXX 152
            +SN RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKLSRRAFPRGY        
Sbjct: 65   SSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERV 124

Query: 153  XXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKKK--IGGNDEQMLQELTGANNGRLRISST 210
                         CD+K++Q+HLV  + +NK+       +EQML++L+ +N G LR+SST
Sbjct: 125  RELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGGSLRVSST 184

Query: 211  NLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNN----KLHSKPVSTNLN 266
            NL+LLNK      PA             HE    H+C  +DCN+     LH KPVST L+
Sbjct: 185  NLYLLNKT----SPA------------GHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLS 228

Query: 267  DPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQ 326
            DPT ISFEQ+EAPGLPAVKAL+SMA  E STQLA LVALSVPRSTEEILFIPQLLAR+ Q
Sbjct: 229  DPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQ 288

Query: 327  IHGFTSKQCLYSVSLLASLKNNLPGPQLV-KWDELDYLKTTNLWEVDNLDKFFHETLKFN 385
            +HG TSKQCLY+ SLLASLK   P   +V   D L  LK T+LWE+D+  +FF ++ KFN
Sbjct: 289  VHGLTSKQCLYTASLLASLKE--PSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFN 346

Query: 386  ILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGL 445
            +   G  +D E L  SI EI++L++++F+     IP+L++ EF+ YY+K K+ ++  P  
Sbjct: 347  L---GSDNDVELL--SISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNF 401

Query: 446  FQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYYHRAIS 505
            F +  S+FA R+K ISYKIFACIL  VCQ+G+++KVK E++  A S + ++ +YY+ AI 
Sbjct: 402  FGKANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQL-PAKSKFSRIMAYYNNAIL 460

Query: 506  LIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAV 565
             + LNPYF V                YF+N G VS++YELRG +VSMAQQLRLHRCPSAV
Sbjct: 461  ALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAV 520

Query: 566  LGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVS 625
            LG  GSTM+K EQGDRR+LFWGIYYLDVFSALQLGVPRL+KD EIECALP++EN    VS
Sbjct: 521  LGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVS 580

Query: 626  LAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRG 685
            LA Q+IRLEG+VS+FSL+++RF+K+LGNILD++FKRGMT S+++++ALIHENALD+WRRG
Sbjct: 581  LADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRG 640

Query: 686  LPAELIFEIEVNGTINMDKFN---EMKQNNATVENVEQMVLLVSYFLAKCMIHLPVVATR 742
            LP  L FE++VNGTINM++ N     K++ +T  + +   L+V YFL KC++HLPV+A +
Sbjct: 641  LPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAK 700

Query: 743  PL---PSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESLKSIYL 799
            PL    S  D ++ +  ++  +  +       RSSSSYVLLQQATNT L+V  SLKS +L
Sbjct: 701  PLLGGASEVDTDATLAFDDASSGAD-------RSSSSYVLLQQATNTFLSVQSSLKSRHL 753

Query: 800  PLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWH 859
            PL  N+ R KARFALLSARG LEY KGGALF  NKALLLDVVK +E  ++LEIPG +SWH
Sbjct: 754  PLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWH 813

Query: 860  GLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRRNSS 919
             L LLDM +SL++QPP+TK  KLD+LL+ KL+YY+++MGR     S+        +R   
Sbjct: 814  SLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVAST--------KRKKE 865

Query: 920  DDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLED-----------ESSDTSNALVD 968
            +D  S S       AT LTP+SS S     EK++KLE            E++   N    
Sbjct: 866  EDNTSLSN------ATKLTPLSSDSSSP-SEKRVKLEHTDKVGETPVGVENTGQPNGNTQ 918

Query: 969  KSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFFGGN--MPAAGGN 1026
            + Y    S+  NQP       + +AEA HLDPVLNNN  S  DL AFF  +  MP   G 
Sbjct: 919  EHYAATWSNQ-NQP------HSTVAEAFHLDPVLNNNPFSNGDLTAFFSTDNGMPNLSGG 971

Query: 1027 QHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDEYYPSGT 1086
              +S  N       H     + A  +  A+ + S    DGLFRVPSN DFL D Y   G 
Sbjct: 972  --ASMLNMVGVDQAHSTAGND-AQNTVNANSQQSTLFNDGLFRVPSNGDFLKDYYRVPGA 1028

Query: 1087 SXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFNDRLQGNQ 1146
            S                      G G            G +Q       TN  D      
Sbjct: 1029 SSSQLNLMLM-------------GSGSS----------GSNQRQAKQQQTNTTD------ 1059

Query: 1147 LGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPE 1180
                          F F VDASLGLAPLL WSPE
Sbjct: 1060 ------------PGFGFTVDASLGLAPLLAWSPE 1081

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1136 (48%), Positives = 708/1136 (62%), Gaps = 121/1136 (10%)

Query: 72   RPRLNTEVSEVA--SYTSVNSAA-NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 128
            +PR N   +  A  S + V SA   SN RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE
Sbjct: 41   QPRTNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 100

Query: 129  CRISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKKKIGG 188
            C++SDKLSRRAFPRGY                     CD+K++Q+HLVS + +NK+    
Sbjct: 101  CKVSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEPS 160

Query: 189  NDEQ--MLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHR 246
            + E+  ML++L+ ++ G LR+SSTNL+LLNK      PA + +G +            H+
Sbjct: 161  STEEGRMLEQLSNSDGGSLRVSSTNLYLLNKT----TPA-VQDGSE-----------LHK 204

Query: 247  CDELDCNNK----LHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATL 302
            C  L CN+     LH KPVST+L+DP AISFEQNEAPGLPAVKAL +MA  E S QLA L
Sbjct: 205  CQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYL 264

Query: 303  VALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDELDY 362
            VALSVPRST+EILFIPQLLAR+ Q+HG TSKQCLYS SLLA+LK +    Q       DY
Sbjct: 265  VALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLAALKES---SQTSFQGSPDY 321

Query: 363  --LKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHI 420
              LK  +LWE+D+   FF    KFN+     S D E L  +I EI+EL++++F      I
Sbjct: 322  KDLKDKSLWEIDDCMTFFKTGCKFNLTS---SKDAECL--TISEIEELISIYFGECHALI 376

Query: 421  PILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTK 480
            P+L++ EF+ YY+K K +++T P  F+    +FA+R+K ISYKIFACIL  +CQ GL+ K
Sbjct: 377  PVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAK 436

Query: 481  VKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVS 540
            VK E++ + +  +  L SYY  A+  +  NPYF V                Y++N G VS
Sbjct: 437  VKREQLPTKNK-FSLLMSYYSNALLALKTNPYFSVKNTSIQTLQLLSLLLFYYLNVGEVS 495

Query: 541  AIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLG 600
            ++YE+RG VVSMAQQLRLHRCPSAVLG  GSTM+K EQGDRR+LFWGIYYLDVF ALQLG
Sbjct: 496  SVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLG 555

Query: 601  VPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFK 660
            VPRL+KD EIECALP++E+    VSLA Q+I+LEG+VS+ SL+++RF+K+LGNILD++FK
Sbjct: 556  VPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFK 615

Query: 661  RGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATV---EN 717
            RGMT S ++++ALIHENALDNWRRGLP  L FE++VNGTI +++     QNN       +
Sbjct: 616  RGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNAS 675

Query: 718  VEQMVLLVSYFLAKCMIHLPVVATRP-LPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSS 776
             ++ +L++ YFL KC++HLPV+A +P L  S +P+ D     +       S+ A RSSSS
Sbjct: 676  SDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFD-----DASSGADRSSSS 730

Query: 777  YVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKAL 836
            YVLLQQATNT L+V    K+ +LPL  ++ R KARFALLSARG LEY KGGALF DNKAL
Sbjct: 731  YVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKAL 790

Query: 837  LLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRV 896
            LL+VVK +E  +KLE+PG +SWH L LLDM   L++QPP TK +KLD+LL+ +LNYY+++
Sbjct: 791  LLEVVKELEASKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKL 850

Query: 897  MGRPILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLE 956
            MGR  L +       NGKR+N  +D  S        + + LTP+SS+ + +P +K+IK+E
Sbjct: 851  MGRSTLTS-------NGKRKNEENDATS--------KVSKLTPLSSEYN-TPSDKRIKVE 894

Query: 957  D-------ESSDTSNALVDKSYTDDLSSS--ANQPQVPASTQTAIAEALHLDPVLNNNIL 1007
                     S+  S    D    D  S++  +N PQ       AIAEA HLDPVLN N  
Sbjct: 895  SIGSSGNVPSNSESVHHFDDIQNDKFSTNWPSNNPQ-----PNAIAEAFHLDPVLNGNPF 949

Query: 1008 SVADLAAFFGGN--MPAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGV- 1064
            S  DL AFF  +  +P  GG   SS  N       +  +       +     +   T V 
Sbjct: 950  SNGDLTAFFNSDNGIPQIGGG--SSVLNLAGIGAANSNELNNNNNEAAGGGPRKVATTVN 1007

Query: 1065 DGLFRVPSNADFLMDEYYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNFNVK 1124
            DGLFRVPSN DFL D Y   G S                      G G +TG N N    
Sbjct: 1008 DGLFRVPSNGDFLKDYYRIPGASSSQLNLMFM-------------GPG-NTGANQN---A 1050

Query: 1125 GGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPE 1180
              +Q  N                 FT  G       F F VDASLGLAPLL WSPE
Sbjct: 1051 PNNQKNN-----------------FTVPG-------FGFTVDASLGLAPLLAWSPE 1082

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/1325 (43%), Positives = 753/1325 (56%), Gaps = 212/1325 (16%)

Query: 86   TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYX 145
            T ++S   +N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKLSRRAFPRGY 
Sbjct: 62   TPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYT 121

Query: 146  XXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHF-----------PTNKKKIGGN----D 190
                                CD+KE+Q+ LVS +             NKK    +    D
Sbjct: 122  ETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSANKKGDSDHTTLED 181

Query: 191  EQMLQELTGANNGRLRISSTNLFLLNK----------ARDGKQPATI-SNGDDHMT-KPD 238
            EQ+LQ+L+ ++ G LR+SSTNL+LLNK           +    P  + SN     T  P 
Sbjct: 182  EQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPS 241

Query: 239  HEHTGKHRCDELDCNNKLHSKPVS-------------TNLNDPTAISFEQNEAPGLPAVK 285
            H     H  D       L + PV+             TNLNDPT+ISFEQ++APGLPAVK
Sbjct: 242  HVAEADHVTD---LRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVK 298

Query: 286  ALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASL 345
            AL+S+A+ E+S+QLA LVA+S+PR+TEEILF+PQLLARI Q+HGFTSKQCLY+ S+LASL
Sbjct: 299  ALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASL 358

Query: 346  KNNLPGPQLVKWDELDYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDD----------- 394
            K   P         L+ LK  NLWE+DN+D F  E L+ +I R G S D           
Sbjct: 359  KEITP---RKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRR-GSSGDFNLENPNGYKL 414

Query: 395  --------------GESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDIS 440
                           E   L+ +EI+EL+ LFFD W   IPI D+ EF SY+ K K ++S
Sbjct: 415  ENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVS 474

Query: 441  TQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYY 500
            T PG F  G + F RR+K ISYKIFAC+L TVCQMGL++KVK E+    D     L +YY
Sbjct: 475  T-PGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDR-LNNLMTYY 532

Query: 501  HRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMAQQLRLHR 560
             RAIS + +NPYF                  YF+N G+VS +YELRG+VVS+ QQLRLHR
Sbjct: 533  DRAISHVIMNPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHR 592

Query: 561  CPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAEND 620
            CPSAVLG  GST+ K +QG+RRVLFWG+YYLDVFS+LQLGVPRL+KD EIECALPV+ +D
Sbjct: 593  CPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDD 652

Query: 621  DREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALD 680
            D  V+LAGQMI LEG++S FSL+IIRF+KVLGN+LD++FKRGMTES++K++AL+HENALD
Sbjct: 653  DNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALD 712

Query: 681  NWRRGLPAELIFEIEVNGTINMDKFNEMKQ---NNATVENVEQMVLLVSYFLAKCMIHLP 737
            NWR  LP  L F+++VNGTINM+  N++K+   N  T   +   + +  YFLAK MIHLP
Sbjct: 713  NWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLP 772

Query: 738  VVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESLKSI 797
            VVAT+P+         I + + V D N   +   RSSSSYVLLQQATNT LNVL S+ S+
Sbjct: 773  VVATKPI---------IDKPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFLNVLSSVSSL 823

Query: 798  YLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVIS 857
            YLPLP N+ RTK RF L+SARGSLEY KGGALF DNK LLLD++K +E D+KL +PG IS
Sbjct: 824  YLPLPLNITRTKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTIS 883

Query: 858  WHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSL---------R 908
            WH LKLLDM ++L+LQPPNTK EK ++LL+KK+NYY++++   +  T+SL         +
Sbjct: 884  WHSLKLLDMAVNLILQPPNTKPEKQEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRK 943

Query: 909  QEANGKRRNSSDDKL--SRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESSD--TSN 964
             E    R     +K   S+    ++  A ++ P+        +EKK+KLE  +S+  T  
Sbjct: 944  PEPAHARPIPEKEKPPSSKRHRGDDNAAASMPPL--------LEKKVKLEAPASNMPTPP 995

Query: 965  ALVDKSYTD---------------DLSSSANQPQ--VPASTQTAIAEALHLDPVLNNNIL 1007
            A +   + D                + ++ ++P+  + +S   AI EA  LDP+L     
Sbjct: 996  APISALHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPF 1055

Query: 1008 SVADLAAFFGGNMPAAGGNQHSSYTNQNDFAPKHMRKEKEP--AAFSDLAHKKSSVTGVD 1065
            S  DL +FF       G +Q+++      F   +   +K P  AA    A     ++  D
Sbjct: 1056 SNTDLPSFF-------GVDQYAAPPELQPFPAGYAAPDKVPQAAAQGPSATAGPPLSSKD 1108

Query: 1066 GLFRVPSNADFLMDEYYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNFNVKG 1125
             LF+VPSN DFL D Y                        G+S        +N+ F    
Sbjct: 1109 SLFKVPSNGDFLKDYY-----------------------SGMSSAQ-----LNSLFTAPD 1140

Query: 1126 GHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSP----EM 1181
                         + R +  Q     S  +     + F VDASLGLAPLL WSP    ++
Sbjct: 1141 RR-----------DVRPRAPQPDRAPSDGLQQQPGYGFVVDASLGLAPLLAWSPRPADDL 1189

Query: 1182 HTHGKTVSHASDRSGIILD--SSIPQSEDALSTLADRVNKTQSVPVPTLASHGYKNLPAT 1239
                K    AS RS   ++  SSIP            +  TQ  P P  A H     PA 
Sbjct: 1190 LLDDKGAKLASARSFTHVNKLSSIPT-----------LMSTQ--PPPASAPHAKLGQPAP 1236

Query: 1240 QSEQLA-HGIDSNDDNGPAMLTLGSXXXXXXXXQMDYNSTSNTSNRVPQEA---NLSNLF 1295
              +      I   D  GP  L               +NS  N +   P  A   ++S+LF
Sbjct: 1237 PDQDDGILTIPPRDQRGPRRL---------------WNSALNQAR--PAAALDDSISDLF 1279

Query: 1296 HWQNS 1300
             WQNS
Sbjct: 1280 RWQNS 1284

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/974 (49%), Positives = 619/974 (63%), Gaps = 95/974 (9%)

Query: 97   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXX 156
            RVAQACDRCR+KK RCDGKRPQC+QCAAVGFEC+ISDKLSRRAFPRGY            
Sbjct: 178  RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 237

Query: 157  XXXXXXXXXCDIKEQQIHLVSHFPTNKKKIG-----GNDEQMLQELTGANNGRLRISSTN 211
                     CD+KE+Q+HLVS +  +K + G       +EQ+L EL+  N G LR+SSTN
Sbjct: 238  AENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSSTN 297

Query: 212  LFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNKLHSKPVSTNL------ 265
            L+LLNK       + I + +  +       T          N+   S P  TN       
Sbjct: 298  LYLLNKKASPGDDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADSDPSQTNTGNNDHI 357

Query: 266  ------------NDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEE 313
                         DP  ISFEQNEAPGLPA+KAL+S++  +Q TQLATLVA+SVPR+TEE
Sbjct: 358  HSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPRTTEE 417

Query: 314  ILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNN----LPGPQLVKWDELDYLKTTNLW 369
            ILF+PQLLARI QIHGFTSKQC+Y+ S+LASLK N    +P        EL+ LK  NLW
Sbjct: 418  ILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIP-------PELEVLKNHNLW 470

Query: 370  EVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFF 429
            E+D++  F+    K + +    + D  S  L+  E++EL+ LFF  W   IP+ DK EF 
Sbjct: 471  EIDDVLHFWKNVFKLDFMT-HTAVDHSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFN 529

Query: 430  SYYDKLKKDISTQPGLF-QEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITS 488
            SYY+K K ++ T P  F ++  + F  R + ISYKIF+C+L  + QMG+L+K+K +KITS
Sbjct: 530  SYYEKFKLNV-TDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITS 588

Query: 489  ADSPYVKLTSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGR 548
                   L  YY + ++ I++NPYF                  Y +N G++S+IYELRG+
Sbjct: 589  GK--LSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGK 646

Query: 549  VVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDF 608
            VVSM+QQLRLHRCPSAVLGG GST++K +QG+RR+LFW IYYLDVFSALQLGVPRL+KDF
Sbjct: 647  VVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDF 706

Query: 609  EIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVS 668
            EIECALPV  +DDR+V+LAGQMI LEG+VSQFSL++IRFAKV+GNILD+ FKRGMT S++
Sbjct: 707  EIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLT 766

Query: 669  KKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVE------NVEQMV 722
            K+ AL+HENALDNWR GL  +L F+++VNGTINMD+FN+ KQ + ++           +V
Sbjct: 767  KQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLV 826

Query: 723  LLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAI-RSSSSYVLLQ 781
            L+  YF+AKCMIHLPVVAT+PL         + E  +    N   N ++ RS SSYVLLQ
Sbjct: 827  LMTLYFMAKCMIHLPVVATKPL---------VAEAIQTPTDNQTENGSVDRSLSSYVLLQ 877

Query: 782  QATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVV 841
            QATNT+LNVL +L SIYLPLP N+ARTK RF L SARGSLEY KGGALF DNKALLLD+V
Sbjct: 878  QATNTLLNVLTALNSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLV 937

Query: 842  KSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPI 901
            K +E D+KLE+PG  SWH LKL D++I+L+LQP N+  EK +++++KK+NYY+++MG+P 
Sbjct: 938  KELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPT 997

Query: 902  LKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDE-SS 960
            +     R                        +AT  T            KK+K+ED+ S 
Sbjct: 998  VAVKRKRDP----------------------KATENT-----------SKKVKVEDDHSQ 1024

Query: 961  DTSNALVDKSYTDDLSSSANQPQVPASTQ------TAIAEALHLDPVLNNNILSVADLAA 1014
            D  + +     TD + S      VP          T I EA  +DPVLN N+ S  DL  
Sbjct: 1025 DNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMDPVLNTNLFSNTDLKT 1084

Query: 1015 FFGGNMPAAGGNQH 1028
             F   +    G+ H
Sbjct: 1085 LFNSGIFENAGSIH 1098

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 49/120 (40%), Gaps = 20/120 (16%)

Query: 1065 DGLFRVPSNADFLMDEYYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNF--- 1121
            D LF+VPSN DFL D YY +  S                           +G  TN    
Sbjct: 1180 DSLFKVPSNGDFLKD-YYINNMSNTGLSNLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYS 1238

Query: 1122 NVKGGHQSTNHSHLTNFN-DRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPE 1180
            NV+G    + H    N N  R Q    GF+            FA DASLGLAPLL WSP+
Sbjct: 1239 NVRG---ESKHPSGVNLNKQRAQPAMDGFS------------FAADASLGLAPLLAWSPD 1283

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1193 (41%), Positives = 686/1193 (57%), Gaps = 167/1193 (13%)

Query: 86   TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYX 145
            + VN  ++SN RV QACDRCRSKKTRCDG++PQCSQCAAVGFEC++SDKL R+A+PRGY 
Sbjct: 16   SDVNHPSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYT 75

Query: 146  XXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKKKIGGNDEQMLQ---------- 195
                                CD+KEQQI LV+ + +NK  I   D  +++          
Sbjct: 76   ESIEERVRELEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNN 135

Query: 196  ---EL---------TGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTK------- 236
               EL         T  N+  L IS TNL+LLN+    ++ A ++NG+    +       
Sbjct: 136  IKGELNKDRQNDVTTIPNSLPLNISQTNLYLLNQT---QKKAELNNGNKMFQQNQSNVST 192

Query: 237  ----------------------------PDHEHTGK--------------HRCDELDCNN 254
                                        P   HT                H CD + C +
Sbjct: 193  SSSSSPFFANKLNSNGTIRSPESNTTVSPLESHTKNLKSNIRNNNTTTTTHVCDGICCTD 252

Query: 255  KLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEI 314
            KLH +PV+TN NDPT+ISFEQ+EAPGL A KAL S+  +E++TQLA LV+LSVPRSTEEI
Sbjct: 253  KLHPQPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEI 312

Query: 315  LFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDELD-------YLKTTN 367
            LFIPQLLA+I Q+HGFTSKQCLY+VSLL+SLKN+LP P   K D L         LK TN
Sbjct: 313  LFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSP---KSDFLMDNSQNSLLLKNTN 369

Query: 368  LWEVDNLDKFFHETLKFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEE 427
            +W++++L+ FF + LKFNI     +D   S  LS  +ID+L NL+F+ W+  IP+L++EE
Sbjct: 370  IWQINDLNVFFTDLLKFNI----SNDSKTSTLLSFDDIDDLTNLYFNHWSNLIPVLNEEE 425

Query: 428  FFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKIT 487
            FF+ Y+  K     Q   F +G     + N +  YK F C L  +CQMGLL K+K  K  
Sbjct: 426  FFNRYNNFK----IQCQSFIQG----NQSNNLRDYKFFGCFLMVMCQMGLLIKLKEHK-- 475

Query: 488  SADSPYVKLTSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRG 547
             +++   K+ +YYH+   ++  NP +                  Y +N GN+  IYELRG
Sbjct: 476  -SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIEQIYELRG 534

Query: 548  RVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKD 607
             ++SMA QLRLHRCPSAVL GSGSTM K EQ +RR+LFW IYYLDVFS+LQLGVPRL+KD
Sbjct: 535  NIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLGVPRLLKD 594

Query: 608  FEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESV 667
            +EIECALPV +N     ++ G  I+LEG VSQ SL + RFAKVLGNI+D++FKR M+ S+
Sbjct: 595  YEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFKRNMSTSI 653

Query: 668  SKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVSY 727
            S+++ALIHENALDNWR  LP +  F+++VNGTIN+        N+   EN + + L+V Y
Sbjct: 654  SRQVALIHENALDNWRSRLPEQFQFKLDVNGTINL--------NDLDTENSDTIFLIVFY 705

Query: 728  FLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTM 787
            FLAKCMIHLPV +T+           +  E++V +   +  +  R S+SYV LQQ+TNTM
Sbjct: 706  FLAKCMIHLPVCSTK-----------VDLEDKVTETGNDVIYNDRFSTSYVSLQQSTNTM 754

Query: 788  LNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEED 847
            LN L  ++  YLP+PFNV+RT  RF L+SA+GSL+YIKGG+LF+DNK LLLD V+ IE +
Sbjct: 755  LNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEAN 814

Query: 848  RKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSL 907
            RKL++PG+ISWH LKLLD+T++L LQ  NTK EK+++LL+KKLNYY+++MG+P++K   +
Sbjct: 815  RKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPLVKNLPI 874

Query: 908  RQEANGKRRNSSDDKLSRSGTEENFRATN-LTPISSKSDG-SPVEKKIKLEDESSDTSNA 965
            ++  N  + N++D+   +   +E     N L PI   ++G +P +    +   +S+T+N 
Sbjct: 875  QKRTNQNKGNNNDEPSRKKVKKELENDINSLHPILIDNEGVTPSDAAPLINKTNSNTNNP 934

Query: 966  LVDKSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNI--LSVADLAAFFGGNMPAA 1023
            +V                   +TQ   AEAL +DP+LN++    S  DLA  F  +    
Sbjct: 935  VV-------------------TTQNEFAEALQVDPILNSDYYQFSNLDLATLFNSDKLNK 975

Query: 1024 GGNQHSSYTNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDEYYP 1083
              + H S  N  D  P +   +     FS +    +S   ++ L R     +   + + P
Sbjct: 976  INSHHGSSINLIDQKPFN---DSLIPKFSQVNTASNSTLNMEQLLRNQGKFNISPNIFSP 1032

Query: 1084 S--------GTSXXXXXXXXXXXXXXXXXXGLS------DGHGKDTGVNTNFNVKGGHQS 1129
            +        G S                   L+      +     + +N+N   + G   
Sbjct: 1033 NFQSKENLLGNSKVNNNLLYSNLKNNSNNQSLTTMMMLLNNEIPFSSINSNTG-ESGVNK 1091

Query: 1130 TNHSHLTNFNDRLQGNQLGFTN---SGNM----NSGSDFNFAVDASLGLAPLL 1175
             N +   N N      +   TN   SGNM    N  SDF++ +D SLGLAPLL
Sbjct: 1092 QNANATENDNVETINFKQDLTNKNESGNMLSTENYLSDFSYIIDGSLGLAPLL 1144

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/876 (50%), Positives = 568/876 (64%), Gaps = 79/876 (9%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXX 156
           R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL R+A+P+GY            
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 123

Query: 157 XXXXXXXXXCDIKEQQIHLVSHF--PTN-KKKIGGNDEQMLQELTGANNGRLRISSTNLF 213
                    CDIKEQQI+LVS    PT+    +  N +Q L++        L +SSTN++
Sbjct: 124 AENKRLLALCDIKEQQINLVSQSRPPTSLDNTVSDNFKQDLKD------APLNLSSTNIY 177

Query: 214 LLNKARDGKQPATISNGDDHMTKPDHEH----------TGKHRCDELDCNNKLHSKPVST 263
           LLN+  + +    + NG     + D                H CD + C N LH+KP ST
Sbjct: 178 LLNQTVNKQ----LQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTNNLHAKPTST 233

Query: 264 NLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLAR 323
           +LNDPTAISFEQNEAPGLPAVKAL SM T ++STQLATLV+LS+PRSTEEILFIPQLL R
Sbjct: 234 SLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTR 293

Query: 324 IIQIHGFTSKQCLYSVSLLASLKNNLPGPQLV------KWDE------LDYLKTTNLWEV 371
           I QI GF SKQCLY+VSLL+SLKN LP P+L+      K  E      L+  +TT+L E 
Sbjct: 294 IRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNTFETTSLAEF 353

Query: 372 DNLDKFFHETLKFNI-----LRPGVSDD-GESLGLSIKEIDELVNLFFDSWAVHIPILDK 425
            +L KF   +LKF+I      +P V ++  ++  LS+ EI EL++LFF  W+  + IL+ 
Sbjct: 354 GDLKKFLI-SLKFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLHLFFKFWSNQVSILNN 412

Query: 426 EEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEK 485
           + F  Y++   + I   P   +   +N  + +   +++IFA  L  + QMGLL KVK EK
Sbjct: 413 DHFLLYFNNFVEVIKALP--LELKKTNGTKTHATTNHQIFALKLLIMLQMGLLIKVKREK 470

Query: 486 ITSA-----DSPYVKLTSYYHRAISLIYLNPYF-GVXXXXXXXXXXXXXXXXYFVNTGNV 539
           I        +S + KL  YYH+  S+I  NPYF  +                YF+N G++
Sbjct: 471 IKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFLNVGDI 530

Query: 540 SAIYELRGRVVSMAQQLRLHRCPSAVLG-GSGSTMNKREQGDRRVLFWGIYYLDVFSALQ 598
            AIY LRGR+VSM+QQLRLHRCPSAVL   S   + + EQ +RR+LFW +YY+DVF++LQ
Sbjct: 531 PAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDVFASLQ 590

Query: 599 LGVPRLIKDFEIECALPVA--ENDDREVSLAGQM------IRLEGRVSQFSLAIIRFAKV 650
           LGVPRL+KDF+IECALP++  E +D+  S   +       I+L+G+VS FSL IIRFAK+
Sbjct: 591 LGVPRLLKDFDIECALPISDVEFEDQLASENEKTKNKTKKIQLQGQVSSFSLQIIRFAKI 650

Query: 651 LGNILDTVFKRGMT-ESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKF---- 705
           LGNILD++FKRGM  E V+ ++AL+HENALDNWR  LP    F+I VNGT+N+D      
Sbjct: 651 LGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDDIRANN 710

Query: 706 ---NEMKQNNATVENVEQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVND 762
               E K +   +   E+ VLL+ YFLAK MIHLPV+AT+PLP + D ++  K     ND
Sbjct: 711 SRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTVDNSTKKKHSMFNND 770

Query: 763 KNGESNF------------AIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKA 810
               +N             AIR+SSSY++LQQATN  L + +S+ S+YLPLP NV+RT  
Sbjct: 771 TKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSINSVYLPLPLNVSRTLI 830

Query: 811 RFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISL 870
           RF+LL ARGSLEY KGGALFLDNK LLLD +K IE DR L++PGV SWH LKL DMTI+L
Sbjct: 831 RFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHTLKLFDMTINL 890

Query: 871 LLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSS 906
           LL+ PN KVE+LD+ L+KKLNYY+R+MG P   T+S
Sbjct: 891 LLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTS 926

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 1116 GVNTNFNVKGGHQSTNHSHLT----NFNDRLQGNQLGFTNS--GNMN-SGSDFNFAVDAS 1168
             V++NFN      +T+ S +T    N  D    N  G  N+   N+N SG D+++ VDAS
Sbjct: 1199 NVSSNFNPASTASNTSRSSITGNKKNGMDNCDINDFGNFNNFMTNVNYSGVDYDYIVDAS 1258

Query: 1169 LGLAPLLDWSPEMHTHGKTVSHAS-DRSGIILDSSIPQSEDALSTLADRV-NKTQSV 1223
            LGLAPLL  +P++     T + ++  ++ IILD +     D   + A  V N T S+
Sbjct: 1259 LGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDPTFNDDSDRSHSNAREVLNPTDSI 1315

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/899 (48%), Positives = 573/899 (63%), Gaps = 86/899 (9%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXX 156
           R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL R+A+P+GY            
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 124

Query: 157 XXXXXXXXXCDIKEQQIHLVSHF---PTNKKKIGGNDEQMLQELTGANNGRLRISSTNLF 213
                    CDIKEQQI LVS      +    I GN +  L++        L +SSTN++
Sbjct: 125 AENKRLLALCDIKEQQISLVSQSRPQTSTDNTINGNFKHDLKD------APLNLSSTNIY 178

Query: 214 LLNKARDGKQPATISNGDDH------MTKPDHEHTGKHRCDELDCNNKLHSKPVSTNLND 267
           LLN+  + +      +GD+       +  P       H CD + C N LH KP ST+LND
Sbjct: 179 LLNQTVNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTNHLHVKPTSTSLND 238

Query: 268 PTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQI 327
           PTAISFEQ+EAPGLPAVKAL SM T ++STQLATLV+LS+PRSTEEILFIPQLL RI QI
Sbjct: 239 PTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQI 298

Query: 328 HGFTSKQCLYSVSLLASLKNNLPGPQLVKWDE-------------------LDYLKTTNL 368
            GF SKQCLY+VSLL+SLKN LP P+L+                       +   ++TNL
Sbjct: 299 FGFNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNL 358

Query: 369 WEVDNLDKFFHETLKFNI-------LRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIP 421
            E  +L KF   +LKFNI        +P    D E L L+  EI EL++LFF  W+  +P
Sbjct: 359 SEFVDLKKFLI-SLKFNINSFSKQSEKPANDQDDELLSLT--EIKELLHLFFKFWSNQVP 415

Query: 422 ILDKEEFFSYYD---KLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLL 478
           IL+ + F  Y++   ++ K +ST+        +N  +     +++IFA  L  + QMGLL
Sbjct: 416 ILNNDHFLIYFNNFVEVVKHLSTE----NLETNNTTKSTVTTNHEIFALKLLMMLQMGLL 471

Query: 479 TKVKGEKI--TSADSP---YVKLTSYYHRAISLIYLNPYF-GVXXXXXXXXXXXXXXXXY 532
            K+K EKI  T   +P   Y +L +YYH+   +I  NPYF  +                Y
Sbjct: 472 VKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFY 531

Query: 533 FVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GSGSTMNKREQGDRRVLFWGIYYL 591
           ++N G++SAIY +RGR+VSMAQQLRLHRCPSAVL   S   + K EQ +RR+LFW IYY+
Sbjct: 532 YLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYV 591

Query: 592 DVFSALQLGVPRLIKDFEIECALPVAE--------NDDREVSLAGQMIRLEGRVSQFSLA 643
           DVF++LQLGVPRL+KDF+IECALP+++         ++ +     + I+L+G+VS FSL 
Sbjct: 592 DVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQ 651

Query: 644 IIRFAKVLGNILDTVFKRGMT-ESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINM 702
           IIRFAK+LGNILD++FKRGM  E ++ ++AL+HENALDNWR  LP    F+I VNGT+N+
Sbjct: 652 IIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNL 711

Query: 703 DKFNEMKQNNATVEN-------VEQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIK 755
           D+     Q N   +         E+ +LL+ YFLAK MIHLPV+AT+PLP + D  +  K
Sbjct: 712 DEIRATNQRNTETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNVDNATKKK 771

Query: 756 EEEEVNDKNGESNF------------AIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPF 803
           +    ND  G +N             AIR+SSSY++LQQATN  L + +++ S+YLPLP 
Sbjct: 772 QSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPL 831

Query: 804 NVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKL 863
           NV+RT  RF+LL ARGSLEY KGGALFLDNK LLLD +K IE DR L++PG+ SWH LKL
Sbjct: 832 NVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKL 891

Query: 864 LDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRRNSSDDK 922
            DM+I+LLL+ PN KVE+LD+ L+KKLNYY+R+MG P   T+SL+     + +NS +++
Sbjct: 892 FDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPLFGSQSKNSLENR 950

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 91/208 (43%), Gaps = 40/208 (19%)

Query: 1123 VKGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMN-SGSDFNFAVDASLGLAPLLDWSPEM 1181
             K G  + + + L NFN+ +           N+N SG D+++ VDASLGLAPLL  +P++
Sbjct: 1237 TKHGMDNCDFNDLGNFNNFMT----------NVNYSGVDYDYIVDASLGLAPLLVDTPDI 1286

Query: 1182 HTHGKTVSHAS-DRSGIILDSSIPQSEDALSTLADRV-NKTQSV----PVPTLASHGYKN 1235
                 T + ++  ++ IILD++     D     A  V N T S+     V ++++    N
Sbjct: 1287 SNTNTTSTTSNRSKNSIILDTTFNDDLDRSRMNAREVLNPTDSILSQGMVSSVSTRNTSN 1346

Query: 1236 LPATQSEQLAHGIDSNDDNGPAMLTLGSXXXXXXXXQMDYNST----SNTSNRVPQEA-- 1289
              +  S   + G  S+ +N  +  T           QM   S+    S+   R PQ+   
Sbjct: 1347 QRSLSSGNDSKGDSSSQENSKSA-TGNQLDTPSTLFQMRRTSSGPSASHRGPRRPQKNRY 1405

Query: 1290 ----------------NLSNLFHWQNSK 1301
                            N+S+LF WQN+K
Sbjct: 1406 NTDRSKSSGGGSSNTDNVSDLFQWQNAK 1433

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/927 (48%), Positives = 591/927 (63%), Gaps = 87/927 (9%)

Query: 76  NTEVSEVASYTSVNSAANSNL-----RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 130
           N   SE     +VN+ + + L     R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFECR
Sbjct: 38  NPHFSENIKEATVNTTSPTPLSTPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 97

Query: 131 ISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKKKIGGND 190
           ISDKL R+A+P+GY                     CDIKEQQI LVS    +       D
Sbjct: 98  ISDKLLRKAYPKGYTESLEERVRELEAENKRLLALCDIKEQQISLVSQSRPSTSLDSNVD 157

Query: 191 EQMLQELTGANNGRLRISSTNLFLLNKARDGK-QPATISNGD-----DHMTKPDHEHTGK 244
               +EL  A    L +SSTN++LLN+  + + Q   + N +     D +          
Sbjct: 158 GNCKKELKDA---PLNLSSTNIYLLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSPPPKD 214

Query: 245 HRCDELDCNNKLHSKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVA 304
           H CD + C N+LH KP ST+L+DPTAISFEQNEAPGLPAVKAL SM T ++STQLATLV+
Sbjct: 215 HVCDGVSCTNRLHVKPTSTSLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVS 274

Query: 305 LSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLV--------- 355
           LS+PRSTEEILFIPQLL RI QI GF SKQCLY+VSLL+SLKN LP P ++         
Sbjct: 275 LSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSK 334

Query: 356 -------KWDELDYLKT---TNLWEVDNLDKFFHETLKFNI----LRPGVSDDG-ESLGL 400
                    D+  +LKT   T+L E  +L KF   +LKF+I     +P    +G +S  L
Sbjct: 335 EKNEDKTPNDDSAFLKTFQSTSLSEFVDLKKFLI-SLKFDIDSFSKQPEKQANGHDSDLL 393

Query: 401 SIKEIDELVNLFFDSWAVHIPILDKEEFFSYYD---KLKKDISTQPGLFQEGPSNFARRN 457
           S+ EI EL++LFF  W+  +PIL+ + F  Y++   ++ KD S    L     ++  + N
Sbjct: 394 SLTEIKELLHLFFKFWSNQVPILNNDHFLLYFNNFVEIIKDFS----LISTKANSTTKNN 449

Query: 458 KIISYKIFACILFTVCQMGLLTKVKGEKIT-----SADSPYVKLTSYYHRAISLIYLNPY 512
              +++IF   L  + QMGLL K+K +KI      ++++ Y++L SYYH+   +I  NPY
Sbjct: 450 VTTNHEIFTLKLLMMLQMGLLIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPY 509

Query: 513 F-GVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GSG 570
           F  +                Y++N G++SAIY +RGR+VSMAQQLRLHRCPSAVL   S 
Sbjct: 510 FLNMSTTSLPSLQLLSLASFYYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSN 569

Query: 571 STMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAE--------NDDR 622
             + K EQ +RR+LFW IYY+DVF++LQLGVPRL+KDF+IECALP+++         ++ 
Sbjct: 570 PVLQKFEQSERRLLFWAIYYVDVFASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENE 629

Query: 623 EVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMT-ESVSKKLALIHENALDN 681
           ++    + I+L+G+VS FSL IIRFAK+LGNILD++FKRGM  E +S ++AL+HENALDN
Sbjct: 630 KMKNKAKKIQLQGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDN 689

Query: 682 WRRGLPAELIFEIEVNGTINMDKFNEMKQNNAT-VEN---------VEQMVLLVSYFLAK 731
           WR  LP    F+I VNGT+N+D   E++ NN+  +E           E+ +LL+ YFLAK
Sbjct: 690 WRNQLPEMYYFKITVNGTVNLD---EIRANNSRDIETPFETKDIILFEKKILLLFYFLAK 746

Query: 732 CMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNF------------AIRSSSSYVL 779
            MIHLPV+AT+PL  + D     K+    ND  G +N             AIR+SSSY++
Sbjct: 747 SMIHLPVIATKPLSKNVDNVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYII 806

Query: 780 LQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLD 839
           LQQATN  L + +S+  +YLPLP NV+RT  RF+LL ARGSLEY KGGALFLDNK LLLD
Sbjct: 807 LQQATNATLTIFQSINWMYLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLD 866

Query: 840 VVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGR 899
            +K IE DR LE+PG+ SWH LKL DMTI+LLL+ PN KVE+LD+ L+KKLNYY+R+MG 
Sbjct: 867 TIKDIENDRLLELPGIASWHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGL 926

Query: 900 PILKTSSLRQEANGKRRNSSDDKLSRS 926
           P+  T+SL+     + +NS + K  +S
Sbjct: 927 PLATTTSLKPLFGFQSKNSPETKPRKS 953

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 1157 SGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHAS-DRSGIILDSSIPQSEDALSTLAD 1215
            SG D+++ VDASLGLAPLL  +P++     T + ++  ++ IILDS+     D   T A 
Sbjct: 1261 SGVDYDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDSTFNDDLDRSHTNAR 1320

Query: 1216 RV 1217
             V
Sbjct: 1321 EV 1322

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/949 (46%), Positives = 596/949 (62%), Gaps = 99/949 (10%)

Query: 97   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXX 156
            R+AQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL R+A+P+GY            
Sbjct: 65   RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 124

Query: 157  XXXXXXXXXCDIKEQQIHLVSHF--PTNKKKIGGNDEQMLQELTGANNGRLRISSTNLFL 214
                     CDIKEQQI LVS    PT+         +  QEL  A    L +SSTN++L
Sbjct: 125  AENKRLLALCDIKEQQISLVSQSRPPTSMDNTANGSFK--QELKDA---PLNLSSTNIYL 179

Query: 215  LNKA-----RDGKQPATISNGD-DHMTKPDHEHTGKHRCDELDCNNKLHSKPVSTNLNDP 268
            LN+      ++GK  +  SN   + +          H CD + C N LH KP ST+LNDP
Sbjct: 180  LNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTNHLHVKPTSTSLNDP 239

Query: 269  TAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIH 328
            TAISFEQ+EAPGLPAVKAL  M T ++STQLATLV+LS+PRSTEEILFIPQLL RI QI 
Sbjct: 240  TAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIF 299

Query: 329  GFTSKQCLYSVSLLASLKNNLPGPQLV------KWDE-------------LDYLKTTNLW 369
            GF SKQCLY+VSLL+SLKN LP P+L+      K  E                 +TTNL 
Sbjct: 300  GFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAFFKKFQTTNLS 359

Query: 370  EVDNLDKFFHETLKFNI-----LRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILD 424
            E  +L K F  +LKF+I         + +D ++  LS+ EI EL++LFF  W+  +PIL+
Sbjct: 360  EFVDL-KGFLVSLKFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKFWSNQVPILN 418

Query: 425  KEEFFSYYD---KLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKV 481
             + F  Y++   ++ KD+S+         ++    N    +++FA  L  +  MGLL K+
Sbjct: 419  NDHFLLYFNNFVEVVKDLSSANLKTNVTNTSIVTTN----HELFALKLSMMLLMGLLVKI 474

Query: 482  KGEKIT-----SADSPYVKLTSYYHRAISLIYLNPYF-GVXXXXXXXXXXXXXXXXYFVN 535
            K EKI      + +S Y +L +YYH+   +I  NPYF  +                Y++N
Sbjct: 475  KMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLN 534

Query: 536  TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG-GSGSTMNKREQGDRRVLFWGIYYLDVF 594
             G++SAIY +RGR+VSMAQQLRLHRCPSAVL   S   + K EQ +RR+LFW IYY+DVF
Sbjct: 535  VGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVF 594

Query: 595  SALQLGVPRLIKDFEIECALPVAENDDRE--------VSLAGQMIRLEGRVSQFSLAIIR 646
            ++LQLGVPRL+KDF+IECALP+++ + ++         +   + I+L+G+VS FSL IIR
Sbjct: 595  ASLQLGVPRLLKDFDIECALPISDVEYKDQLFMENKKTNKKAKKIQLQGQVSSFSLQIIR 654

Query: 647  FAKVLGNILDTVFKRGMT-ESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMD-- 703
            FAK+LGNILD++FKRGM  E ++ ++AL+HENALDNWR  LP    F+I VNGT+N+D  
Sbjct: 655  FAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNGTVNLDEI 714

Query: 704  KFNEMKQNNATVEN-----VEQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEE 758
            + N+ K      E       E+ +LL+ YFLAK MIHLPV+AT+PLP + D  +  K+  
Sbjct: 715  RVNDSKNIETRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNIDNGTKKKQSV 774

Query: 759  EVNDKNGESNF------------AIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVA 806
              ND  G ++             AIR+SSSY++LQQATN  L + +++  +Y+PLP NV+
Sbjct: 775  FSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTINWMYIPLPLNVS 834

Query: 807  RTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDM 866
            RT  RF+LL ARGSLEY KGGALFLDNK LLLD +K IE DR L++PG  SWH LKL DM
Sbjct: 835  RTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGTASWHTLKLYDM 894

Query: 867  TISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRRNSSDDKLSRS 926
            TI+LLL+ PN KVE+LD+ L+KKLNYY+R+MG P+  T+S++     + ++S + +  +S
Sbjct: 895  TINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPILGSQSKDSPETRPRKS 954

Query: 927  -------------GTEENFR---ATNLTPISSKSDGSPVEKKIKLEDES 959
                         G ++N +     + +PI + S+GS   K++K E ++
Sbjct: 955  IVKRENPEYEYLYGKDDNKKNNSGPDQSPIENTSNGS---KRLKYETDT 1000

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 48/88 (54%), Gaps = 12/88 (13%)

Query: 1125 GGHQS-------TNHS-HLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLD 1176
             GH+S       TNH     +FND   GN   F  + N  SG D+++ VDASLGLAPLL 
Sbjct: 1225 AGHRSQSSSIGNTNHGVDNCDFNDL--GNFNNFMTNVNY-SGVDYDYIVDASLGLAPLLV 1281

Query: 1177 WSPEMHTHGKTVSHAS-DRSGIILDSSI 1203
             +P++     T + ++  ++ IILD + 
Sbjct: 1282 DTPDISNTNTTSTTSNRSKNSIILDPTF 1309

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/829 (48%), Positives = 525/829 (63%), Gaps = 102/829 (12%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXX 152
           +SNLR+AQACDRCRSKKTRCDGKRPQCSQCA VGFEC+ISDKL R++FPRGY        
Sbjct: 72  DSNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKV 131

Query: 153 XXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKKKIGGNDEQMLQELTGANNGRLRISSTNL 212
                        C   + Q           +K    D    QE   +            
Sbjct: 132 RELENENRRLLAICQFNKLQ----------SQKNDTIDNSTTQEEVYS------------ 169

Query: 213 FLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNN----KLHSKPVSTNLNDP 268
                 R     +T    D ++T           C + +CNN     LH KPVST     
Sbjct: 170 -----IRSNSASSTAIETDSNITT----------CLDTNCNNDTHNHLHMKPVSTK-PPQ 213

Query: 269 TAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIH 328
             ISFEQNEAPGL AVKAL SMA  EQSTQLATLVAL++PRST+EILFIPQLL++I Q  
Sbjct: 214 NIISFEQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNF 273

Query: 329 GFTSKQCLYSVSLLASLKNNLPGPQLVKWDE------LDYLKTTNLWEVDNLDKFFHETL 382
           GFTSK CLY+VSLL+SLK NLP P+++  +       L+ LK TNLW+ D+L +F ++ L
Sbjct: 274 GFTSKHCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYL 333

Query: 383 KFNILRPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQ 442
           K + L    S+D     L+  E+DEL+N FF  W   IPI++KEEF S Y+  K D+   
Sbjct: 334 KLDPLNQKNSNDL----LNQIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDLKN- 388

Query: 443 PGLFQEGPSNFARRNKI-----ISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVK-L 496
                      + R+K+     ++YKIF CIL  +CQMGLLTK+K     S+ + ++K +
Sbjct: 389 -----------SERDKLSSNLKMNYKIFGCILVLMCQMGLLTKIKATNGKSSPNIHLKSI 437

Query: 497 TSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMAQQL 556
            +YYH+ I+ + +N +F +                Y +N G++SAIYELRGR++SM+QQL
Sbjct: 438 MAYYHQLIANLPINNFFQIATISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQL 497

Query: 557 RLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPV 616
           RLHRCPSAVL GS  TMNK +Q +RR+LFW IY LD  S+LQLGVPRL+KD+EIECALP+
Sbjct: 498 RLHRCPSAVLSGSSLTMNKLDQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPI 557

Query: 617 A-ENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIH 675
             E+ +R+ +     I+LEG VS FSLAI RF+K+LGNILD +FKR MTES++K ++LIH
Sbjct: 558 TMEDKERDKT----KIKLEGTVSPFSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLIH 613

Query: 676 ENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVSYFLAKCMIH 735
           ENALD WR  LP +L F++ + G+I++   N M Q N+T    + ++L+  YF A  MIH
Sbjct: 614 ENALDQWRYDLPEDLTFKLNIQGSIDL---NVMHQGNST-PGKKNLILMFFYFFAVSMIH 669

Query: 736 LPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESL- 794
           LPVVA RPL        D+K                RSSSSY+ LQ A NTMLNVLE L 
Sbjct: 670 LPVVAARPL--------DVKNA-----------MPDRSSSSYIALQHAINTMLNVLELLN 710

Query: 795 ---KSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLE 851
              K+ YLP+P N++R + R AL+S+RG L+YIKGGALFLDNK LLL V+K++E DR L+
Sbjct: 711 NQPKNYYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLD 770

Query: 852 IPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRP 900
           +PGV+SWH LKL D+TI+L +Q  N K+EKLD++L+KK NYY+++MG+P
Sbjct: 771 LPGVVSWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKP 819

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 1143 QGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPE------MHTHGKTVSHASDRSG 1196
            + NQ   TN     + S++ + VDASLGLAPLL+ +        +    KT+SH+S    
Sbjct: 1040 EQNQPRNTNDDVGMTNSNYGYFVDASLGLAPLLELANNDNNNFILDDESKTISHSSKTPE 1099

Query: 1197 IILDSSIP 1204
             IL    P
Sbjct: 1100 SILKDEDP 1107

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/1142 (39%), Positives = 634/1142 (55%), Gaps = 165/1142 (14%)

Query: 68   TPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 127
            +P  RP  +T  +   +   ++S  ++  R +QACDRCR KK +CD KRPQCS CA+VGF
Sbjct: 142  SPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGF 201

Query: 128  ECRISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFPTNKKKIG 187
            EC++SDKL+R +FPRGY                      D+KEQQ+  +   P + + + 
Sbjct: 202  ECKLSDKLTRNSFPRGYTESLEERIRELESENRRLLAMNDLKEQQLFKI---PEDIQSVV 258

Query: 188  GNDEQMLQELTGANNGRLRISSTNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRC 247
              D     EL  +N  +      N++                               H C
Sbjct: 259  DVDA----ELNSSNQTK------NMY-----------------------------ATHVC 279

Query: 248  DELDCNN-KLHSKPVSTN--LNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVA 304
            D + C + KLHS+PV+TN  LNDPT++SFEQNEAPGL A +A+  ++  EQSTQLA LV+
Sbjct: 280  DGICCQDTKLHSRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVS 339

Query: 305  LSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQLVKWDEL---- 360
            LS+PRSTEEILFIPQLLA+I Q+ GFTSKQCLY+VSLL+SLK++LP P L+K  ++    
Sbjct: 340  LSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLLKNSKMILQN 399

Query: 361  ----DYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDDGESLG-----LSIKEIDELVNL 411
                D L + NLW ++NL  FF   LK NIL     DD + L      L++ EIDELV L
Sbjct: 400  SSNFDILTSVNLWHLENLSNFFQNVLKLNIL----PDDDDHLKKNDDHLALSEIDELVAL 455

Query: 412  FFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFT 471
            +F  W+  IPI +++EF S Y   K D+     L + GPS+      I++ KIF C+L  
Sbjct: 456  YFKYWSDSIPIFNEKEFNSNYRVFKADLMK---LSKNGPSSL---ENILNIKIFGCLLTV 509

Query: 472  VCQMGLLTKVKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVXXXXXXXXXXXXXXXX 531
            +CQMG+L K K  K  S    + KL SYYH  + ++  N YFGV                
Sbjct: 510  ICQMGILIKYKNFKNKSPK--FEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILF 567

Query: 532  YFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYL 591
            Y +NTG++  IY+LRG ++SMAQQLRLHRCPSAVL GSGS M++ EQG+RR LFW IYYL
Sbjct: 568  YHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYL 627

Query: 592  DVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVL 651
            DVF +LQLGVPRLIKD EIECALP++        + G  ++LEG +S+FSL+++R AKVL
Sbjct: 628  DVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVL 685

Query: 652  GNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQN 711
            GNILD++FKR M+ES+++++  IHENALD+WR  LP +  F++  NG ++++  N     
Sbjct: 686  GNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNH---- 741

Query: 712  NATVENVEQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAI 771
                   E ++L++ +FL K MI++P+ +                 E  N+   ++++ +
Sbjct: 742  -------ENLILVLLFFLVKSMIYMPLSSAI--------------TELANNPKVKNDYYM 780

Query: 772  RSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFL 831
                S+  LQQ+ N +L+V +++ + YLPLP N +RT  RFAL+SA+GSLEY KGG LF 
Sbjct: 781  NHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFE 840

Query: 832  DNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLN 891
            DNK LLL V++ IE+DRKLE+PG+I WH LKLLD+ ++L L  P    +KL++ L+KK+N
Sbjct: 841  DNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKIN 900

Query: 892  YYSRVMGRPILKTSSLRQEANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEK 951
            YY+++MG+P++ +      +  KR+ S +D  + +   +    T L+ +  K +   V+ 
Sbjct: 901  YYNKIMGKPLITS---LPSSKTKRKQSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQ- 956

Query: 952  KIKLEDESSDTSNALVDKSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNI--LSV 1009
             +K E + + T                        STQ+A  EAL LDP+LN NI   S 
Sbjct: 957  LLKREGQGNTTE-----------------------STQSAFVEALQLDPILNANIYNFSG 993

Query: 1010 ADLAAFFGGNMPAAGGNQHSSYTNQNDFAPKHMRKEKEPAAFSDL-------AHKKSSVT 1062
             DL+ FF               +NQN   P   R+ +EPA    +       A   S VT
Sbjct: 994  TDLSNFF--------------ISNQNGDVP---RESREPAVQQPIPDRTSLPATNTSVVT 1036

Query: 1063 GVDGLFRVPSNADFLMDEYYPS---GTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNT 1119
            G D L + P N+    D   PS   G                      +D       +N 
Sbjct: 1037 GFDSLPK-PENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMMFLNNDYPFSSMNLNA 1095

Query: 1120 NFNVKGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSP 1179
             +   G  +S+             G Q    N+G  +S  DF   VDASLGLAPLL+ +P
Sbjct: 1096 LYAPDGYKESSAQP----------GKQFTL-NTGEPHSTYDFGMIVDASLGLAPLLNEAP 1144

Query: 1180 EM 1181
            E+
Sbjct: 1145 EI 1146

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1104 (39%), Positives = 610/1104 (55%), Gaps = 179/1104 (16%)

Query: 50   GSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKK 109
            G+ ++  +KRK  S+     S     +T+   V+   + +++ N + R++QACDRCRSKK
Sbjct: 61   GNSNMAVSKRKLDSI-----SNSSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKK 115

Query: 110  TRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIK 169
            TRCDGKRPQCSQCA VGFEC++SDKL R+++PRGY                      ++K
Sbjct: 116  TRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGYTETLEEKIRELQTENKRLLAIYNLK 175

Query: 170  EQQIHLVSHFPTN--KKKIGGNDEQMLQELT-----------GANNGRLR-ISSTNLFLL 215
            + Q+ + S   +    KK  GND  +    T           G+N   ++ I  + L  L
Sbjct: 176  QNQLSVSSSSSSTSPNKKGNGNDCAVQSNSTSTSAINDTNENGSNETAMKEIIQSQLIPL 235

Query: 216  NKARDGKQPATISNGDD--------HMTK---PD-------HEHTGKHRCDELDCNNKLH 257
                    P  I N DD        H  K   PD       H   GK   D  D  + LH
Sbjct: 236  TNINSVHDP--IQNNDDNTHTDCCNHTIKTINPDNNNNYSTHTTNGKLHRDTND--HHLH 291

Query: 258  SKPVSTNLNDPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFI 317
             KPVSTN N   +ISFEQNEAPGL  VKAL SM   E++TQLATLV+L++PRSTEEILFI
Sbjct: 292  PKPVSTNSNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEILFI 351

Query: 318  PQLLARIIQIHGFTSKQCLYSVSLLASLK------NNLPGPQLVKWDELDYLKTTNLWEV 371
            PQ+LA++ Q  GFTSK CLY+VSLL+SLK      NN           L+ LK TNLW+ 
Sbjct: 352  PQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAASADNKNLETLKNTNLWKF 411

Query: 372  DNLDKFFHETLKFNILRPGV--------------------SDDGESLGLSIKEIDELVNL 411
            + L +FF   LK + L   +                    + DG S  LS  EIDEL+ L
Sbjct: 412  NALFQFFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQDGIS-PLSSSEIDELLKL 470

Query: 412  FFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNKIISYKIFACILFT 471
            FF +W+  + +++++EF+ YY   K D+       Q    +    + +++YKIF  I+  
Sbjct: 471  FFQNWSDFVLMINEKEFYQYYSVFKSDL-------QNNNISKMSLSTLMNYKIFGLIILL 523

Query: 472  VCQMGLLTKVKGEKITSADSPYV------KLTSYYHRAISLIYLNPYFGVXXXXXXXXXX 525
             CQMGLL+K+K     +    +       K+ +YYH  I+ +  N +F +          
Sbjct: 524  FCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMWNEFFKISNVTLQSLKL 583

Query: 526  XXXXXXYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLF 585
                  Y ++ GN+S IYELR +V+SM+QQLRLHRCPSAVL GS   ++K EQ +RR+LF
Sbjct: 584  LSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGSTLKIHKLEQSNRRLLF 643

Query: 586  WGIYYLDVFSALQLGVPRLIKDFEIECALPV-------------------AENDDREVSL 626
            W IYYLD+F++LQLGVPRL+KD EIECALP+                   AENDD +   
Sbjct: 644  WNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNAENDDNK--- 700

Query: 627  AGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGL 686
                I+LEG VS  SL IIR+++++GNILD +FKR MTES++K +ALIH +ALD+WR  L
Sbjct: 701  ----IKLEGCVSHLSLVIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIHALDDWRNTL 756

Query: 687  PAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVS--YFLAKCMIHLPVVATRPL 744
            P+ L F++ VNG+I++  F + +  N   +  +Q  LLV   YF    MIH+PVVA+RPL
Sbjct: 757  PSNLKFDLNVNGSIDLSSFIDQQNLNEEEQRTQQQKLLVIFLYFFGVNMIHMPVVASRPL 816

Query: 745  PSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFN 804
            P        + E + +N          RSSSSY+ LQ ATNTMLNVL+ L   Y+PLP N
Sbjct: 817  P--------LVENDSLNQ------IPDRSSSSYIALQHATNTMLNVLDLLSPTYVPLPIN 862

Query: 805  VARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLL 864
            ++RT  RF+++SA G L++IKGG+LFL+NKALL  VVK+IE DR L++PGVISWH LKL 
Sbjct: 863  MSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLPGVISWHSLKLF 922

Query: 865  DMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQ--------------- 909
            D+T++L  Q  N K+EKLD+LL+KK NYY+R+MG+PI++  + +                
Sbjct: 923  DLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGKPIVRNPAEKNSTTVPASMSAVDETD 982

Query: 910  --EANGKRRNSSD------------------------DKLSRSGTEENFRATNLTPISSK 943
               A+ K+++  D                        D  +++  +++  A  LT I   
Sbjct: 983  LPRADKKKKDIVDTENEYVSSVPDTNNIVVKQTPEEWDTSTKTNVKDSTLAHKLTTIELP 1042

Query: 944  SDG---------SPVEKKIKLEDESSDTSNALVDKSYTDDLSSSANQPQVPASTQTAIAE 994
            S           SPV KK K  ++    +   V +S T   + ++N     A+ Q   A+
Sbjct: 1043 STDKKKRKQEQISPVNKKAKKAEQEVSQTQVGVPRSSTSSTAQNSNY----ANIQNQFAD 1098

Query: 995  ALHLDPVLNNNILSVA--DLAAFF 1016
            AL  DP+LN+N  + +  DL++ F
Sbjct: 1099 ALQFDPILNSNSFNFSNLDLSSLF 1122

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 24/144 (16%)

Query: 1160 DFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASDRSGIILDSSIPQSEDALSTLADRVNK 1219
            D+N+ VDASLGLAPLL+     ++  +T     + S      ++     +LS+ A+  N 
Sbjct: 1374 DYNYFVDASLGLAPLLETQRRHNSFPETSQPLVNTSN-----AMNLGNASLSSTANNNNT 1428

Query: 1220 TQSVPVPTLASH-GYKNLP-ATQSEQLAHGIDSNDDNGPAMLTLGSXXXXXXXXQMDYNS 1277
                 +P++A++ GY N P  + S+Q    + +N D G  +   G           D ++
Sbjct: 1429 -----MPSIANNVGYNNPPLLSSSKQKPRHLPTN-DTGDILNFNG-----------DLSN 1471

Query: 1278 TSNTSNRVPQEANLSNLFHWQNSK 1301
             +   +   +  NL +LF WQNS+
Sbjct: 1472 LNFRRDVRRKRENLEDLFSWQNSR 1495

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa] {ON}
            similar to uniprot|P39113 Saccharomyces cerevisiae
            YMR280c CAT8 transcription factor involved in
            gluconeogenesis
          Length = 1254

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1141 (37%), Positives = 603/1141 (52%), Gaps = 176/1141 (15%)

Query: 97   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYXXXXXXXXXXXX 156
            RVAQACDRCR KKT+CDGK PQCSQCA VGFEC+ISD+L+R++FPRGY            
Sbjct: 55   RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTETLEERVRELE 114

Query: 157  XXXXXXXXXCDIKEQQIHLVSHFPTNKKKIGGNDEQMLQELTGANNGR---LRISSTNLF 213
                     C+         S   +N +  G      L++ + +   R   +   S   F
Sbjct: 115  TENKRLMALCN---------SDLGSNTRSDG------LEKQSPSKRKRSPSMERDSERGF 159

Query: 214  LLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNNKLHSKPVSTNL--NDPTAI 271
              N     +Q  +     D    P+H      RC        +H KPV +N+  +  T +
Sbjct: 160  TENMELQLQQSCSSCGNSD----PNH------RC--------VHLKPVVSNIIVDSNTDV 201

Query: 272  SFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFT 331
            SFEQN APGLPAVKAL SMA RE+S QLA LV+L++PRSTEEILFIPQL+A I +  GF+
Sbjct: 202  SFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFS 261

Query: 332  SKQCLYSVSLLASLKNNLPGPQLVKWDELDYLKTTNLWEVDNLDKFFHETLKFNILRPGV 391
            SKQ LY+VSLL+SLK NLP P     DE     + N +  ++   FF+E LKF+IL    
Sbjct: 262  SKQSLYTVSLLSSLKKNLPTPNSNSSDEN---LSPNYYVSEDFRPFFYEVLKFDILGETE 318

Query: 392  SDDGESLG---------------LSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLK 436
            +++G +                 LS  EI  LV+++F+ W+  IPI  ++ F       K
Sbjct: 319  TENGSNRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFK 378

Query: 437  KDIST-QPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVK 495
             ++      LF+   +    + KI   KIFA +L  +CQM LL+++K  + T+ +    +
Sbjct: 379  TEVDKFGDRLFEVYKT---EQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKR 435

Query: 496  ---LTSYYHRAISLIYLNPYF-GVXXXXXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVS 551
               L ++Y++ I  I+L+ +F  +                YF+N G++  +Y+LRG V+S
Sbjct: 436  TQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVIS 495

Query: 552  MAQQLRLHRCPSAVL-GGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEI 610
            MAQQLRLHRCPSAVL   SGSTM K EQG+RR+LFW IYYLDVF +LQLGVPRLIKD EI
Sbjct: 496  MAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEI 555

Query: 611  ECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGM-TESVSK 669
            ECALPV+E +D +         LEGRVS FSLA+IR+AKVLGNILD++FKR M +E+ ++
Sbjct: 556  ECALPVSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATE 606

Query: 670  KLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVSYFL 729
             +A +HE ALD W+  LP +  F +E NG  N D+   +K  N+  + +E+  +L+ YFL
Sbjct: 607  SMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVK--NSEKDLIEKSSILLFYFL 664

Query: 730  AKCMIHLPVVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLN 789
            AKCMIHLPV+ATR              +     K  ++    R   SY+L+Q+A +TML 
Sbjct: 665  AKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQ 724

Query: 790  VLESLKSIYLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRK 849
            V+      YLP P N++RTKARFALL+A  ++EY+KGG+L+++ K LL +++  +E +RK
Sbjct: 725  VMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERK 784

Query: 850  LEIPGVISWHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQ 909
            L++PG+ISWH LKLLDM + LLLQ P TK+EKLD+L++KK+N+Y+R MG P +K S    
Sbjct: 785  LDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLS---- 840

Query: 910  EANGKRRNSSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESSD---TSNAL 966
              N ++ N                                 KKIKLE+ESS    TSN +
Sbjct: 841  --NSRKNN---------------------------------KKIKLENESSQLSSTSNPI 865

Query: 967  VDKSYTDDLSSSANQPQVPASTQTAIAEALHLDPVLNNNIL-------------SVADLA 1013
                   D         V  +  T  A+    +  +N N +             S  DL+
Sbjct: 866  AKGELKSDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLS 925

Query: 1014 AFFGGNMPAA---GGNQHSSYTNQNDF--APKHMRKEKEPAAFSDLAHKKSSVTGVDGLF 1068
            A F  N P +     N+++ Y  Q++           KEP        + S    ++ +F
Sbjct: 926  ALF--NAPESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVN----KERDSDKQELNAIF 979

Query: 1069 RVPSNAD-------FLMDEYYPSGTSXXXXXXXXXXXXXXXXXXGLSDGHGKDTGVNTNF 1121
                N          L++  + S +S                  G    HG  +G+N+  
Sbjct: 980  NETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPSHGATSGLNS-- 1037

Query: 1122 NVKGGHQSTNHSHLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEM 1181
              KG             N+ L  N L          G D +F +DASLGLAPLL  + E+
Sbjct: 1038 --KG-------------NEFLSMNTL---------YGGDNDFIIDASLGLAPLLSENNEI 1073

Query: 1182 H 1182
            H
Sbjct: 1074 H 1074

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/732 (47%), Positives = 463/732 (63%), Gaps = 62/732 (8%)

Query: 399  GLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEGPSNFARRNK 458
            GLS +E DE+++LFFD W   IPI DK EF +Y+ K K+++ST P  F  G + FA+R+K
Sbjct: 593  GLSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHK 651

Query: 459  IISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYYHRAISLIYLNPYFGVXXX 518
             ISYKIFAC+L TV QMGL+TKVK E +       + L +YY RA+S I  NPYFG    
Sbjct: 652  SISYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNI-LMTYYDRALSHIITNPYFGSNST 710

Query: 519  XXXXXXXXXXXXXYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQ 578
                         YF+N G++S IYELRG+VVS AQQLRLHRCPSAVLGG G T+++ +Q
Sbjct: 711  SIQSLQLLSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQ 770

Query: 579  GDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVS 638
            G+RRVLFWG+YYLDVF++LQLGVPRL+KD EIECALPV+ + DR+V+LAGQMI LEG++S
Sbjct: 771  GERRVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMS 830

Query: 639  QFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNG 698
             FSL++IRF+KVLGN+LD++FKRGMT S++K++AL+HENALDNWR GLP  L F+++VNG
Sbjct: 831  PFSLSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNG 890

Query: 699  TINMDKFNEMKQ----NNATVENVEQMVLLVSYFLAKCMIHLPVVATRPLPSSDDPNSDI 754
            TINMD+FN++K     N+ +  N E  + +  YFLAK MIH+PVVA +P           
Sbjct: 891  TINMDEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKP----------- 939

Query: 755  KEEEEVNDKNGE--SNFAIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVARTKARF 812
              +  V +KN    S  A RSSSSY+LLQQATNT LNVL S+++ YLPLP N++R K RF
Sbjct: 940  PVDTSVQEKNDPAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRF 999

Query: 813  ALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDMTISLLL 872
             L SARGSLEY KGGALF DNK+LLL+++K +E DRKL IPG ISWH LKL DM I+L+L
Sbjct: 1000 GLFSARGSLEYTKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLIL 1059

Query: 873  QPPNTKVEKLDRLLKKKLNYYSRV------MGRPILKTSSLRQEANGKRRNSSDDKLSRS 926
            QPPNTK EK ++LL+KK++YY+++      M   ++ +++++ +   +++     +  + 
Sbjct: 1060 QPPNTKPEKEEKLLQKKISYYNKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQL 1119

Query: 927  GTEEN-FRATNLTPI--SSKSDGSPVEKKIKLEDESSD--TSNALVDKSYTDD------- 974
              +EN        P   SS +    + K++K+E+ S    TSN  +   + DD       
Sbjct: 1120 HYKENKGNGAKRKPEIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKS 1179

Query: 975  LSSSANQPQVPA------------STQTAIAEALHLDPVLNNNILSVADLAAFFGG---- 1018
            L S+     VP             S   AIAEA  LDPVL+    S  DL +F  G    
Sbjct: 1180 LRSNTIVSDVPTGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVT 1239

Query: 1019 -------NMPAAG-GNQHSSYTNQNDFAPKHMRKEKEPAAFS-DLAHKKSSVTGVDGLFR 1069
                    M   G G   +  +  N     +         F        ++++  DGLF+
Sbjct: 1240 NASMFADTMHTTGIGGGLTDVSGHNGLPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFK 1299

Query: 1070 VPSNADFLMDEY 1081
            VPSN DFL D Y
Sbjct: 1300 VPSNGDFLKDYY 1311

 Score =  281 bits (720), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 164/401 (40%), Positives = 215/401 (53%), Gaps = 95/401 (23%)

Query: 78  EVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137
           + S     T ++S    + RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKLSR
Sbjct: 105 QASATPGSTPLSSMTPMSYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 164

Query: 138 RAFPRGYXXXXXXXXXXXXXXXXXXXXXCDIKEQQIHLVSHFPT---------------- 181
           RAFPRGY                     CD+KE+Q+ LVS +                  
Sbjct: 165 RAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYSAGSVGVGVGGPVTAGTT 224

Query: 182 ---------------------------------NKKKIGGND------EQMLQELTGANN 202
                                              KK  G+D      +++LQ+L+ ++ 
Sbjct: 225 VGNRSSVNGAVNESASSTVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDG 284

Query: 203 GRLRISSTNLFLLNKARDGKQ----PATISNGDDHMTKPD--------HEHTGKHRCDEL 250
           G LR+SSTNL+LLNK   G+Q    P + +  +    +PD              H  D  
Sbjct: 285 GTLRVSSTNLYLLNKKTSGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTASSHVADSD 344

Query: 251 DCN--NKLHSKPVS-----------------------TNLNDPTAISFEQNEAPGLPAVK 285
           +     K H +P +                        NLNDPT+ISFEQ++APGL AVK
Sbjct: 345 NPAEFQKEHLQPRTLPNIPVASTAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVK 404

Query: 286 ALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASL 345
           AL++MA  EQS+QLATLVA+S+PR+TEEILF+PQLLARI Q+HGFTSKQCLY+ S+LASL
Sbjct: 405 ALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASL 464

Query: 346 KNNLPGPQLVKWDELDYLKTTNLWEVDNLDKFFHETLKFNI 386
           K  +P        EL+ L++ +LWE+D++D F  + L+F+ 
Sbjct: 465 KEIVP---YQTSPELELLRSKSLWEIDDVDSFLSKGLRFSF 502

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 1156 NSGSDFNFAVDASLGLAPLLDWSPE 1180
            N    + F VDASLGLA LL WSP+
Sbjct: 1396 NQQQGYGFVVDASLGLASLLGWSPK 1420

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 46/61 (75%), Gaps = 3/61 (4%)

Query: 86  TSVNSAAN--SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRG 143
           TSVN  +N  SN R++QACDRCR KK +CDG +P CSQC  V F C+ SDKL+RR FPRG
Sbjct: 81  TSVNIDSNFLSN-RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRG 139

Query: 144 Y 144
           Y
Sbjct: 140 Y 140

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 40/54 (74%)

Query: 91  AANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           A N  +R +QACDRCR KK +CDG +P CSQC  V F CR SD+L+RR FPRGY
Sbjct: 27  AKNKKMRQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 84.7 bits (208), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (72%)

Query: 90  SAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           S+  S  RV+QACDRCR KK +CDG++P+CS C  + F C IS KLSRR  P+GY
Sbjct: 4   SSELSKFRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 85.1 bits (209), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R +QACDRCR KK +CDG RP C+ C  +G++CR SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 84.7 bits (208), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 40/50 (80%)

Query: 95  NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           N+R++QACDRCR KK +CDG +P C+ C+ + F C+ SD+L+RR FP+GY
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 39/55 (70%)

Query: 90  SAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           +A+    R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR FPRGY
Sbjct: 51  TASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           +S N+  + ++R A ACDRCR KK +CDG +P CS CA + F C+ SDKLSRR  P+GY
Sbjct: 30  SSSNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           N+  + ++R A ACDRCR KK RCDG +P CS C  + F C+ SDKLSRR  P+GY
Sbjct: 33  NATTDFSVRKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 82.4 bits (202), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           ++ N+  + ++R A ACDRCR KK +CDG +P CS C  + F C+ SDKLSRR  P+GY
Sbjct: 30  STANAVPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           ++ N+  + ++R A ACDRCR KK +CDG +P CS C+ + F C+ SDKLSRR  P+GY
Sbjct: 30  STSNAITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 37/52 (71%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           N  +R + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR FP+GY
Sbjct: 50  NERVRHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (70%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R  QACDRCR KK +CD  +P CSQC    F+C+ +DKL+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
            R  QACDRCR KK +CDG +P C+ CA + F C+ S KLSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R +QACDRCR KK +CDG  P C+ C  + F C+ + KLSRR  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 32/49 (65%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           ++  QACDRCR KK +CD + P C+ C   G  CR +++L RR F +GY
Sbjct: 39  IKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 43/82 (52%), Gaps = 2/82 (2%)

Query: 63  SLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQC 122
           SL+A   S++P+ N E  ++ S  S    +NS  +   AC RCRSKKT+CD K P C +C
Sbjct: 9   SLVAQKESKKPKGNIE--KLLSIESAAKRSNSIPKSRSACKRCRSKKTKCDQKLPSCGKC 66

Query: 123 AAVGFECRISDKLSRRAFPRGY 144
             +   C   D  +    PR Y
Sbjct: 67  TKLNTPCISVDPATGEDVPRSY 88

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 10/163 (6%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRC-PSAVLG-GSGSTMNKREQGDRRVLFWGIYYLDV 593
           +  +S  Y   G  +  A +  LHR  P+  +G G+ S  N  E   R+ LF+ IY LD+
Sbjct: 391 SARLSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDI 450

Query: 594 FSALQLGVPRLIKDFEIECALPVAENDDR----EVSLAGQ--MIRLEGRVSQFSLAIIRF 647
           +    LG+PR I   + + +LP   +D+     E+    Q  ++   G  +Q +  ++ F
Sbjct: 451 YVNAMLGLPRSISPNDFDQSLPFDLSDENITKDEIFFDRQNNVLSSAGIANQHTKLMMIF 510

Query: 648 AKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAEL 690
             ++  +     K+     +S       E  L++W   LP EL
Sbjct: 511 DSIITELYP--IKKTSKFFISHDSITNFELKLNHWLNNLPIEL 551

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + QACD CR KK +C  ++P+C++C    +ECR S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 94  SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           SN+   Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 2   SNIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + QACD CR KK +C  ++P+C++C    +ECR S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 10  QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           N   RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 5   NKRRRVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLA------GQMIRLE 634
           R+ LF+ IY +D++    LG+PR I   + +  LP+  NDD     A      G ++   
Sbjct: 461 RKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDAIYPEEQGDVLSSA 520

Query: 635 GRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELI 691
           G  +Q +  ++   +++ ++      +     +S ++    E  L  W   LP ELI
Sbjct: 521 GIANQHTKILMILDQIMADLYPI---KKTNNLISHQMVTNLELKLRQWLDQLPPELI 574

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 15  RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%)

Query: 90  SAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           S  ++N    QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 9   SRHHANSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query: 573 MNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMI- 631
           +N  E   ++ LF+ +Y +D++    LG+PR ++  + +  LP+ E  D  ++  G    
Sbjct: 364 INPIELEMKKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPI-ELSDENITAEGYFYE 422

Query: 632 RLEGRVSQFSLAIIRFAKVLGNILDTVFK-----RGMTESVSKKLALIHENALDNWRRGL 686
           R +G +S  S+AI      L  + DT+       +     +S +     E  L  W   L
Sbjct: 423 RQKGELS--SIAISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNL 480

Query: 687 PAEL 690
           P EL
Sbjct: 481 PVEL 484

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 5/119 (4%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLE-GRVSQ 639
           R+ LF+ IY LD++    LG+PR I   + +  LP+ E  D  ++  G +   + G +S 
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPI-ELSDENITEHGYLPENQNGVLSS 466

Query: 640 FSLA--IIRFAKVLGNILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELIFEIE 695
             +A    +   +L +I+  ++    T + +S +     E  L  W   LP EL+  +E
Sbjct: 467 TGIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTELVPNLE 525

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 74  RLNTEVSEVASYTSVNSAANSNLR--VAQACDRCRSKKTRCD--GKRPQCSQCAAVGFEC 129
           R  +E  E  +      AA+   R   ++ACD+CR KKTRCD   +RP CS C  +G  C
Sbjct: 5   RRESEPKEAETSPEAGGAASDRRRSKTSRACDQCREKKTRCDFSDERPICSACQRMGKTC 64

Query: 130 RISDKLSRRAFPRGY 144
                  +R   +GY
Sbjct: 65  TFERVPMKRGPTKGY 79

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137
           N   RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 11  NKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 54

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 70/160 (43%), Gaps = 10/160 (6%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +  LHR  S   G S   +  R++     LF+ IY LDV+ 
Sbjct: 345 SARLSTCYAYIGVAMRSALREGLHRSVSPDSGFSPIEIEMRKR-----LFYTIYKLDVYV 399

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIR-LEGRVSQFSLA--IIRFAKVLG 652
              LG+PR I   + +  LP+ E  D  ++  G      +G++S   +A    +   +L 
Sbjct: 400 NAMLGLPRSISSNDFDQTLPI-ELSDENITEEGYFPENQKGKLSSAEIANQHTKLIMILN 458

Query: 653 NILDTVFK-RGMTESVSKKLALIHENALDNWRRGLPAELI 691
            I+  ++  R     +  ++    E  L  W  GLP ELI
Sbjct: 459 VIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPRELI 498

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 94  SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR--ISDKLSRRAFP 141
           S LR++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 24  SRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 70/164 (42%), Gaps = 10/164 (6%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +  LHR       G  S  N  E   R+ LF+ IY LD++ 
Sbjct: 391 SARLSTCYSYIGVAMRSALREGLHR-----QVGPNSGFNPIEIEMRKRLFYTIYKLDIYV 445

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLE-GRVSQFSLA--IIRFAKVLG 652
              LG+PR I   + +  LP+ E  D  ++  G     + G +S   +A    +   +L 
Sbjct: 446 NAMLGLPRSISANDFDQTLPL-ELSDENITEQGYFPENQNGVLSSTGIANEHTKLLMILD 504

Query: 653 NILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELIFEIE 695
            I+  ++    T + +S +     E  L NW   LP EL   +E
Sbjct: 505 AIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNELAPNLE 548

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           N   RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 6   NKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 71/163 (43%), Gaps = 17/163 (10%)

Query: 536 TGNVSAIYELRGRVVSMAQQLR--LHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDV 593
           +  +S  Y   G  V+M   LR  +HR     L     + N  E   R+ LF+ IY +DV
Sbjct: 307 SARLSTCYTYIG--VAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDV 360

Query: 594 FSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAII-----RFA 648
           +    LG+PR +   + + ALP AE  D  ++  G     +G V   S A I     +  
Sbjct: 361 YVNTMLGLPRSVSQRDFDQALP-AELTDEFITKDGLHFEKQGNV--LSSAGIANQHTKLI 417

Query: 649 KVLGNILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAEL 690
            +L NI+  ++    T + +S  +    E  L  W   LP EL
Sbjct: 418 MILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCRSKK +CD K P C +CA +   C   D  + +  PR Y
Sbjct: 40  ACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 8/159 (5%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +   HR  S+  G S   +  R++     LF+ IY LDV+ 
Sbjct: 362 SARLSTCYTYIGVAMRSALRAGFHRKLSSSSGFSPIEIEMRKR-----LFYTIYKLDVYI 416

Query: 596 ALQLGVPRLIK--DFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGN 653
              LG+PR I   DF+    L +++ +  EV+   +        +  S    +   +L  
Sbjct: 417 NAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLPENQHSVLSSTGISNEHTKLFLILNE 476

Query: 654 ILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELI 691
           I+  ++    T + +S +     E  L NW   LP ELI
Sbjct: 477 IISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 515

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFP 141
           RV +ACD CR KK +CDG++P C  C    +EC       R   P
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNP 59

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 66/159 (41%), Gaps = 8/159 (5%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +   HR       G+ S  +  E   R+ LF+ IY LDV+ 
Sbjct: 360 SARLSTCYTYIGVAMRSALRAGFHR-----KLGTNSGFSPIEIEMRKRLFYTIYKLDVYI 414

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLA--IIRFAKVLGN 653
              LG+PR I   + +  LP+  +D+     A         +S   ++    +   +L  
Sbjct: 415 NAMLGLPRSISPDDFDQTLPLDLSDENITETAYLPENQNAVLSSTGISNEHTKLFLILNE 474

Query: 654 ILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELI 691
           I+  ++    T + +S +     E  L NW   LP ELI
Sbjct: 475 IISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 513

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 67/159 (42%), Gaps = 8/159 (5%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +   HR  S   G S   +  R++     LF+ IY LDV+ 
Sbjct: 359 SARLSTCYTYIGVAMRSALRAGFHRKLSPNSGFSPIEIEMRKR-----LFYTIYKLDVYI 413

Query: 596 ALQLGVPRLIK--DFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGN 653
              LG+PR I   DF+    L +++ +  EV+   +        +  S    +   +L  
Sbjct: 414 NAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLPENQHSVLSSTGISNEHTKLFLILNE 473

Query: 654 ILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELI 691
           I+  ++    T + +S +     E  L NW   LP ELI
Sbjct: 474 IISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKELI 512

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           N   RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 6   NKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 9/116 (7%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQF 640
           R+ LF+ IY +DV+    LG+PR +   + + ALP AE  D  ++  G     +G V   
Sbjct: 379 RKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALP-AELTDEYITEDGLHPEKQGDV--L 435

Query: 641 SLAII-----RFAKVLGNILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAEL 690
           S A I     +   +L NI+  ++    T + +S  +    E  L  W   LP EL
Sbjct: 436 SSAGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPEL 491

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 70/159 (44%), Gaps = 8/159 (5%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +   HR  SA    SG T  + E   R+ LF+ IY LDV+ 
Sbjct: 359 SARLSTCYTYIGVAMRSALRAGFHRKLSA---NSGFTPIEIEM--RKRLFYTIYKLDVYI 413

Query: 596 ALQLGVPRLI--KDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGN 653
              LG+PR I  +DF+    L +++ +  EV+   +        +  S    +   +L  
Sbjct: 414 NAMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSSTGISNEHTKLFLILNE 473

Query: 654 ILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELI 691
           I+  ++    T + +S +     E  L NW   LP EL+
Sbjct: 474 IISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKELM 512

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 27/152 (17%)

Query: 543 YELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVP 602
           Y + G  + +A  L +H+        S +  N R       +FW  +  D   A++ G P
Sbjct: 330 YVMVGNAIRIAFTLGIHK-------TSATPKNNR-------IFWLCFLYDRLLAIRFGFP 375

Query: 603 RLIKDFEIECALPVAENDDRE-VSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKR 661
            LI + EIE  +P   + D + +S++ +    E +VS         AK+  NI+  ++ +
Sbjct: 376 LLINEIEIE--IPSCSSFDTDFLSISLEKYHFEAQVS--------LAKITTNIIKRIYTK 425

Query: 662 GMTESVSKKLALIHENALDNWRRGLPAELIFE 693
             +  V    A++ E  L +W  GLP+EL F+
Sbjct: 426 NSSSFVHNCHAVLKE--LKDWFDGLPSELKFD 455

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           N N +  +AC+ C+ +K RC G  P C  C  +G
Sbjct: 9   NGNAKSKRACETCKRRKKRCSGGLP-CEYCVKIG 41

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 76/159 (47%), Gaps = 9/159 (5%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  ++  Y   G  +  A +   HR     +  + +T+N  E   R+ +F+ IY LDV+ 
Sbjct: 432 SARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEMRKRIFYTIYKLDVYV 487

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEG-RVSQFSLA--IIRFAKVLG 652
              +G+PR + + + +  LP+ E  D  ++  G +   EG ++S  S+A    +   +L 
Sbjct: 488 NSMMGLPRSLSEDDFDQELPI-EISDECITENGYLSEQEGQQLSSISIANYHTKLYLILA 546

Query: 653 NILDTVFK-RGMTESVSKKLALIHENALDNWRRGLPAEL 690
           +I+  ++  +    S+++   +  EN L  W   LP EL
Sbjct: 547 DIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHEL 585

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 10/64 (15%)

Query: 70  SQRPRLN----TEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAV 125
           SQ+  LN     ++S VAS T          RV +ACD CR KK +CDG+ P C  C   
Sbjct: 41  SQKFELNYMNSNKLSNVASVTQ-----KKRRRVTRACDECRKKKVKCDGQNP-CIHCTVY 94

Query: 126 GFEC 129
            ++C
Sbjct: 95  SYKC 98

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 49

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 77/164 (46%), Gaps = 17/164 (10%)

Query: 536 TGNVSAIYELRGRVVSMAQQLR--LHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDV 593
           +  +S  Y   G  V+M   LR  LHR  +  +G  G T  + E   R+ LF+ IY +D+
Sbjct: 293 SARLSTCYAYIG--VAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDI 346

Query: 594 FSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAII-----RFA 648
           +    LG+PR I   + + + P+ E DD  ++  G  I  E +  + S A I     +  
Sbjct: 347 YLNTMLGLPRAISQRDFDQSFPL-EIDDEYITEDG--IYPERQGDELSSAGIANQHTKLI 403

Query: 649 KVLGNILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAELI 691
            +L NI+  ++    T + +S ++    E  L  W   LP ELI
Sbjct: 404 MILDNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPELI 447

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQF 640
           R+ LF+ IY LDV+    LG+P  +   + +  LP+   D+   +L  Q I  +      
Sbjct: 404 RKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDLPDE---ALTEQGINYDQNPYSL 460

Query: 641 SLAII-----RFAKVLGNILDTVFK-RGMTESVSKKLALIHENALDNWRRGLPAELI 691
           S   I     +   +LG+IL  ++  + +   +S K     E  L  W   LP EL+
Sbjct: 461 SSTGIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPRELV 517

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 87  SVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           S N      LRV++ACD CR +K RCDG++P C  C    + C
Sbjct: 17  STNRLQPKRLRVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 71/165 (43%), Gaps = 25/165 (15%)

Query: 584 LFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSL- 642
           LFW IY +DV+    LG+PR I + +++  LP   +DDR   L G   +  G++S   + 
Sbjct: 396 LFWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRITDL-GIEPQPAGKISSCGMN 454

Query: 643 ----AIIRFAKVLGNILDTVFKRGMTESVSKKLAL--IH--ENALDNWRRGLPAELIFEI 694
                +I    V+ N +         ++    L L  +H  EN L NW   LP +L    
Sbjct: 455 NQHTKLI----VIMNHIHCKLSPLKNDAPPATLLLESVHELENELQNWTLQLPLQL---- 506

Query: 695 EVNGTINMDKFNEMKQNNATVENVEQMVLLVSYFLAKCMIHLPVV 739
                     +  + Q  A +      +LL+ +  AK M++ P +
Sbjct: 507 -------RPNYTFLDQAEADLYLKPNKLLLLDFLHAKIMLYRPFI 544

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 69/160 (43%), Gaps = 12/160 (7%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +   HR       G  S ++  E   R+ LF+ IY LDV+ 
Sbjct: 391 SARLSTCYAYIGVAMRSALREGFHR-----KVGPESDLSPLEIEIRKRLFYTIYKLDVYV 445

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNIL 655
              LG+PR I   + +  LP+  +D+     A    R +G +S   +A      ++  IL
Sbjct: 446 NAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLIM--IL 503

Query: 656 DTVFKRGM-----TESVSKKLALIHENALDNWRRGLPAEL 690
           DT+ ++          +S +     E  L +W   LPAEL
Sbjct: 504 DTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPAEL 543

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 50  GSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNL-RVAQACDRCRSK 108
           G+ D  + K  S +L  G  +  P L  E S  +     +   N    R++  C  CR  
Sbjct: 13  GNGDNNTTKPYSEALFLGFNNSTPGLEAEHSSTSPAPENSETHNRKRNRISFVCQACRKS 72

Query: 109 KTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           KT+CD ++P+CS+C   G +C + D +S++  PR
Sbjct: 73  KTKCDREKPECSRCIKHGLKC-VYD-VSKQPAPR 104

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 9/159 (5%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +  +S  Y   G  +  A +  LHR     +    S +N  +   R+ +F+ IY  D++ 
Sbjct: 483 SARLSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYL 538

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMI-RLEGRVSQFSLA--IIRFAKVLG 652
              LG+P+ +   + +  LPV E  D  ++  G    +  G VS  ++A    +   +L 
Sbjct: 539 NSMLGLPKSLSSADFDQVLPV-ELSDENITEEGYFPDKQNGEVSSAAIANYHTKLMLILA 597

Query: 653 NILDTVFKRGMTES-VSKKLALIHENALDNWRRGLPAEL 690
           +I   ++    + + VS +     E  L+NW + LP +L
Sbjct: 598 DITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQL 636

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 94  SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + LRV +AC  CR KK RCDGK P CS CA     C  ++     A PR +
Sbjct: 24  TRLRVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNT----ARPRSH 69

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 73/165 (44%), Gaps = 23/165 (13%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +G++ A Y   G  + +A +  LHR PS     +G T  + E   R  LFW IY +D++ 
Sbjct: 256 SGDLKACYYYIGIALRIAIRENLHRKPSL----TGPTAIEDETKKR--LFWSIYKVDIYM 309

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRV----------SQFSLAII 645
              LG+P  + +  I+  LP   +D++ VS  G +      +          ++  L ++
Sbjct: 310 NCTLGLPASLNESFIDQELPYDVDDEKIVS-DGVIFNENSNIISSCGMNNEHTKLILIML 368

Query: 646 RFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAEL 690
           +  + L +I   + K      +   + L  E+ L  W   LP +L
Sbjct: 369 KIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQL 407

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           + QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 48  RLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 50  GSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNL-RVAQACDRCRSK 108
           G++D  S K  S +   G  +  P L  E S  +     +   N    R+   C  CR  
Sbjct: 13  GNDDNSSTKPYSEAFFLGFNNPTPGLEAEHSSTSPAPENSETHNRKRNRILFVCQACRKS 72

Query: 109 KTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 73  KTKCDREKPECGRCVKHGLKC-VYD-VSKQPAPR 104

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           R   AC RCR +K +CD K P CS+C      C   D  + R  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           + QACD CR KK +C    P+C QC    + C  S K+ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFP 141
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 12/54 (22%)

Query: 88  VNSAANSNL--------RVAQACDRCRSKKTRCDG----KRPQCSQCAAVGFEC 129
           V SA  SN+        RVA+ACDRCR +K +CD     K  +CS C   G EC
Sbjct: 101 VGSAIKSNVSTTKVQKRRVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 552 MAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIE 611
           +AQ++ L R P++  G +  T+ +     RR+LFW I+ LD  ++L   +P LIK  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQ----SRRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 612 CALPV 616
            ALPV
Sbjct: 444 TALPV 448

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133
           ++V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 17  IKVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           LRV +AC+ C+ +K +CDG +P C+ C   G EC+      RR + R
Sbjct: 11  LRVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 68  TPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 127
           +PS  P++  ++   +S +S N       R++  C  CR  K +CD ++P+C++C   G 
Sbjct: 16  SPSYSPQITPDIPSSSSSSSSNIQLKKRNRISFVCQNCRKSKMKCDREKPECTRCLKQGI 75

Query: 128 ECRISDKLSRRAFPR 142
           +C   ++  R+  PR
Sbjct: 76  KCVYDEE--RQPRPR 88

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 48  DNGSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNL-RVAQACDRCR 106
           DNG+ D   +K  S +   G     P L  E S  +     +   N    R++  C  CR
Sbjct: 11  DNGNGDDDISKPYSGAFSLGFNKSTPGLEGEHSSTSPAPENSEMQNRKRNRISFVCQACR 70

Query: 107 SKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
             KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 71  KSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           R++  C  CR  KTRCD ++P C++C  +  EC + D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 93  NSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           +S  RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 7   HSRRRVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 6   RACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSR 137
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R 
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRG 44

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 49  NGSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNL-RVAQACDRCRS 107
           NG+ +  ++K  S     G  +  P L  E S  +     +   N    R++  C  CR 
Sbjct: 12  NGNGEDSTSKPYSEPFFLGFNNATPGLEAEHSSTSPAPENSETHNRKRNRISFVCQACRK 71

Query: 108 KKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
            KT+CD ++P+C +C   G +C + D +S++  PR
Sbjct: 72  SKTKCDREKPECGRCIKHGLKC-VYD-VSKQPAPR 104

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 78  EVSEVASYTSVN----SAANSNLRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 129
           +VS +  +TS N    S+ N   RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 105 DVSVMMEHTSSNDLIASSKNLKKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSAC 163

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 75  LNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           +N +V  ++   S        LRV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 1   MNPKVLVLSMDNSTKKLRPKRLRVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 9/126 (7%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           +GN+   Y   G  +  A    LHR  S+++G +       E   ++ LFW +Y +D++ 
Sbjct: 202 SGNLKRCYSYMGIALRAAIAEGLHR-KSSLMGPTPI-----EDESKKRLFWTVYKVDIYM 255

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSL--AIIRFAKVLGN 653
              +G+P+ I    +   LP  + DD  ++  G + +  G++S   +     +   +L  
Sbjct: 256 NCIMGLPQSISQKTVNMELP-KDLDDENITNQGCIDQPWGKLSSTGMNNEHTKLMLILSR 314

Query: 654 ILDTVF 659
           I DT++
Sbjct: 315 IHDTLY 320

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 14/78 (17%)

Query: 56  SAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGK 115
           SA  KS S L   P Q+       +++  Y +  SA     RV++ACD CR +K +CD K
Sbjct: 217 SASSKSVSPLESIPLQK-------NDLKPYDNPRSAKK---RVSRACDHCRKRKIKCDEK 266

Query: 116 RP----QCSQCAAVGFEC 129
           R     +CS C     EC
Sbjct: 267 RDPNTNKCSNCIKYNSEC 284

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 97  RVAQACDRCRSKKTRCDGKR--PQCSQCAAVGFECRISDKLSRRAFPRGY 144
           +V++ACD+CR KK +CD     P CS C  VG  C       +R   +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGY 80

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 11/122 (9%)

Query: 577 EQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAG-------Q 629
           EQ  R+ LF+ +Y ++VF    LG+P  +   + + +LP+ E  D+ +S +G        
Sbjct: 358 EQEMRKRLFYTLYKMEVFVNTMLGLPSSLSKDDYDQSLPL-EISDKYISDSGIHAEQQRD 416

Query: 630 MIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAE 689
           ++   G  +Q +  I+   ++    L  V + G  + +S K+    E  L +W   LPAE
Sbjct: 417 ILSSSGVANQHTKLIMIMEEIAAQ-LYPVKRTG--KFISHKVISALELKLRSWLDQLPAE 473

Query: 690 LI 691
           L+
Sbjct: 474 LV 475

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           NS ++   R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 15  NSHSSKRNRISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 128
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133
           RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 17  RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 10/117 (8%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLI--KDFEIECALPVAENDDREVSL----AGQMIRLE 634
           R+ +F+ IY +DV     LG+PR I  +DF+ E  L ++++   E  +       ++   
Sbjct: 366 RKRVFYTIYRMDVMLNTMLGLPRSISKEDFDQELPLTISDSCITEEGILRNKGSDILGST 425

Query: 635 GRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELI 691
           G  +Q +    +   ++  I +T++   +   VS  +    E  L  W   LP EL+
Sbjct: 426 GVTNQHT----KLVMIMDEIANTLYSPRLDNVVSHSVISDLELKLRAWLDQLPPELV 478

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 70/161 (43%), Gaps = 21/161 (13%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           + N+ A Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++ 
Sbjct: 302 SANLKACYSFIGIALRAALKEGLHRRSSIV----GPTPIQDETKKR--LFWSVYKLDLYM 355

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIR---------LEGRVSQFSLAIIR 646
              LG P  I + +I+   P+ + DD  +S  G   +         +  + ++  L + R
Sbjct: 356 NCILGFPSGIDESDIDQEFPL-DVDDENISTIGIKFQDWRTISSCGMNNKHTKLILIMSR 414

Query: 647 FAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLP 687
             K++ ++     +R   E  S+   +   + LDNW   LP
Sbjct: 415 IYKLMYSL-----RRKPLEEDSRTQIVSLNDQLDNWYAQLP 450

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 130
           R  +AC  CR +K RC G  P C  C    +EC+
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRIS 132
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           NS      RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 7   NSQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 90  SAANSNLRVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 129
           S  NS  RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 124 SGKNSKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           LRV +AC+ C+ +K +CDG RP C  C+    ECR   K + R
Sbjct: 40  LRVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNR 81

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 91/206 (44%), Gaps = 20/206 (9%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           + N+   Y   G  +  A    LHR  S +    G T  + E   R  LFW +Y +D++ 
Sbjct: 306 SANLKTCYSYIGIALRAAISEGLHRKNSLI----GPTPIEDETKKR--LFWSVYKVDLYM 359

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSL--AIIRFAKVLGN 653
              LG+PR + +  I   LP  + DD +++  G + +  G++S   +     +   V+  
Sbjct: 360 NCILGLPRTLSESAINQELP-RDVDDEKITTKGILAQDWGKISSCGMNNQHTKLMLVMAR 418

Query: 654 ILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNA 713
           I ++++     +  +    +  ++ L+ W   LP +L  + +         FNE ++N  
Sbjct: 419 IHESLYPVLKWDQATYVNIINLQDKLNEWFIELPMQLKPDYQF--------FNEEERNYY 470

Query: 714 TVENVEQMVLLVSYFLAKCMIHLPVV 739
              N    +L + Y LAK +++ P +
Sbjct: 471 LKPN---KLLYLDYLLAKIILYKPFI 493

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLS 136
           N  + + LRV +AC+ C+ +K +CDG +P C  C+    ECR   K++
Sbjct: 19  NENSKTRLRVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKVT 65

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           +V +ACD CR +K +C+G +P C  C   G EC  +D  S +
Sbjct: 26  KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 26/60 (43%)

Query: 67  GTPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           G  S  P L +   +  S  + N       RV  +C  CR +K +CD  RP C QC   G
Sbjct: 31  GNSSNSPNLASNSKKHDSTNTSNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 543 YELRGRVVSMAQQLRLHR-CPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGV 601
           + L G    MA  L LHR  P++ +          +Q  RRVL+W IY      +L+ G 
Sbjct: 490 WSLIGLCSHMATSLGLHRDLPNSTI---------HDQQLRRVLWWTIYCTGCDLSLETGR 540

Query: 602 PRLIKDFE-IECALPVAENDDREVSLAGQMIRLEGRVSQF 640
           P L+ + + I+  LP +    +E S+   +I+ E + SQ 
Sbjct: 541 PSLLPNLQAIDIPLPASSATIKEPSIYSSIIQ-ESQWSQI 579

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133
           RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           R++  C  CR  KT+CD ++P+CS+CA    +C + D   +RA PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRA-PR 70

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--RISDKLSRR 138
           RVA+ACD CR +K +CD   PQ   CS C      C  R+ D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           R++  C  CR  KT+CD ++P CS+C   G  C + D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           R++  C  CR  KT+CD ++P+C +C   G  C + D + ++A PR
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPR 98

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           R++  C  CR +K +CD +RP C QCA  G  C + D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 14/85 (16%)

Query: 534 VNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGD---RRVLFWGIYY 590
           V   N+S++ +L      +AQ+L+L   P  V G        RE  D   RR++FW I+ 
Sbjct: 265 VENPNISSVAQL----ARLAQRLQLTADPEYVPGS-------REMADVQFRRIIFWQIFQ 313

Query: 591 LDVFSALQLGVPRLIKDFEIECALP 615
           LD  ++LQ  +P L++  E E +LP
Sbjct: 314 LDTLTSLQNRLPPLLRYNECETSLP 338

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 97  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 129
           R A+AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECRISDKLSRRAFP 141
           +V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
            C  CRS+K +CD  RP C +C   GFEC
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           +V++ACD CR +K +C+GK P C+ C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 76  NTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDG--KRPQCSQCAAVGFECRISD 133
           NTE +  AS +S N       + ++ACD+CR KK +CD    R  C+ C   G +C    
Sbjct: 40  NTEEANNASRSSSNKRRT---KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFER 96

Query: 134 KLSRRAFPRGY 144
              +R   +GY
Sbjct: 97  VPLKRGPSKGY 107

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECRISDK 134
           RV ++C  CR +K++CD  +P CS C   G  ECR  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 129
           N    +  +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 6   NKVVKTRRKVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK--LSRRAFP 141
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {ON}
           conserved hypothetical protein
          Length = 873

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 63/152 (41%), Gaps = 25/152 (16%)

Query: 550 VSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFE 609
           V++AQ   LHR           T+   E+  R++++W +Y +D   ++ +G P+ I    
Sbjct: 332 VTIAQTYGLHRS-----ADFHPTLTANEKRARKLIWWILYVIDTLVSISIGRPQAIN--L 384

Query: 610 IECALPVAENDDREVSLAGQMIRLEGRVSQFSLAI---------IRFAKVLGNILDTVFK 660
            +C +PV  +DD            EG   + S+ +         ++ A+++  I   + +
Sbjct: 385 DDCDVPVLTHDD---------FVFEGEAPEHSMPVDHMDCIISTVQIAEIMSRISRELNR 435

Query: 661 RGMTESVSKKLALIHENALDNWRRGLPAELIF 692
                  +K L    +  L  WR  LP  L +
Sbjct: 436 PAAAHCDAKFLIQHFDLLLQRWRNNLPESLTY 467

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGK-RPQCSQCAAVGFECRISD 133
           R ++AC+ C  +K RCD   R  C+ C   G  CR+ D
Sbjct: 14  RTSRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 40  RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 97  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 84  SYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           S  S  SA +   + A +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 25  STDSTESATSPGDKEAYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 69  RISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20  RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 91  AANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRIS 132
              S+ +V++ACD CR +K +C GK+P CS C A    C  S
Sbjct: 17  VTKSSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 70/158 (44%), Gaps = 15/158 (9%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           + N+ A Y   G  +  A +  LHR  S     +G T  + E   R  LFW +Y LD++ 
Sbjct: 323 SANLKACYSFIGIALRAALKEGLHRKSSI----TGPTAIQDETKKR--LFWSVYKLDLYM 376

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAG------QMIRLEGRVSQFSLAIIRFAK 649
              LG P  I + +I+   P+ + DD  +S  G      +MI   G  ++ +  I+  ++
Sbjct: 377 NCILGFPSGIDESDIDQEFPL-DVDDENISTMGIKFQDWRMISSCGMNNEHTKLILIMSR 435

Query: 650 VLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLP 687
           +    L    +R   E  S+   +   + L+NW   LP
Sbjct: 436 IYK--LMYSLRRKPLEEDSRLQIVSLNDQLENWYAQLP 471

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 70/161 (43%), Gaps = 21/161 (13%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           + N+ A Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++ 
Sbjct: 290 SANLKACYSFIGIALRAALKEGLHRKSSIV----GPTPIQDETKKR--LFWSVYKLDLYM 343

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIR---------LEGRVSQFSLAIIR 646
              LG P  I + +I+   P+ + DD  +S  G   +         +  + ++  L + R
Sbjct: 344 NCILGFPSGIDESDIDQEFPL-DVDDENISTMGIKFQDWRTISSCGMNNKHTKLILIMSR 402

Query: 647 FAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLP 687
             K++ ++     +R   E  S+   +   + L+NW   LP
Sbjct: 403 IYKLMYSL-----RRKPLEEDSRSQIVSLNDQLENWYTQLP 438

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 130
           R  +AC  CR +K RC G+ P C  C    FEC+
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 41.2 bits (95), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 90  SAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           SA N  L V QACD CR ++ +CDGK P C +C      C     L +R 
Sbjct: 30  SAFNMTL-VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKRG 77

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           RV +AC  CR +K +C+GK P C  C A G+ C   D     A P+
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 24  KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 76  NTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 129
           +TE     S + ++ +     RV++ACD CR +K +CD  +P   +CS C     EC
Sbjct: 113 HTESPAFTSISPLDVSGAPKKRVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

 Score = 39.3 bits (90), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 66/176 (37%), Gaps = 31/176 (17%)

Query: 543 YELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVP 602
           Y +    V  AQ + LH         +   ++ +E   RR+L+W  Y  D F +L+L  P
Sbjct: 518 YSIFATAVRFAQDMSLHNL------DTYKRLSYKECLKRRILWWHCYTTDKFLSLKLCKP 571

Query: 603 RLIKDFEIEC-------------ALPVAEND----DREVSLAGQMIRLEGRVSQFSLAII 645
            LI + ++                LP    D    D+  ++   + +LE   S   + I 
Sbjct: 572 SLINERDMTVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCSFLPVFIS 631

Query: 646 RFAKVLGNILDTVFK--------RGMTESVSKKLALIHENALDNWRRGLPAELIFE 693
            +   L  I   ++         +G T        L  +N+L +W + LP  +  E
Sbjct: 632 YYTTKLARISSKIYYSFFTPTSLKGQTFDTMIDRVLEIKNSLSDWEKYLPGSIRLE 687

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 810
           aa] {ON} ANNOTATED BY YGOB - Artificial frameshift
           joining KLLA0C03223g and KLLA0C03234g
          Length = 810

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 6/68 (8%)

Query: 68  TPSQRPRLNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 127
           TP   P   T V+   S  +++S        AQ CDRCR  K +C G  P C  C     
Sbjct: 24  TPKFSPVAMTNVNSTESLDNLHSCR------AQVCDRCRKLKKKCYGTGPSCVNCVVTNN 77

Query: 128 ECRISDKL 135
            C ++  L
Sbjct: 78  PCTVTTTL 85

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R    C  CRS+K +CD ++PQC +C     +C
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKC 43

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 87  SVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRG 143
           ++N       R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 10  AMNRVGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 30/68 (44%)

Query: 75  LNTEVSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           ++T  SE  + +     AN   R  Q CDRCR  K +C G   QC+ C      C     
Sbjct: 16  VSTNSSEQPAQSGPPDPANWESRRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMAT 75

Query: 135 LSRRAFPR 142
           L RR  P+
Sbjct: 76  LKRRRKPK 83

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 65/152 (42%), Gaps = 25/152 (16%)

Query: 550 VSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFE 609
           V++AQ   LHR           T+   E+  R++++W +Y +D   ++ +G P+ I    
Sbjct: 314 VTVAQTYGLHRS-----ADFHPTLTANEKRTRKLIWWILYVIDTLVSISIGRPQAIN--L 366

Query: 610 IECALPVAENDDREVSLAGQMIRLEGRVSQFSLAI---------IRFAKVLGNILDTVFK 660
            +C +PV  +DD            EG     ++A+         ++  +++  I   + +
Sbjct: 367 DDCDVPVLTHDD---------FIFEGGAPDHAVAVDYMDCIISTVQIVEIMSRISRELNR 417

Query: 661 RGMTESVSKKLALIHENALDNWRRGLPAELIF 692
              ++  +K L    +  L  WR+ LP  L +
Sbjct: 418 PAASQCDAKVLIQHFDMLLQRWRKNLPESLTY 449

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGK-RPQCSQCAAVGFECRISD 133
           R  +AC+ C  +K RCD   R  C+ C   G  CR+ D
Sbjct: 14  RTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           ACD CR ++ +CDGK+P C +C    FEC     L +R
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKR 43

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 73/164 (44%), Gaps = 21/164 (12%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           + N+ A Y   G  +  A +  LHR  S+++G +       E   ++ LFW +Y LD++ 
Sbjct: 314 SANLKACYSFIGIALRAALKDGLHR-KSSIVGPTPI-----EDETKKRLFWSVYKLDLYM 367

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIR---------LEGRVSQFSLAIIR 646
              LG P  I + +I+   P+ + DD  +S  G   +         +  + ++  L + R
Sbjct: 368 NCILGFPSGIDESDIDQEFPL-DVDDENISTTGIKFQDWRTISSCGMNNKHTKLILIMSR 426

Query: 647 FAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAEL 690
             K++ ++     +R   E  S+   +   + LD+W   LP  L
Sbjct: 427 IYKLMYSL-----RRKPLEEDSRLQIVSLNDQLDDWYTQLPDTL 465

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 130
           R  +AC  CR +K RC G+ P C  C    FEC+
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}
           HAL9Putative transcription factor containing a zinc
           finger; overexpression increases salt tolerance through
           increased expression of the ENA1 (Na+/Li+ extrusion
           pump) gene while gene disruption decreases both salt
           tolerance and ENA1 expression
          Length = 1030

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 76  NTEVSEVASYTSVN----SAANSNLRVAQACDRCRSKKTRC---DGKRPQCSQCAAVGFE 128
           N ++S +  +T+ N    S  N   RV++ACD CR +K RC   D +  +CS C      
Sbjct: 106 NRDISTMMEHTNSNDMSGSGKNLKKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLP 165

Query: 129 C 129
           C
Sbjct: 166 C 166

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRG 143
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 99  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFP 141
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 89  NSAANSNL----RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRIS 132
           N+A N  +    RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 58  NNAGNKRVMKRNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66  RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6.154
           YBR240C
          Length = 397

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 91  AANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL 135
             N+N R    C  CR KK +C+ +RPQC+ C   G  C    KL
Sbjct: 3   VKNTNTRKFTGCWACRFKKKKCNEQRPQCTLCIQHGNHCSYDVKL 47

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 84  SYTSVNSAANSN-----LRVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECRISDKLS 136
           S    N+A+NS+      + ++ACD+CR KK +CD   ++  CS C   G +C       
Sbjct: 52  SAAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPL 111

Query: 137 RRAFPRGY 144
           +R   +GY
Sbjct: 112 KRGPSKGY 119

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECRISD 133
           ++ N       +V ++C  CR +K +CD KRP C+ C   G  EC  +D
Sbjct: 74  STSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRIS 132
           N       +V++ACD CR KK +C G  P C  C   G EC  S
Sbjct: 42  NGTGKPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256w HAP1 transcription factor
          Length = 1355

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 18  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {ON}
           YOR363C (REAL)
          Length = 1002

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 87  SVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRG 143
           ++NS      R++  C  CR  KT+CD ++P+C +C      C I D ++R+  PR 
Sbjct: 10  TMNSIGKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQKAPRN 64

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 90  SAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           S     LRV +ACD C+ +K +CDG  P CS C     +C
Sbjct: 4   STTKQRLRVQKACDICKRRKVKCDGLSP-CSNCIRHNVDC 42

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           LRV +AC+ C+ +K +CDG  P C  C+    ECR   K + R
Sbjct: 81  LRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNR 122

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 33  RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 92  ANSNLRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECRI 131
           A +N R   +C  CR +K RC+   K+PQ C++CA +  +C I
Sbjct: 21  AATNHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 22  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
           Anc_8.879 YML099C
          Length = 852

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           TS   A N   +  + C  CR +K +CD K+P+C +C +    C
Sbjct: 7   TSSRDADNKRAKTFEGCWTCRLRKIKCDLKKPKCDKCRSSAISC 50

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 6/66 (9%)

Query: 67  GTPSQRPRLNTEVSEVASYTSVNSAANSNL------RVAQACDRCRSKKTRCDGKRPQCS 120
           GT S     NT +S   S +  N+   S        RV  +C  CR +K +CD  RP C 
Sbjct: 2   GTVSPVSFSNTPLSATDSSSHANANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQ 61

Query: 121 QCAAVG 126
           QC   G
Sbjct: 62  QCTKTG 67

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
            CD C+ ++ +CD  +P C +CA +  EC  +    RR
Sbjct: 33  GCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRR 70

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
           (PIP2) - activator of peroxisome proliferation [contig
           46] FULL
          Length = 838

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 94  SNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRI---SDKLSRRAFP 141
           S +R +  C  C+ +K +CD  RP C +C+ +  EC      +K  RR  P
Sbjct: 22  SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72

>TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.416
           YDR207C
          Length = 702

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 55  RSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVNSA-ANSNLRVAQACDRCRSKKTRCD 113
           +S K +SPSL   + S    L+ +     SY++  S  A S  R    C  CR +K +C 
Sbjct: 578 QSRKVRSPSLDETSTSSDDVLSVKSKHEGSYSNAESKKALSGTRSRNGCWICRLRKKKCS 637

Query: 114 GKRPQCSQCAAVGFEC 129
            ++P CS C  +  EC
Sbjct: 638 EEKPSCSNCHRLNLEC 653

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
           to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 14  RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  KT+CD ++P C++C      C
Sbjct: 41  RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 97  RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + ++ACD+CR KK +CD K  R  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSFERVPLKRGPSKGY 91

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKL 135
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 97  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 129
           R  +ACD CR +K RCD   P   +CS C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
           +C RCR  K +C  + P+CS C A  + C    +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1192

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 9/57 (15%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRIS--------DKLSR 137
           N+A     +V++AC  CR +K +C+G  P CS C     EC  S        DKL R
Sbjct: 15  NTAKKQRNKVSKACQSCRRRKIKCNGINP-CSNCTTYECECIYSIPDSNSQTDKLGR 70

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
           YER184C (REAL)
          Length = 170

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           RV++AC+RCR KK +CD K+P C  C     +CR  ++
Sbjct: 13  RVSKACERCRRKKVKCDSKKP-CFGCIGSQSKCRYKNQ 49

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRA 139
            CD C+ ++ +CD  +P C +C  +  EC  S    R+A
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 129
           + C  CR +K RCD  RP CS C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>Smik_15.342 Chr15 complement(595611..595820,595851..598070) [2430
           bp, 810 aa] {ON} YOR162C (REAL)
          Length = 810

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECRISDKLSR 137
           ++ NS    N ++ ++C  CR +K RCD ++P CS C +     CR +++ ++
Sbjct: 39  STFNSGKKRN-KLIKSCSFCRRRKLRCDQQKPMCSTCVSRNLMTCRYAEEFNK 90

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRR 138
           +V +ACD CR +K +C GK P C+ C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 10/158 (6%)

Query: 536 TGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFS 595
           + N+S+ Y   G  +  A +   HR        S   +N  EQ   + LFW IY  D++ 
Sbjct: 274 SANLSSGYTYIGIALRTAIKQNFHR------KTSLQNLNLLEQETIKKLFWTIYKTDIYM 327

Query: 596 ALQLGVPRLIKDFEIECALPVAENDDREVSLAGQMIRLEGRVSQFSL--AIIRFAKVLGN 653
              LG+P  + +  I+   P   +DDR +     +++  G++S   +     +   ++ N
Sbjct: 328 NCILGLPNSLDESLIDQEFPSDIDDDRILE-NRLLVQPSGKLSSVGMNNEHTKLILIMNN 386

Query: 654 ILDTVFKRGMT-ESVSKKLALIHENALDNWRRGLPAEL 690
               ++   +T  S+S       E  L NW   LP +L
Sbjct: 387 AHKILYPMSLTVTSISHSEISKLEGELSNWLERLPFQL 424

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 79  VSEVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           VS +A+  S N       +V  AC  C+ +K RCDG+ P C+ C     +C
Sbjct: 13  VSVLATEPSTNQLEPVRHKVKHACSSCKERKVRCDGQSP-CASCINARVKC 62

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1244

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 bp,
           1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
           similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 547 GRVVSMAQQLRLHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIK 606
            ++  +AQ+++L   P +  G +   + +     RR+LFW I+YLD  ++L   +P LIK
Sbjct: 321 AQLFRLAQKIQLTLDPVSYHGMTDQALIR----SRRILFWQIFYLDTITSLHNNLPPLIK 376

Query: 607 DFEIECAL 614
             E +  L
Sbjct: 377 PGEFDTVL 384

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 102 CDRCRSKKTRCDGKRPQCSQCAAVGFECR--ISDKLSR 137
           C  C  +K +C  +RP C  C    FEC   ++D++SR
Sbjct: 38  CMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVSR 75

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 96  LRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           LRV +AC+ C+ +K +CDG +P C  C     ECR   K
Sbjct: 51  LRVQKACELCKKRKVKCDGNKP-CLNCFKHQKECRYEFK 88

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 100 QACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           QACD CR ++ +CDGKRP CS C     +C
Sbjct: 11  QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1.380
           YLR256W
          Length = 1429

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 128
           R+  +C  CR +K +CD   P C+QC   G +
Sbjct: 40  RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 78  EVSEVASYTSVNSAANSNLR-----VAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECRI 131
           E S+++  +  +SA N   R       ++C  CR +K +CD  +P CS C A  F EC  
Sbjct: 6   ESSKISKNSPESSAVNKPPRKKRRSTIKSCSFCRRRKLKCDKSKPLCSTCRARNFTECIY 65

Query: 132 SDKL 135
           SD +
Sbjct: 66  SDAI 69

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
           finger transcription factor involved in the complex
           regulation of gene expression in response to levels of
           heme and oxygen; the S288C sequence differs from other
           strain backgrounds due to a Ty1 insertion in the carboxy
           terminus
          Length = 1502

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           R+  +C  CR +K +CD  RP C QC   G
Sbjct: 59  RIPLSCTICRKRKVKCDKLRPHCQQCTKTG 88

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 581 RRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALP 615
           RR L+W  YY +   A +LG P  I D +I C LP
Sbjct: 519 RRSLWWKAYYFEKTLASKLGYPSNIDDSKINCLLP 553

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1237

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
           YML099C
          Length = 835

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
            C  CRS+K +CD +RP C +C   G +C
Sbjct: 27  GCWTCRSRKVKCDLQRPNCGRCEKSGLDC 55

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 86  TSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISD 133
           T  +   N  LRV +AC  CR +K +CD   P C  C + G+ C+  D
Sbjct: 4   TGADVPRNKRLRVRKACLPCRQRKRKCDSGFP-CGMCTSYGYNCQYDD 50

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 97  RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + ++ACD+CR KK +CD K  R  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGY 91

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 10  RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           R++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 35  RLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 97  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECRISDKLSRRAFPRGY 144
           + ++ACD+CR KK +CD    R  C+ C  +G  C       +R   +GY
Sbjct: 50  KASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 126
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 14  RVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 89  NSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
           N  A    +++  C  CR  KT+CD K+P C++C  +   C I D L  +  PR
Sbjct: 8   NLKAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYD-LEYQPLPR 59

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {ON}
           
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           +V +AC  CR +K +C G  P CS CAA   EC
Sbjct: 12  KVVKACLNCRRRKIKCTGTFP-CSNCAAYQCEC 43

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON} 
          Length = 881

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 80  SEVASYT-SVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECR 130
           +E  +YT ++   +  + R    C  C+S+K RC+  RP CS+C  +G  C 
Sbjct: 12  TENCTYTFAMAGKSQKSKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHCH 63

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRI--SDKLSRRA 139
           AC  CR K+ +CD +RP CS C   G EC    +DK ++R 
Sbjct: 16  ACQNCRIKRRKCDMERP-CSNCLKYGIECITVNNDKRTKRT 55

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 98  VAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECRISD 133
           + + C  CR KK +CD +RP CS C A  F EC   D
Sbjct: 78  IIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 19  KLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 97  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 129
           RV++ACDRCR +K +CD   P   +CS C      C
Sbjct: 29  RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 81  EVASYTSVNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
           +V +   V   A +  +  QAC  CR +K +C+G RP CS C   G EC
Sbjct: 30  QVMATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRP-CSSCKTNGLEC 77

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
           Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 88  VNSAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRIS 132
           V     S L++ +ACD CR +K +C G +P C+ C A    C  S
Sbjct: 2   VGKVKKSQLKIKRACDNCRRRKIKCTGTQP-CACCVAYQCGCVYS 45

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134
           +V++ACD CR +K +C GK+P C+ C A    C  S +
Sbjct: 43  KVSKACDNCRKRKIKCTGKQP-CATCEAYQCPCIYSTQ 79

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 21/42 (50%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPR 142
            CD C+ ++ +CD  +P C +C  +   C  +    RR+  R
Sbjct: 63  GCDNCKRRRVKCDESKPHCQKCVNMQLHCVYTPPQPRRSKGR 104

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
           Anc_8.879 YML099C
          Length = 953

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 101 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 129
            C  CRS+K +CD +RP CS+C     +C
Sbjct: 11  GCWTCRSRKVKCDLRRPNCSRCERSELQC 39

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 133,384,964
Number of extensions: 5955631
Number of successful extensions: 25467
Number of sequences better than 10.0: 751
Number of HSP's gapped: 26266
Number of HSP's successfully gapped: 818
Length of query: 1301
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1179
Effective length of database: 39,492,147
Effective search space: 46561241313
Effective search space used: 46561241313
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)