Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005208.846ON26826813630.0
ZYRO0G14300g8.846ON2802756512e-84
Suva_13.4708.846ON3032875681e-71
Skud_13.4538.846ON3002925638e-71
YMR281W (GPI12)8.846ON3042945638e-71
Smik_13.4948.846ON3042985594e-70
TPHA0I002808.846ON3012985421e-67
SAKL0D01320g8.846ON2602705181e-64
NDAI0K003308.846ON3132975152e-63
Kpol_1068.48.846ON2912785063e-62
KAFR0B039608.846ON2782795001e-61
KNAG0J002408.846ON2862874914e-60
NCAS0C003808.846ON2762524843e-59
TBLA0B033008.846ON3193194874e-59
Ecym_46178.846ON2492594651e-56
KLTH0C03740g8.846ON2542584424e-53
ABL120W8.846ON2492594353e-52
Kwal_27.102278.846ON2542684321e-51
KLLA0D01430g8.846ON2632534208e-50
CAGL0M03047g8.846ON3042834193e-49
Suva_11.3011.194ON36485674.8
Skud_11.3021.194ON36185674.9
Smik_11.3281.194ON36085665.6
KLTH0H11572g1.380ON123780676.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00520
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   529   0.0  
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   255   2e-84
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   223   1e-71
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   221   8e-71
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   221   8e-71
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   219   4e-70
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   213   1e-67
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   204   1e-64
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   202   2e-63
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   199   3e-62
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   197   1e-61
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   193   4e-60
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   191   3e-59
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   192   4e-59
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   183   1e-56
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   174   4e-53
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   172   3e-52
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   171   1e-51
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   166   8e-50
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   166   3e-49
Suva_11.301 Chr11 complement(550381..551475) [1095 bp, 364 aa] {...    30   4.8  
Skud_11.302 Chr11 complement(547706..548791) [1086 bp, 361 aa] {...    30   4.9  
Smik_11.328 Chr11 complement(556023..557105) [1083 bp, 360 aa] {...    30   5.6  
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    30   6.6  

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/268 (95%), Positives = 257/268 (95%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60
           MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV
Sbjct: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60

Query: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120
           MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ
Sbjct: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120

Query: 121 FDYPDGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK 180
           FDYPDGFDEKW           KVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK
Sbjct: 121 FDYPDGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK 180

Query: 181 GHKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANA 240
           GHKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANA
Sbjct: 181 GHKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANA 240

Query: 241 HESQLVWFRYGWWSLSRFVFVNDLEIVI 268
           HESQLVWFRYGWWSLSRFVFVNDLEIVI
Sbjct: 241 HESQLVWFRYGWWSLSRFVFVNDLEIVI 268

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  255 bits (651), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 177/275 (64%), Gaps = 14/275 (5%)

Query: 7   AVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPS 66
           A+K  K+ F L +L++A + RI  RN   +  +   +   +SL+L++AHPDDEVMFF+P+
Sbjct: 4   AIKFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPT 63

Query: 67  LLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDG 126
           +L+LD  LP +V FN VCLSKG AD LG+TR  EL+ S+NLL +NS+R+ QL Q DYPDG
Sbjct: 64  ILELDSRLPPNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDG 123

Query: 127 FDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKG---HK 183
            +E W            V  G   ++LLTFD  GVS H NH+ACH AV+ L++       
Sbjct: 124 HEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKA 183

Query: 184 ALYLNSHSRNLPLKYSGFIWELIRMLSDSVM-----------KLERTGLTFMNSFPQYIL 232
           ALYL+S+  N+ LKYS F WE+ ++  D  +               T +T M+ +  YIL
Sbjct: 184 ALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYIL 243

Query: 233 AFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267
           +FA+M ++H+SQ+VWFRYGWW+ SRFVFVNDL++V
Sbjct: 244 SFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVV 278

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  223 bits (568), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/287 (43%), Positives = 162/287 (56%), Gaps = 30/287 (10%)

Query: 9   KVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLL 68
           K+ KL   L++LY+  T +I  RN    Q           + L+IAHPDDEVMFFSP + 
Sbjct: 15  KITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVIS 74

Query: 69  QLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFD 128
           QL    P +V FN +CLSKGDA+ LGETR  EL  S  LL  N +R   +   D+ DG D
Sbjct: 75  QLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRN-ERPVSVQVMDFEDGMD 133

Query: 129 EKWXXXXXXXXXXXKVFIGSG--FNLLLTFDAHGVSNHPNHVACHNAVARLI-------- 178
           E W            + + +     +++TFD++GVSNH NH +CH AV + I        
Sbjct: 134 EVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKT 193

Query: 179 ----EKGH-KALYLNSHSRNLPLKYSGFIWELIRMLSDSV--------------MKLERT 219
               E  H  ALYL S+  N+ LKY+ FIWE+++ML  +V                 E+ 
Sbjct: 194 KEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKN 253

Query: 220 GLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266
           GL  MN+  QYILAFAAM NAH+SQ+VWFRYGWW LSRFVFVN+ +I
Sbjct: 254 GLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDI 300

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  221 bits (563), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 167/292 (57%), Gaps = 27/292 (9%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60
           +N S    K+ KL   L+ILY+  T +I  RN+   Q           + L+IAHPDDEV
Sbjct: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEV 66

Query: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120
           MFFSP + QL    P +V FN +CLSKG+AD LGE+R  EL  S  LL  N +R   +  
Sbjct: 67  MFFSPVISQLHSYFPITVPFNIICLSKGNADGLGESRVKELNGSAALLLQN-ERPVSVQV 125

Query: 121 FDYPDGFDEKWXXXXXXXXXXXKVFIGSG--FNLLLTFDAHGVSNHPNHVACHNAVARLI 178
            D+ DG DE W            + + +     +++TFD++GVS+H NH +CH AV RLI
Sbjct: 126 MDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLI 185

Query: 179 EKGHK-------------ALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLE-------- 217
           ++  +             ALYL S+  N+ LKY+ FIWE++++L   ++           
Sbjct: 186 DRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPTT 245

Query: 218 ---RTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266
              R+ L  MN+  QY+LA+AAM NAH+SQ+VWFRYGWW LSRFVFVN+ ++
Sbjct: 246 TTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 297

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  221 bits (563), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 168/294 (57%), Gaps = 29/294 (9%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60
           +N S    K+ KL   L+ILY+  T +I  RN    Q           + L+IAHPDDEV
Sbjct: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDDEV 68

Query: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120
           MFFSP + QL+   P++V FN +CLSKG+A+ LGETR  EL  S  LL  N +R   +  
Sbjct: 69  MFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHN-ERAVSVQV 127

Query: 121 FDYPDGFDEKWXXXXXXXXXXXKVFIGS-GFN-LLLTFDAHGVSNHPNHVACHNAVARLI 178
            D+ DG DE W           K+ I +   N +++TFD++GVSNH NH +C+ AV +L+
Sbjct: 128 MDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVKKLV 187

Query: 179 EKGHK-------------ALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKL--------- 216
           +   +             ALYL S+  N+ LKY+ FIWE++++L D +            
Sbjct: 188 DDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQALPP 247

Query: 217 ----ERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266
               E+  L+ MN+  QY+LAFA M NAHESQ+VWFRYGWW  SRFVFVN+ ++
Sbjct: 248 NTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  219 bits (559), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/298 (42%), Positives = 166/298 (55%), Gaps = 33/298 (11%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60
           +N S    K+ KL   L+ILY+  T +I  RN    Q       +   + L+IAHPDDEV
Sbjct: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEV 68

Query: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120
           MFFSP + QL    P +V FN +CLSKG+A+ LG+TR  EL  S  LL  N +R   +  
Sbjct: 69  MFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHN-ERAVSVQV 127

Query: 121 FDYPDGFDEKWXXXXXXXXXXXKVFIGSG--FNLLLTFDAHGVSNHPNHVACHNAVARLI 178
            D+ DG +E W            + I +     +++TFD++GVS H NH +CH AV +LI
Sbjct: 128 MDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLI 187

Query: 179 EKGHK-------------ALYLNSHSRNLPLKYSGFIWELIRML---------------S 210
               +             ALYL S+  N+ LKY+ FIWE++RML               S
Sbjct: 188 ADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPS 247

Query: 211 DSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIVI 268
           D V   E+  L  MN+  QYILAFAAM NAH+SQ+VWFRYGWW LSRFVFVN+ ++ I
Sbjct: 248 DVVA--EKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDVYI 303

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  213 bits (542), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/298 (40%), Positives = 170/298 (57%), Gaps = 35/298 (11%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESL---TLLIAHPDDEVM 61
           G   K+FK    LSILY+ LT  I   N   +  +     + +SL    L+IAHPDDEVM
Sbjct: 2   GILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVM 61

Query: 62  FFSPSLLQLDRLLPQSVRFNFVCLSKG---DADHLGETRELELQRSLNLLTSNSQ----R 114
           FF+P+LLQLD +LP  V FN +CLSKG   D   +G+ R  E+  SL +L  + +    R
Sbjct: 62  FFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNR 121

Query: 115 KTQLYQFDYPDGFDEKWXXXXXXXXXXXKVFIGSGFN----LLLTFDAHGVSNHPNHVAC 170
           + +L+QF+Y DG D++W            + + S  +     LLTFDA GVS HPNH+AC
Sbjct: 122 EVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIAC 181

Query: 171 HNAVARLIEKGHKA-----LYLNSHSRNLPLKYSGFIWELIRMLSDSV------------ 213
           ++A+  L +K         + LNS+  N+ LKYS F+  + ++L + +            
Sbjct: 182 YDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQV 241

Query: 214 ----MKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267
               M  E   + F+N+FP YI+A ++M N+H SQ+VWFRYGWWS SRFVFVNDL I+
Sbjct: 242 PFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHII 299

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  204 bits (518), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 154/270 (57%), Gaps = 18/270 (6%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEV 60
           M V     K+ K    LS+LY+ ++ RI   N  Q  ++     TP S+ L++AHPDDE 
Sbjct: 1   MRVVEVVAKLLKAYALLSVLYICVSQRIAAHNR-QVFRNVFPSRTPTSVNLIVAHPDDET 59

Query: 61  MFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQ 120
           MFFSP+LLQL    P SV    +CL+ GDAD LG  RE EL+ S+ LL     R T +  
Sbjct: 60  MFFSPTLLQLHVNYPPSVPLRVICLTNGDADGLGAVREQELRLSMQLLL--PARNTSVIV 117

Query: 121 FDYPDGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK 180
             + DG   +W            V   S   LLLTFD HGVS H NHV+C+ AV+ L+E+
Sbjct: 118 EGFEDGMGVEWDTRQVVATINRHVSDASP--LLLTFDEHGVSGHVNHVSCNTAVSALVEQ 175

Query: 181 GHK------ALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAF 234
             +      ALYLNS  R  P KY  F  +L R+++       R    FM++FPQY+L+ 
Sbjct: 176 REQREQRFTALYLNS-KRYFPPKYGSFAVDLARIITG------RQPPVFMSTFPQYLLSL 228

Query: 235 AAMANAHESQLVWFRYGWWSLSRFVFVNDL 264
           AAM NAH SQ+VWFR+GWW  SRFVFVN+L
Sbjct: 229 AAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  202 bits (515), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 170/297 (57%), Gaps = 38/297 (12%)

Query: 9   KVFKLLFFLSILYVALTARINGRN----------EVQWQQHA-AAIGTP-ESLTLLIAHP 56
           K FKL   L + Y+  T +I+  N          ++  Q H+ A I  P   L+L+IAHP
Sbjct: 11  KSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHP 70

Query: 57  DDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNS-QRK 115
           DDE+MFF+P+LLQL+R LP S+ FN +C S GDA+ LG  R  EL  S+NLL S+S  RK
Sbjct: 71  DDELMFFAPTLLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRK 130

Query: 116 TQLYQFDYPDGFDEKWXXXXXXXXXXXKVFIGS----GFNLLLTFDAHGVSNHPNHVACH 171
             +   D+ DG D+ W           ++ +        N+LLTFDA+G+SNHPNH+AC+
Sbjct: 131 INISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACN 190

Query: 172 NAVARLI--------EKGHKALYLNSHSR------NLPLKYSGFIWELIRM-------LS 210
            AV  LI        E     L L+S S       NL  KY+ F+ +L+++         
Sbjct: 191 KAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTF 250

Query: 211 DSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267
           +++       L+F+N++ QYIL++A+M N H+SQ+VWFRYGWW  SRFVF NDL +V
Sbjct: 251 NTIPNSASLELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVV 307

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  199 bits (506), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 156/278 (56%), Gaps = 22/278 (7%)

Query: 9   KVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLL 68
           K  KL F L   YV     I G N  Q +      G+  S+ L+IAHPDDEVMFFSP+L+
Sbjct: 9   KAIKLYFLLWCGYVWFAGAIRGENARQVRGPGYFSGS-SSVNLVIAHPDDEVMFFSPTLM 67

Query: 69  QLDRLLPQSVRFNFVCLSKG---DADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPD 125
           QLD  LP  V  N +C SKG   D    GE+R  EL++S+++L  +  R   ++Q DY D
Sbjct: 68  QLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLIEHD-RPVTVHQLDYKD 126

Query: 126 GFDEKWXXXXXXXXXXXKVFIGSGF---NLLLTFDAHGVSNHPNHVACHNAVARLIEKG- 181
           G D+ W            +     +   +LL+TFD HGVS+HPNH+ACHNAV RLIE+  
Sbjct: 127 GKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEEP 186

Query: 182 -HKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLER--TGL----------TFMNSFP 228
              A  L SHS N+ LKYS F  E+++   +   +  +  T L             N+  
Sbjct: 187 LFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTHS 246

Query: 229 QYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266
           +YI+A+A M NAHESQ+VWFRYGWW  SR  + N+L++
Sbjct: 247 EYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANELKL 284

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  197 bits (500), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 160/279 (57%), Gaps = 18/279 (6%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAI----GTPESLTLLIAHP 56
           +++S    K+ KL      LY+ L+ +I   N+        ++        SLTL++AHP
Sbjct: 2   IHISKLIFKITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHP 61

Query: 57  DDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKT 116
           DDEVMFFSP+LLQLD  LP + +FN +  S GDA+ LG  R  EL  S+++L    +R  
Sbjct: 62  DDEVMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLI--PRRNK 119

Query: 117 QLYQFDYPDGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVAR 176
           +++ F++ DG +E W            +   S  N+LLTFD  GVSNH NH ACH  V  
Sbjct: 120 EIFIFNHTDGMNEVW-DNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTS 178

Query: 177 LIE---KGHKALYLNSHSRNLPLKYSGFIWELIRMLSD------SVMKLERTGLTFMNSF 227
            I+   K + AL L+S+S NL  KY+GF W+L+ +  +      ++  L+   L   N +
Sbjct: 179 YIQSHAKNNFALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTLPNLDH--LALFNPY 236

Query: 228 PQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEI 266
             YI A+A M  AH+SQ+VWFRYGWW  SRFV+VNDL++
Sbjct: 237 SDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDLKL 275

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  193 bits (491), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 161/287 (56%), Gaps = 28/287 (9%)

Query: 2   NVSGGAVKVFKLLFFLSILYV-ALTARINGRNEVQWQQHAAAIGTPE--SLTLLIAHPDD 58
           N S    KV KL   L ILY+ A T++I   N    +     +G  +  S+ L+IAHPDD
Sbjct: 5   NFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLE----TLGEHDINSVNLVIAHPDD 60

Query: 59  EVMFFSPSLLQL-DRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQ 117
           EVMFF+PSL+ L +++   S  FN +C S G AD LG  RE EL  S+ +L     R T 
Sbjct: 61  EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPT--RNTS 118

Query: 118 LYQFDYPDGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARL 177
           +   D+ DG  EKW            +    G N+LLTFD  GVS H NH+AC+ A    
Sbjct: 119 IVVLDFKDGMKEKWDVKEMIAKLR-NIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGY 177

Query: 178 I-----EKGHKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMK------LERTG------ 220
                 ++    L L S+S+N+  KYS +IWELI++L  S +       L + G      
Sbjct: 178 YNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARK 237

Query: 221 LTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267
           +T  +++PQY+L+ AAM NAH++Q+VWFRYGWW  SR VFVNDL+++
Sbjct: 238 ITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVI 284

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  191 bits (484), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 149/252 (59%), Gaps = 19/252 (7%)

Query: 27  RINGRNEVQWQQHAAAI---GTPESLTLLIAHPDDEVMFFSPSLLQLDRLLPQSVRFNFV 83
           RI   N + + Q    I   GT  +L L+IAHPDDEVMFF+P+LLQLD L+P S+  N +
Sbjct: 32  RIEQFNTLNYSQLNTKIFHEGT--TLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVI 89

Query: 84  CLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFDEKWXXXXXXXXXXXK 143
           C S GDA  LGE R+ ELQ S++ L  N QR+T +    + DG D+ W           +
Sbjct: 90  CFSNGDAQGLGEKRQHELQSSIHALIQN-QRQTNVTVLHFQDGNDQIW-----DIDQMTQ 143

Query: 144 VFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGHKA--LYLNSHSRNLPLKYSGF 201
               +     LTFD+HGVS H NH+ACHNAV  L    +    L L+S   +L  KY+ F
Sbjct: 144 YLPQNDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFF 203

Query: 202 IWELIRMLSDSVMKLER------TGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSL 255
           I +L+++  +     ++        +TF N++ QYILA++ M NAH+SQ+VWFRYGWW+ 
Sbjct: 204 IIDLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAF 263

Query: 256 SRFVFVNDLEIV 267
           SRFVF N L+I 
Sbjct: 264 SRFVFSNHLKIT 275

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  192 bits (487), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 123/319 (38%), Positives = 171/319 (53%), Gaps = 53/319 (16%)

Query: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQ---QHAAAIGTPE-----SLTLL 52
           MN S   ++  KL+    ++Y+  +  I   N+  +    +H   +   +     SL+L+
Sbjct: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60

Query: 53  IAHPDDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGE----TRELELQRSLNLL 108
           IAHPDDE+MFFSP+LLQL+  L + + FN VCLS+G  D  G      R  EL  SLNLL
Sbjct: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLL 119

Query: 109 ---TSNSQ--RKTQLYQFDYPDGFDEKWXXXXXXXXXXXKV-FIGSGFNLLLTFDAHGVS 162
               SN++  R  +L Q DY DG  E W            + F  +G NLLLTFD  GVS
Sbjct: 120 FNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVS 179

Query: 163 NHPNHVACHNAVARLIEKGHK-----ALYLNSHSRNLPLKYSGFIWELIRML-------- 209
           NH NH+AC+ AV +L++  +       ++LNSHS+N  LKYS F+ +L  ++        
Sbjct: 180 NHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSI 239

Query: 210 ----------SDSVMKLE---------RTGL--TFMNSFPQYILAFAAMANAHESQLVWF 248
                     SD +   +         +T L  TF N F +Y+L+++ M NAHESQ+VWF
Sbjct: 240 SLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWF 299

Query: 249 RYGWWSLSRFVFVNDLEIV 267
           RY WW  SRF F+NDL IV
Sbjct: 300 RYLWWIFSRFAFINDLTIV 318

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  183 bits (465), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/259 (40%), Positives = 144/259 (55%), Gaps = 13/259 (5%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFS 64
           G    V KL   L  +Y      +   N   ++    + G   S+TL+IAHPDDEVMFF+
Sbjct: 3   GSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFA 62

Query: 65  PSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYP 124
           P+LLQLD  + QSV F  VCL+ GDAD LGE R  EL ++L LL    +R  ++    + 
Sbjct: 63  PTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLV--LERDVEIQMGGFK 120

Query: 125 DGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGHKA 184
           DG DE+W            V       L+LTFD  GVS H NH+AC +A A+L   GH  
Sbjct: 121 DGMDEEWKMEVVREELAQVV--TDRRPLVLTFDERGVSGHRNHIACAHAAAKL---GHHT 175

Query: 185 LYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQ 244
           L+L+S   NL  KYS F  +L R+L    M        F+++F QY+ +   M  AH+SQ
Sbjct: 176 LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMP-----TVFLSTFSQYLHSLVTMLVAHKSQ 229

Query: 245 LVWFRYGWWSLSRFVFVND 263
           +VWFR+GWW+ SR+V+ N+
Sbjct: 230 MVWFRWGWWTASRYVYANE 248

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  174 bits (442), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 149/258 (57%), Gaps = 16/258 (6%)

Query: 10  VFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLLQ 69
           V KLL  L ILY A +ARI   NE  +    + +  P S+ L+IAHPDDEVMFF+P+LLQ
Sbjct: 7   VCKLLAVLCILYFASSARIKASNEQAFTTLFSVLN-PTSINLVIAHPDDEVMFFAPTLLQ 65

Query: 70  LDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFDE 129
           LD      +  +   L+ G AD LG+ RE EL+ S++LL    +RK ++   ++ DG   
Sbjct: 66  LDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLF--RRRKAEVTVLNFEDGMKV 123

Query: 130 KWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGH---KALY 186
           +W           +V +G    L LTFD HGVS+H NH++C+  V R +   H   ++  
Sbjct: 124 EWDLQKTSEALRKQV-VGDQ-PLFLTFDDHGVSSHINHISCYETV-RNLRAAHPESRSFS 180

Query: 187 LNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLV 246
           L S  R++  KY+ F+  LI +L  S   +      FM++F QY+LA + M NAH SQ+V
Sbjct: 181 LTS-KRSIFQKYTAFVPSLITVLRGSRQAV------FMSTFKQYLLALSVMMNAHTSQMV 233

Query: 247 WFRYGWWSLSRFVFVNDL 264
           WFRYGWW  S +VF N++
Sbjct: 234 WFRYGWWFFSCYVFANEV 251

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  172 bits (435), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 138/259 (53%), Gaps = 13/259 (5%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFS 64
           G    V KL   L  +Y     R+   N   +++         SLTL+IAHPDDEVMFF+
Sbjct: 3   GSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFA 62

Query: 65  PSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYP 124
           P+LLQLD  LP  + F  VCL+ G A+ LG+ R  ELQ++L LL    +    L   D+ 
Sbjct: 63  PTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLV--LEHDVTLEVADFT 120

Query: 125 DGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGHKA 184
           DG  E W              +     L+LTFD  GVS H NH+ C  A ARL   GHK 
Sbjct: 121 DGMKEDWDLAEVRTRLGE--LVTDAKPLVLTFDERGVSGHRNHIGCALAAARL---GHKT 175

Query: 185 LYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQ 244
           L+L S  RNL  KYS F+ ++ R++  +          F+++  QY+ A  AM  AH SQ
Sbjct: 176 LFLRS-ERNLLRKYSFFVLDVFRVVFGTP-----PPTVFVSTLAQYLHALVAMVVAHRSQ 229

Query: 245 LVWFRYGWWSLSRFVFVND 263
           +VWFR+GWW  SR+V+ N+
Sbjct: 230 MVWFRWGWWMASRYVYANE 248

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  171 bits (432), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/268 (38%), Positives = 147/268 (54%), Gaps = 24/268 (8%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGT------PESLTLLIAHPDD 58
           G    VFK+   L ++Y+  + +I   N         A+G+      P S+ L+IAHPDD
Sbjct: 2   GAFRTVFKVSGILWLVYILGSVQIERSNR-------RALGSLFRGSAPTSINLVIAHPDD 54

Query: 59  EVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQL 118
           EVMFF+P+LLQ+D  LP S+  N + L+ G AD LG+ R  ELQ  + LL    +RK  +
Sbjct: 55  EVMFFAPTLLQIDEWLPGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLL--RKRKASV 112

Query: 119 YQFDYPDGFDEKWXXXXXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLI 178
              D+ DG D +W           ++   S   L LTFD +G+S H NH++C+ AV ++ 
Sbjct: 113 EVLDFLDGMDVEWDLERAVKALQERILDES--PLFLTFDENGISGHVNHISCYKAVQKVR 170

Query: 179 EKGHKALYLNSHS-RNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAM 237
           +   K+      S R L  KYSGFI  L      S      +  T +NSF QY+LA ++M
Sbjct: 171 KHYSKSSCFKLVSKRYLFEKYSGFIPALFHSFISS------SPSTLINSFRQYLLALSSM 224

Query: 238 ANAHESQLVWFRYGWWSLSRFVFVNDLE 265
            NAH SQ+VWFRYGWW  S +V+ N+L+
Sbjct: 225 MNAHVSQMVWFRYGWWLFSYYVYANELQ 252

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  166 bits (420), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 140/253 (55%), Gaps = 19/253 (7%)

Query: 19  ILYVALTARINGRNEVQWQQHA----AAIGTPESLTLLIAHPDDEVMFFSPSLLQLDRLL 74
           ++Y  LT  I   N  +W  H     + +    S+TL++AHPDDEVMFFSP+L Q + LL
Sbjct: 19  VIYGCLTKTIKEHN--RWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNELL 76

Query: 75  PQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFDEKWXXX 134
           P S+  N VC++ GDAD LG  R+ EL  SL ++    Q    +   D+ DG D  W   
Sbjct: 77  PISIPINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDV--LDFEDGMDAVWDQV 134

Query: 135 XXXXXXXXKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEK---GHKALYLNSHS 191
                      I     L+LTFD  GVS H NH++C     RL+EK    HK L+L S  
Sbjct: 135 LLEKQLRSS--IPDSNPLVLTFDQFGVSGHINHISC----GRLVEKLPYSHK-LHLRS-D 186

Query: 192 RNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYG 251
           + + +KYS FI  + ++   +V         F+++ PQY+LA +AM+ AH SQ+VWFR G
Sbjct: 187 QPIYVKYSAFIAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVG 246

Query: 252 WWSLSRFVFVNDL 264
           WW  SRF F+N+L
Sbjct: 247 WWLFSRFCFINEL 259

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  166 bits (419), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 149/283 (52%), Gaps = 34/283 (12%)

Query: 9   KVFKLLFFLSILYVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLL 68
           K+ KL     +LY+  T ++   N+    +          L L+IAHPDDE+MFFSP++L
Sbjct: 24  KLTKLTIIFQVLYIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTIL 83

Query: 69  QLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQ-RKTQLYQFDYPDGF 127
           QL   +      N VCLS GDAD LGE R  EL+ ++  LT N   R   L   DY DG 
Sbjct: 84  QL---IDHVQELNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQ 140

Query: 128 DEKWXXXXXXXXXXXKVFIGSG------FNLLLTFDAHGVSNHPNHVACHNAVARLIE-- 179
           +E W           K +I +        +++LTFD  G+S H NH+AC+  V   ++  
Sbjct: 141 NEVWSGVATDL----KKYILTSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTI 196

Query: 180 KGHKALYLNSHSRN---LPLKYSGFIWELIRMLSDSVMKLERT---------------GL 221
           K +  ++L   S +   +  KYSG + +L+ ++ + +    +T                +
Sbjct: 197 KSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNV 256

Query: 222 TFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDL 264
            F+++F QY L+FAAM  AH+SQ+VWFRY WWS SR+VFVNDL
Sbjct: 257 CFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>Suva_11.301 Chr11 complement(550381..551475) [1095 bp, 364 aa] {ON}
           YKR066C (REAL)
          Length = 364

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 9/85 (10%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHA---------AAIGTPESLTLLIAH 55
           G A  VF   F+L++L        N  N  QW   +         A +  P+  T++  +
Sbjct: 262 GAANNVFTNEFYLNLLNEDWKLEKNDANNKQWDSKSGYMMLPTDYALVQDPKYRTIVKEY 321

Query: 56  PDDEVMFFSPSLLQLDRLLPQSVRF 80
            DD+  FF       ++LL   + F
Sbjct: 322 ADDQDKFFKDFAKVFEKLLENGIDF 346

>Skud_11.302 Chr11 complement(547706..548791) [1086 bp, 361 aa] {ON}
           YKR066C (REAL)
          Length = 361

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 9/85 (10%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHA---------AAIGTPESLTLLIAH 55
           G A  VF   FFL++L        N  N  QW   +         A +  P+ L ++  +
Sbjct: 259 GAANNVFTNEFFLNLLNEDWKLEKNEANNKQWDSKSGYMMLPTDYALVQDPKYLKIVKEY 318

Query: 56  PDDEVMFFSPSLLQLDRLLPQSVRF 80
            DD+  FF       ++LL   + F
Sbjct: 319 ADDQDKFFKDFSKVFEKLLENGITF 343

>Smik_11.328 Chr11 complement(556023..557105) [1083 bp, 360 aa] {ON}
           YKR066C (REAL)
          Length = 360

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 9/85 (10%)

Query: 5   GGAVKVFKLLFFLSILYVALTARINGRNEVQWQQHA---------AAIGTPESLTLLIAH 55
           G A  VF   F+L++L        N  N  QW   +         A I  P+ L ++  +
Sbjct: 258 GAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYALIQDPKYLKIVKEY 317

Query: 56  PDDEVMFFSPSLLQLDRLLPQSVRF 80
            DD+  FF       ++LL   + F
Sbjct: 318 ADDQNKFFKDFSKVFEKLLENGITF 342

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1237

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 24  LTARINGRNEVQWQQHAAAIGTPESLTLLIAHP---DDEVMFFSPSLLQLDRL----LPQ 76
           L  RI    E   + H+A+  TPES ++ +  P    +  +   P LLQ ++     L  
Sbjct: 69  LRERIKALEETLAKMHSASSNTPESASVALEEPRVFQESKLIQEPKLLQSNKYDNDELDL 128

Query: 77  SVRFNFVCLSKGDADHLGET 96
           S +F+ + L      HLG T
Sbjct: 129 SRQFDMLHLKNNGTVHLGAT 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,668,141
Number of extensions: 1050542
Number of successful extensions: 2855
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2842
Number of HSP's successfully gapped: 27
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)