Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B005108.847ON55055028110.0
ZYRO0G14322g8.847ON55055710491e-136
SAKL0D01298g8.847ON5514768012e-99
KLTH0C03718g8.847ON5515647952e-98
Kwal_27.102248.847ON5465567646e-94
Kpol_1068.38.847ON5664957064e-85
TPHA0I002908.847ON5694635871e-67
Smik_13.4958.847ON5764235064e-56
Skud_13.4548.847ON5804215049e-56
Ecym_46188.847ON5274094833e-53
Suva_13.4718.847ON5813664812e-52
YMR282C (AEP2)8.847ON5803674714e-51
CAGL0M03069g8.847ON5484543923e-40
KAFR0B039708.847ON4743943822e-39
NDAI0K003408.847ON6244373671e-36
KLLA0D01408g8.847ON5184053612e-36
TBLA0B033108.847ON6134753521e-34
NCAS0C003708.847ON4953983472e-34
KNAG0J002308.847ON4743642782e-25
ABL119C8.847ON5373872251e-18
Kwal_27.11978singletonOFF14050702.3
TDEL0H009801.216ON407992733.1
TPHA0B006104.305ON122035706.9
Kwal_56.231243.130ON779147699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00510
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...  1087   0.0  
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   408   e-136
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   313   2e-99
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   310   2e-98
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   298   6e-94
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   276   4e-85
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   230   1e-67
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   199   4e-56
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   198   9e-56
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   190   3e-53
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   189   2e-52
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   186   4e-51
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   155   3e-40
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   151   2e-39
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   145   1e-36
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   143   2e-36
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   140   1e-34
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   138   2e-34
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   111   2e-25
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    91   1e-18
Kwal_27.11978 s27 (1030513..1030935) [423 bp, 140 aa] {OFF} [con...    32   2.3  
TDEL0H00980 Chr8 (159829..172068) [12240 bp, 4079 aa] {ON} Anc_1...    33   3.1  
TPHA0B00610 Chr2 complement(139975..143637) [3663 bp, 1220 aa] {...    32   6.9  
Kwal_56.23124 s56 complement(409746..412085) [2340 bp, 779 aa] {...    31   9.7  

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/550 (95%), Positives = 527/550 (95%)

Query: 1   MLRRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNVR 60
           MLRRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNVR
Sbjct: 1   MLRRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNVR 60

Query: 61  DTLRGLESLYALPGVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSL 120
           DTLRGLESLYALPGVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSL
Sbjct: 61  DTLRGLESLYALPGVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSL 120

Query: 121 FETKELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGL 180
           FETKELSTSEFSTFINR           SNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGL
Sbjct: 121 FETKELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGL 180

Query: 181 TPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGAL 240
           TPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGAL
Sbjct: 181 TPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGAL 240

Query: 241 QKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAI 300
           QKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAI
Sbjct: 241 QKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAI 300

Query: 301 VYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGL 360
           VYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGL
Sbjct: 301 VYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGL 360

Query: 361 RILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSI 420
           RILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSI
Sbjct: 361 RILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSI 420

Query: 421 TYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKT 480
           TYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKT
Sbjct: 421 TYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKT 480

Query: 481 MALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDXXXXXXXXXXXXYDNME 540
           MALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRD            YDNME
Sbjct: 481 MALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDKARAKQQQQQAQYDNME 540

Query: 541 EEDMLLGRLW 550
           EEDMLLGRLW
Sbjct: 541 EEDMLLGRLW 550

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  408 bits (1049), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 227/557 (40%), Positives = 331/557 (59%), Gaps = 14/557 (2%)

Query: 1   MLRRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNVR 60
           MLR   S   VFKAF+S+L +++A A A+  GA        T     S++ +   +  + 
Sbjct: 1   MLRTACSRSHVFKAFSSSLMLEHALAAANSSGAAAPTNAASTGNSHDSTLKSELPLRTLN 60

Query: 61  DTLRGLESLYALP--GVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIK 118
           D L   E  Y  P        STR T   +++REYL+  +Y   LI + V NHLN  YI 
Sbjct: 61  DELHNAERKYIKPLTNAPEWSSTR-TGPNSKIREYLKNGQYTKLLIRLSVDNHLNNEYIS 119

Query: 119 SLFETKELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQN 178
            LF T  L+ SE+S FIN+           SN+IPDT HTE+I+ LY+ YC +++   Q+
Sbjct: 120 GLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIV--DQH 177

Query: 179 GLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCG 238
            LTPLQ++D+N F+K FI EAQL KA   L F++ ++ L+++L + DVE + QFL+L+CG
Sbjct: 178 NLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCG 237

Query: 239 ALQKFWRVDS----NSTKV-LGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSS 293
           AL KFW++      NST + LGE +      KSY    E+  L+I+N +L + +W+ R S
Sbjct: 238 ALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNRRS 297

Query: 294 PIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKN 353
           P +D+AI+YSL  LGQT LI++Y+   W  S+D  V       P  ++L+ ++++YC+K 
Sbjct: 298 PKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTN----PNSDLLVAVLTSYCVKE 353

Query: 354 GDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWH 413
           G+  KGL +LD+F++ YP+ EL+ LFWRRLLQLS   WDK++D+KA + HGCW IMKQWH
Sbjct: 354 GNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLSHGCWTIMKQWH 413

Query: 414 EQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMF 473
            Q+   I YD G ++ LY +F  T+N  GA EV+   F   + +  + I  +E+ LL  +
Sbjct: 414 AQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKY 473

Query: 474 QKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDXXXXXXXXXX 533
           Q+  LK +ALKG Y++  +  +EW+    N+  L  YFM+ R  ++  R           
Sbjct: 474 QRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRRTSQSKQKAALQ 533

Query: 534 XXYDNMEEEDMLLGRLW 550
             YD MEE+DMLLGRLW
Sbjct: 534 EKYDEMEEDDMLLGRLW 550

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  313 bits (801), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 166/476 (34%), Positives = 279/476 (58%), Gaps = 16/476 (3%)

Query: 82  RDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLFETKELSTSEFSTFINRXXXX 141
           + ++  N LR++L+  E+  FL+ ++++   +  +   +F  K ++  E+S F+N+    
Sbjct: 85  KPSLPRNNLRQHLQDNEHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSN 144

Query: 142 XXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQL 201
                  +N+IP TVHTE++F LY+IY   V+ ++   LTP+Q++D+N+FIKRF  +AQL
Sbjct: 145 TNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT--LTPVQLYDLNQFIKRFTGDAQL 202

Query: 202 KKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNST---KVLGEDS 258
            KAQ+ L F+++  G  +I +  D +T+  +L+L+CGA+ + W +  +     K LG  S
Sbjct: 203 AKAQQVLGFVLENYG--SIPR--DPQTLINYLELKCGAMPRNWSIPLSRPELGKTLGSQS 258

Query: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318
                  SY +L+ +  L +++ ++KD++W  + +  +++A++YSL  +GQ  L+++YI+
Sbjct: 259 FMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMGQFALLERYIK 318

Query: 319 LKWGISEDGH----VAVKNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374
             WG+S   +    V V     P   +LI+IVS Y +K G+  + L+I+D F+ K+PQ E
Sbjct: 319 HTWGVSVSSNTSTEVEVPKNLYPTSNLLISIVSCYAMK-GNLHQALQIIDSFLSKFPQIE 377

Query: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434
           LE LFWRRL Q S   W+++ D K  + +GCW +MKQWH ++  S+  D G L   Y + 
Sbjct: 378 LEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRSLPIDLGILNERYYVL 437

Query: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494
           K T N   A  +     + +Y K+   +   E+D++  FQKL LK MA +G Y++PL+ I
Sbjct: 438 KRTNNFTEALRIHDEALAGLYMKR--NLIDPEVDVIKKFQKLILKKMAGRGYYHKPLKYI 495

Query: 495 KEWNVDKINQHYLLDYFMRHRRKYDLTRDXXXXXXXXXXXXYDNMEEEDMLLGRLW 550
            EW ++K N+  + +YF RHR+ Y    +            +D  EE+DMLLGRLW
Sbjct: 496 SEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEEEDDMLLGRLW 551

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  310 bits (795), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 189/564 (33%), Positives = 296/564 (52%), Gaps = 32/564 (5%)

Query: 3   RRNHSIQQVFKAFNSTLSVDYAAAQASIV--------GAPVKHEERHTQTLTSSSINACR 54
           R+  S+    K FNSTLSV Y+A+ A++          A  K+  +  +TL  +      
Sbjct: 4   RKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDAVRERSE 63

Query: 55  SISNVRDTLRGLESLYALPGV-EYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLN 113
              +   T +       +P + E   S+  +   N+LR +L  ++Y+ FL+ + +Q+ ++
Sbjct: 64  RFRSRVYTAK-------IPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMD 116

Query: 114 RNYIKSLFETKELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVI 173
            N+   +F+  +LS +EFS FI             S  +P+   TE++F+LYQ+Y   V 
Sbjct: 117 ENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTV- 175

Query: 174 KDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFL 233
             +   L+PLQ+HD N+FI+ FI  AQL+KAQ  L  ++     +N     D  T T +L
Sbjct: 176 --TPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKS---NNNQLPCDSATATHYL 230

Query: 234 QLRCGALQKFWRV-DSN---STKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKS-W 288
           QLRCGAL + W+V D N   ST++    +++     SY  L  +  L  ++ L   KS W
Sbjct: 231 QLRCGALPRNWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVW 290

Query: 289 RLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAV--PGHEVLINIV 346
             R S  ++SA+VYSL  +GQ KL+++++   WGIS   H  V + +   P  EVL+ ++
Sbjct: 291 FHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVL 350

Query: 347 SAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCW 406
           ++Y   N +    L ++D FM KYP  EL+ +FWRRL Q S   W ++ D +  +  GCW
Sbjct: 351 TSYA-SNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCW 409

Query: 407 NIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDE 466
            +M++WH  +   +  D+  L   + +   T N R A EVV  C+SS + K    +S+ E
Sbjct: 410 RVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKA--NLSRHE 467

Query: 467 MDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDXXX 526
             L   F KL LK MA  G Y++PL+ IKEW+ +K+ +H L  YF +HR  Y   +    
Sbjct: 468 AVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRT 527

Query: 527 XXXXXXXXXYDNMEEEDMLLGRLW 550
                    +D+ EE+ MLLGRLW
Sbjct: 528 EAAQKAQKRFDDEEEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  298 bits (764), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 186/556 (33%), Positives = 298/556 (53%), Gaps = 21/556 (3%)

Query: 3   RRNHSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEERHTQTLTSSSINACRSISNV-RD 61
           +R+ +++  FK+F+STLSV+Y+A   S     +  E+ H+Q    ++I+  R++++  +D
Sbjct: 4   KRHTAVRLAFKSFSSTLSVNYSARDESYNYRVI--EQAHSQG-RGNAIDLKRTMADAFQD 60

Query: 62  TLRGLESLYALPGVEYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLF 121
             +GL     +   E   S+  T   N+LR  L  K+Y+ F+I + +Q+ LN N+   +F
Sbjct: 61  KTKGLICATNIHQAE-SPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNFSHKIF 119

Query: 122 ETKELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLT 181
           E   L+ +EFST +N              ++P    TE+IF LYQ   TY++      L 
Sbjct: 120 EDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQ---TYLMTIPAGSLN 176

Query: 182 PLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQ 241
           PLQ+HD+N F++ FI+ AQL KAQ  L  ++     +N     D  T   +LQLRCGAL 
Sbjct: 177 PLQLHDLNSFVQYFIETAQLGKAQIVLDRIL---ASNNDQLPCDTTTGIHYLQLRCGALP 233

Query: 242 KFWRV-DS---NSTKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKS-WRLRSSPII 296
           + W+V DS   +S ++    +K      +Y  L +   LE VN L  + S W  + SP +
Sbjct: 234 RNWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTL 293

Query: 297 DSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVK--NEAVPGHEVLINIVSAYCLKNG 354
           ++A++YSL  +GQ  L+ ++I ++WGI+E G       NE  P  EVLI I +++   + 
Sbjct: 294 EAAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFA-SHQ 352

Query: 355 DTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHE 414
           +   GLR++D F+ KY +  L+ +FWRRL Q +   WD + D +  +  GCW +M +WHE
Sbjct: 353 EVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHE 412

Query: 415 QKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQ 474
           +    +  D+  L   Y +   T N + A  V+   F  +Y K    +S  EM ++  + 
Sbjct: 413 KGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKP--TLSSKEMAIVQKYS 470

Query: 475 KLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDXXXXXXXXXXX 534
           KL LK+MA  G Y++PL  I EW+ +K  +  L  YF +HR  +   ++           
Sbjct: 471 KLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKERLREESRRKQN 530

Query: 535 XYDNMEEEDMLLGRLW 550
            YD+ EE++MLLGRLW
Sbjct: 531 TYDDEEEDNMLLGRLW 546

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  276 bits (706), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 167/495 (33%), Positives = 272/495 (54%), Gaps = 32/495 (6%)

Query: 83  DTVSTNQLREYLRRKEYVDFLIHVMVQNHLNRNYIKSLFETKELSTSEFSTFINRXXXXX 142
           D +  N  R YL+  E   F +H++     + +++K+LF++ +L+ +E S FINR     
Sbjct: 77  DVLPENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSN 136

Query: 143 XXXXXXSNIIPD---TVHTEIIFNLYQIYCTYVIKDSQN-GLTPLQVHDINRFIKRFIDE 198
                   +I +     +TE+I+ ++++Y + + K+S    L  L + D+N FI  FI E
Sbjct: 137 GHDI--KRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKE 194

Query: 199 AQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKV----- 253
           AQL KAQ  LQ++ID +G  +I +  D +T+  FL+LRCG L KFW V   S  V     
Sbjct: 195 AQLSKAQNVLQYIIDAEG--SIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTK 252

Query: 254 ----LGEDSKHFKSPKSY-NLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLG 308
               L  +S + + P SY + +      E++N +L  K W+ + S I+DS IVYSL++  
Sbjct: 253 KNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTF 312

Query: 309 QTKLIDQYIQLKWGISEDGH---VAVKNEAV---PGHEVLINIVSAYCLKNGDTGKGLRI 362
           Q +++D +I+  WGIS  G    + +K + V   P +E+LI I+S+Y  K+ +    ++I
Sbjct: 313 QKQMMDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKI 372

Query: 363 LDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQ---KGVS 419
           LD+F++ YP   L+ +FWRRL+Q     WD + D++    +GCWN+MK W+     K V 
Sbjct: 373 LDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVV 432

Query: 420 ITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALK 479
           + YD       Y+LFK T NG+ AAE+V        +++   + K E++LL  +Q LA+ 
Sbjct: 433 LPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMN 492

Query: 480 TMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHR----RKYDLTRDXXXXXXXXXXXX 535
            +  + ++ +    I+EW++D+ N+  L + F + +    RK   TRD            
Sbjct: 493 WLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLS-TRDKKSQSQKKRQDR 551

Query: 536 YDNMEEEDMLLGRLW 550
           YD MEEEDM++GRLW
Sbjct: 552 YDEMEEEDMIIGRLW 566

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  230 bits (587), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 146/463 (31%), Positives = 234/463 (50%), Gaps = 34/463 (7%)

Query: 116 YIKSLFETKELSTSEFSTFINRXXXXXXXXXXXSNI--IPDTVHTEIIFNLYQIYCTYVI 173
           +++ L E+K+L+ +EFS F+NR             +   P+  H+E++F L+Q+Y   + 
Sbjct: 113 FLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIG 172

Query: 174 KDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFL 233
            D    L+ L + D+N FI+ FI+E  L +A+  L F+++K    +IL   DV+T+T +L
Sbjct: 173 SDK---LSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKT--RSILDLYDVDTVTHYL 227

Query: 234 QLRCGALQKFWRVDSNSTKV----------------LGEDSKHFKSPKSYNLLKEQPFLE 277
           QLRCGAL ++W   + S ++                LG  +   K    Y +L     L+
Sbjct: 228 QLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLK 287

Query: 278 IVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGIS---EDGH----VA 330
           I N ++ D  W+   S  +D+ +VYSL   GQ   I  YI  +W +     DG+      
Sbjct: 288 IANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQ 347

Query: 331 VKNEA---VPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLS 387
           + NEA   +P  EV+  I+S+Y   +    + + I+D+ M  YP  EL + FWRRL+Q S
Sbjct: 348 ISNEASKPLPS-EVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWS 406

Query: 388 FHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVV 447
              WD + D+K  + +GC+  +K++HE + + I +D G L+ LY L  +T+N R AAEVV
Sbjct: 407 VLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVV 466

Query: 448 RTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYL 507
                  + K+  +I+  E  LL  FQK ++  M  K  Y      I++W++D  N+  L
Sbjct: 467 SEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEEL 526

Query: 508 LDYFMRHRRKYDLTRDXXXXXXXXXXXXYDNMEEEDMLLGRLW 550
             Y+     K                   D+ +E+D LLGRLW
Sbjct: 527 FKYYKDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  199 bits (506), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 131/423 (30%), Positives = 227/423 (53%), Gaps = 37/423 (8%)

Query: 157 HTEIIFNLYQIYCTYV------IKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210
           ++E  F ++ +Y   V      I      L   ++ DIN  I+ FI+  QL KAQ+ L F
Sbjct: 162 YSEFWFKIFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTF 221

Query: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTK---------VLGEDS 258
           +ID+    +IL S    D+ T+  FL+LRCGAL  +W++  NS +          LG  +
Sbjct: 222 IIDRNP--DILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKN 279

Query: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318
              +   +Y ++  Q  L+I + +L +K  R  +S  + S ++ S  +LGQT+++++ I+
Sbjct: 280 TSIRLSSTYKVMDHQTLLKIADLVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILERCIE 337

Query: 319 LKWGISED---GHVAVKNEAV-PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374
             W I+      HVA+K     P  ++LI+I+ ++   + D  +GL ILD F+K YP+ +
Sbjct: 338 HIWHITTQEFPSHVAIKPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEVK 397

Query: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434
           L+ LFWRRL QLS   W   KDKKA     CW++MKQWH  KG+S++ D  TLR LY + 
Sbjct: 398 LDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIM 457

Query: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLM-FQKLALKTMALKGRYNEPLQL 493
           K T N     +V+++  S +  ++  + + D+++++L+ +QK  +K +  +GR +   + 
Sbjct: 458 KKTGNFPLGIDVLKSFKSGI--ERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREF 515

Query: 494 IKEWNVDK-INQHYLLDYFMRHR-----RKYDLTRDXXXXXXXXXXXXYDNMEEEDMLLG 547
           I ++  D+ I ++  L+ F  +R     +K     +            +D+ E++ M++G
Sbjct: 516 INDFGFDRTITKN--LNIFCTNRLLLRSKKNKSKIENKKERNKLEPSGFDDDEDDGMIIG 573

Query: 548 RLW 550
            LW
Sbjct: 574 SLW 576

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  198 bits (504), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 132/421 (31%), Positives = 218/421 (51%), Gaps = 33/421 (7%)

Query: 157 HTEIIFNLYQIYCTYV------IKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210
           ++E  F L+ +Y   V      +      L   ++ D+N  IK FI+  QL KAQ+ L F
Sbjct: 166 YSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSF 225

Query: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTKV---------LGEDS 258
           ++D+    +IL S    D+ TI  FLQLRCGAL  +W++  NS +          LG  +
Sbjct: 226 ILDRNP--DILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKN 283

Query: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318
              +   +Y  +  Q  L+I + +L+DK  R  +S  + S ++ S  +LGQT+++++ I+
Sbjct: 284 TSIRLSSTYKAMDHQTLLKIADLVLQDK--RFLNSEDLLSTLIQSFGHLGQTQILERCIE 341

Query: 319 LKWGISED---GHVAVKNEAV-PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374
             W IS      HVA+K     P  ++LI+I+ ++ L + D  +GL ILD F+K YP+ +
Sbjct: 342 HIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVK 401

Query: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434
           L+ LFWRRLLQLS   W    DK+A     CW++MK W+E K +S + D  TLR LY++ 
Sbjct: 402 LDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVM 461

Query: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494
           K T N     +V+++  S +   +     K E  +L+ +QK  +K +  +G+ +   + I
Sbjct: 462 KKTGNFSLGIDVLKSFKSGIEKMRTANPEKLEA-ILIKYQKCIIKQLVNRGKISAARKFI 520

Query: 495 KEWNVDKINQHYLLDYFMRHR---RKYDLTRDXXXXXXX--XXXXXYDNMEEEDMLLGRL 549
            ++  ++      L+ F  +R   R   +  D              YD+ E++ M++G L
Sbjct: 521 GDFGFNR-RAAKDLNIFCSNRIFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIGSL 579

Query: 550 W 550
           W
Sbjct: 580 W 580

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  190 bits (483), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 112/409 (27%), Positives = 208/409 (50%), Gaps = 14/409 (3%)

Query: 124 KELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPL 183
           +E+S+ EFS F NR              IP+ +   +   LYQ Y   + ++ +   TP+
Sbjct: 95  QEMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPM 154

Query: 184 QVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKF 243
           ++HD+N+F   F++E +LK A++ LQ ++ + G   + +  D +T+  + QL  G+L   
Sbjct: 155 ELHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPR--DHQTLVTYFQLYLGSLASL 212

Query: 244 WRVDSNSTKVLGEDSKHFKSPK--SYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIV 301
           W      +    +  +  + PK   YN L E    +++  LL++  W+   S  +D+ I+
Sbjct: 213 WPTPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKIL 272

Query: 302 YSLSNLGQTKLIDQYIQLKWGI-------SEDGHVAVKNEAVPGHEVLINIVSAYCLKNG 354
           YSL +  +  L + +++  WGI        ++  V + +   PG EVLI IV+++  +N 
Sbjct: 273 YSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRN- 331

Query: 355 DTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHE 414
           D  K +R++D F+ KYPQ +L   FW +L   +   +D++ D    +   CW  M  W++
Sbjct: 332 DLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYK 391

Query: 415 QKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQ 474
            +G S+ Y S      Y++ K T N + A  +     S+VYAK     +K  + ++  +Q
Sbjct: 392 SRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKS--AAAKHNLTVVRKYQ 449

Query: 475 KLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRD 523
           K  ++ ++ +G+ +   Q I++W  ++ N+  L D F RH  KY + ++
Sbjct: 450 KFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQE 498

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  189 bits (481), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 198/366 (54%), Gaps = 27/366 (7%)

Query: 157 HTEIIFNLYQIYCTYV-IKDSQ-----NGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210
           ++E  F L+ +Y   V +K +Q       L   ++ D+N  IK FI+  QL KAQ+ L F
Sbjct: 167 YSEFWFKLFSLYAEKVDVKRNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSF 226

Query: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTKV-------LGEDSKH 260
           ++D+    +IL S    D+ TI  FLQLRCGAL  +W++  NS +        LG  +  
Sbjct: 227 ILDRNS--DILLSPKNADIGTIIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTS 284

Query: 261 FKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLK 320
            +   SY  +  Q  L+I + +L+ +  RL +S  + S ++ S  +LGQT+++++ I+  
Sbjct: 285 IRITSSYKAMDHQTLLKIADLVLQKE--RLLNSEDLLSTLIQSFGHLGQTQILERCIEHI 342

Query: 321 WGISED---GHVAVKNE---AVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374
           W IS      H  +K +     P  ++LI+I+ ++ L + D  +GL ILD F+K YP+ +
Sbjct: 343 WQISLQEFPSHATIKPKTRGCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVK 402

Query: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434
           +++LFWRRL QLS   W    DK+A     CW++MKQWHE KG S++ D  TLR LY L 
Sbjct: 403 VDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLT 462

Query: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494
           K T N     +V++  F     +     ++    +++  QK  +K +  +G+ +   + I
Sbjct: 463 KKTGNYSLGIDVLQN-FKPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFI 521

Query: 495 KEWNVD 500
            +++ D
Sbjct: 522 NDFSFD 527

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  186 bits (471), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 192/367 (52%), Gaps = 27/367 (7%)

Query: 157 HTEIIFNLYQIYCTYV------IKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQF 210
           ++E  F L+ +Y   V      +      L   ++ D N  IK FI+  QL KAQ+ L F
Sbjct: 166 YSEFWFKLFSLYAEKVDAKRNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSF 225

Query: 211 LIDKQGLHNILQS---GDVETITQFLQLRCGALQKFWRVDSNSTKV---------LGEDS 258
           ++D+    +IL S    D+ TI  FLQLRCGAL  +W++  NS +          LG  +
Sbjct: 226 ILDRNP--DILLSPKNADISTIVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKN 283

Query: 259 KHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQ 318
              +   +Y  +  Q  L+I +  L++K  +L +S  + S ++ S  +LGQT+++++ I+
Sbjct: 284 TSIRLSSTYKAMDHQTLLKIADLALQEK--KLLNSEDLLSTLIQSFGHLGQTQILERCIE 341

Query: 319 LKWGISED---GHVAVKNEAV-PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE 374
             W IS      HV +K+    P  ++L++I+ ++   + D  +GL ILD F+K YP  +
Sbjct: 342 HIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVK 401

Query: 375 LEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLF 434
           L+ LFWRRL QLS   W    DKKA     CW++MKQW+  K +  + D  TLR LY + 
Sbjct: 402 LDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIM 461

Query: 435 KFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLI 494
           K T N     +V+R+ F     +   + +    ++++ +QK  +K +  +GR++   + I
Sbjct: 462 KKTGNFPLGIDVLRS-FKPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFI 520

Query: 495 KEWNVDK 501
             +  D+
Sbjct: 521 DSYGFDR 527

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  155 bits (392), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 204/454 (44%), Gaps = 38/454 (8%)

Query: 120 LFETKELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNG 179
           L +   +S  EFS+ I             +N++    H   +  L QIY +     +   
Sbjct: 110 LLQDSNVSIQEFSSMIQ-------PVLNRTNLV-GKYHMGYLSKLMQIYISLTRTHNGGS 161

Query: 180 LTPLQVHDINRFIKRFIDEAQLKKAQECLQFLID---KQGLHNILQSGDVETITQFLQLR 236
           +  L   D+N+FIKRFI+ +QLK+AQ  LQFL+D   ++G   +   GD +TI  FL LR
Sbjct: 162 VDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLR 221

Query: 237 CGALQKFWRVD----SNSTKVLGE-DSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLR 291
            GALQ  W++D    +N  +   + +  H     +YN+L      EIV ++L+       
Sbjct: 222 SGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNH 281

Query: 292 SSPI-----IDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIV 346
           S P+     I   ++  L  +GQT LI+  I   W + +   V  K       ++L  IV
Sbjct: 282 SQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWEL-DSVSVPPKYNITVTSDLLTAIV 340

Query: 347 SAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSF---HNWDKQKDKKALVCH 403
           SAY         GL I D+F  K P   ++  FW  L + +    + W    D    +  
Sbjct: 341 SAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTID----LSK 396

Query: 404 GCWNIMKQWHE--QKGVSITYDSGTLRLLYQLFKFT----RNGRGAAEVVRTCFSSVYAK 457
             W +MK W      G  IT +   L L+Y++        ++     ++ +    ++Y+K
Sbjct: 397 RTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSK 456

Query: 458 QPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRK 517
               ++ DE+ LL  FQ   +K M   G Y++ LQ IKEW+ D  N+  L + F+  R +
Sbjct: 457 NS--LTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNR 514

Query: 518 YDLTRD-XXXXXXXXXXXXYDNMEEEDMLLGRLW 550
           Y   R              YD  E+EDMLLG LW
Sbjct: 515 YLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  151 bits (382), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/394 (27%), Positives = 189/394 (47%), Gaps = 35/394 (8%)

Query: 159 EIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLH 218
           EIIF L++ Y   +   S   LT LQV D+N+FI  F++  QLKKAQ  +++LI K    
Sbjct: 114 EIIFQLFETYVKLI--SSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSP-- 169

Query: 219 NILQSGDVETITQFLQLRCGALQKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQPFLEI 278
            +L+  DV T   +L+L CGA  + W  +    K+   ++        Y+L  +  +   
Sbjct: 170 RVLEKYDVSTTRNYLKLNCGACHELWYTNY---KIFDFNNTTLDKLVKYSLDNKIGY--- 223

Query: 279 VNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGIS--EDGHVAVKNEAV 336
                    W        D  I++SL   G+ + ++ YI  KWGIS  +   V   NEA 
Sbjct: 224 ---------W--------DVEIIHSLGYSGRIRSLEDYILKKWGISLCDRAQVNTTNEA- 265

Query: 337 PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKD 396
           P  EVL  I++ +  ++    + ++IL++F+  YP   L+  FW+  +      WD++ D
Sbjct: 266 PESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVD 325

Query: 397 KKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYA 456
           +K +V    W  MK+W+      I ++   L+++   FK   N   A ++ + CF + Y 
Sbjct: 326 QKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYF 385

Query: 457 KQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRR 516
               +++  E++++  +Q   L  +  K  ++  L  I +      N+  L++Y+   R+
Sbjct: 386 CAT-RMNDSELNVIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYY-HGRK 443

Query: 517 KYDLTRDXXXXXXXXXXXXYDNMEEEDMLLGRLW 550
           ++ L +             YD+M EED ++G+LW
Sbjct: 444 EHKLKK---MTRNENLEKTYDDMVEEDFIIGKLW 474

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  145 bits (367), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 125/437 (28%), Positives = 205/437 (46%), Gaps = 51/437 (11%)

Query: 159 EIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDK-QGL 217
           E+IF+L+ I C     ++ N L PL V+D+N+FIK F+ E QLKKAQ  L ++ID+  G+
Sbjct: 194 EVIFSLFNI-CKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGI 252

Query: 218 HNILQSGDVETITQFLQLRCGALQKFWR--VDSNSTKVLG-----EDSKH-FKSPKSYNL 269
             +++S D+ T+   L+L+ GA+ K W+   DS S   L      ED  H FK  K+Y  
Sbjct: 253 EQLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKF 312

Query: 270 LKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHV 329
           L     L+I++ +L DK+  L    I++ +I+YSL  L Q + ++ +I+  W +  D  V
Sbjct: 313 LDGWSLLKIIDMVLTDKTHCLN---ILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAV 369

Query: 330 AVKNEAV------PGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKL----F 379
             +N  +      P    LI I+++YC       +   +LD+ ++KYP+    +L    F
Sbjct: 370 EERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKF 429

Query: 380 WRRLLQLSFHNWDKQKDK-KALVCHGCWNIMKQWH---------EQKGVSITYDSGTLRL 429
           W ++LQ      DK  +         C  IM++W          E   +   Y S  + L
Sbjct: 430 WIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINL 489

Query: 430 LYQLFKFTRN---GRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGR 486
           L+ + K  +N   G  A E            + Y+  ++   +L   QK   + +A  G 
Sbjct: 490 LHNIMKERKNVDIGLKAIENFVQKLKLGSVNKYYE--RNLTHVLYGLQKCIFRKIAESGS 547

Query: 487 YNEPLQLIKE--WNVDKINQHYLLDYFM---------RHRRKYDLT--RDXXXXXXXXXX 533
           YN+ L LI    +  +   +  L +Y++         R RR    +  +D          
Sbjct: 548 YNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEKLQ 607

Query: 534 XXYDNMEEEDMLLGRLW 550
             YD +EEE M++G+LW
Sbjct: 608 QKYDEIEEEGMIIGKLW 624

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/405 (24%), Positives = 186/405 (45%), Gaps = 25/405 (6%)

Query: 121 FETKELSTSEFSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGL 180
           +  ++L+  ++S F+N+            N       TE+  +LY IY  +V+    +G 
Sbjct: 92  YSNEKLTPEDYSVFVNQLMDVYSKDIELLN------KTEVWKSLYHIYRVFVVNAVDDG- 144

Query: 181 TPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGAL 240
             + ++D+N+F++ FI+   L  A+   Q ++       I +  DV+TI  +L+L CGAL
Sbjct: 145 NAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPK--DVQTICMYLRLYCGAL 202

Query: 241 QKFWRVDSNST-------KVLGEDSKHFKSPK--SYNLLKEQPFLEIVNFLLKDKSWRLR 291
            + W   ++          + G ++   + P   +Y  +    F  ++  L++D  +   
Sbjct: 203 SELWTTQTSRNFYQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKL 262

Query: 292 SSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISE-----DGHVAVKNEAVPGHEVLINIV 346
            +  +DS I+ +L +  +   + QYI + +GI E     + H  +K +  P  ++L +++
Sbjct: 263 RNTEMDSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIK-KLTPDSQLLKSVI 321

Query: 347 SAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCW 406
           SAY   N  T  G+ ++  FM+KYP+  L+K FWR  +  S   W+K KD K       W
Sbjct: 322 SAYGHNNNITS-GMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKKAW 380

Query: 407 NIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDE 466
           N+M  W+   G ++ +D   +       K  ++   A   V+  F  ++ K        E
Sbjct: 381 NLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVE 440

Query: 467 MDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYF 511
             +L  +Q+  +K +  +    + +  I EW +D  N  YL  YF
Sbjct: 441 RLVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYF 485

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  140 bits (352), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/475 (25%), Positives = 213/475 (44%), Gaps = 66/475 (13%)

Query: 97  KEYVDFLI--HVMVQNHLNRNYIKSLFETKELSTSEFSTFINRXXXXXXXXXXXSNIIPD 154
           K++VD LI  H +    LN+         K L+    S  IN            S+ +  
Sbjct: 126 KKFVDELIQWHYLDAKALNK------LVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSF 179

Query: 155 TVHTEIIFNLYQIYCTYV---IKDSQNG-------------LTPLQVHDINRFIKRFIDE 198
             H+E+IF +YQIY   +   I +S N              L P+Q++D+N+ I  FI  
Sbjct: 180 KSHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKA 239

Query: 199 AQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKV----- 253
            QLKKA   L +++ +     I Q  D +TI  FL+L CG L   WR++  + +      
Sbjct: 240 GQLKKATTALMYILKRYNAE-IFQIPDSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQG 298

Query: 254 -----LGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKD--------KSWRLRSSPIIDSAI 300
                LG +S +++ P SY  + E+  ++IV  + K+        K +    +   DS +
Sbjct: 299 KRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTL 358

Query: 301 VYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDT-GKG 359
           +YSL++LG+  L +QY +  W       V + +      +++I I S+Y   N +   K 
Sbjct: 359 IYSLTSLGRFDLAEQYFKDNWLSDSCDDVELTS------DIVIAIFSSYVYNNSNNIEKA 412

Query: 360 LRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQ---- 415
            +++ + +K+YP   L    W R+++ +   WD   D    + +  +  M  ++      
Sbjct: 413 NKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSR 472

Query: 416 ----KGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLL 471
               K   I Y+   L  LY LF    +      ++  CF     K P +++  +  +LL
Sbjct: 473 NSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILL 532

Query: 472 MFQKLALKTMA--LKGRYNEPLQLIKEWNVDKINQHYLLDY------FMRHRRKY 518
            +QK+ LK +    K   N+PL  I+++++D  N+  LL+Y      + + R++Y
Sbjct: 533 KYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEYRLERLEYRKSRKEY 587

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/398 (25%), Positives = 194/398 (48%), Gaps = 25/398 (6%)

Query: 156 VHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDK- 214
           V+  ++F L++IY        +  L  LQ++D+N+ IK FI   QLK+ Q  L F+I K 
Sbjct: 120 VNVNVVFQLFEIYARMYC--GEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKY 177

Query: 215 QGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQP 274
            G+ N++   D+ ++   L+L+ G+L K W+ +  + + L           +Y  L    
Sbjct: 178 GGIENMIAHRDLISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRL----NYKFLDGWS 233

Query: 275 FLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNE 334
            L+I + +L D    ++   ++ ++I+YSL +L Q +L+D +I   W         +   
Sbjct: 234 LLKIADLVLNDP---MKCQNVLTNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGL--- 287

Query: 335 AVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQ 394
             P    +I I+++YC   G+  K   +LD+ ++KY   + +K FWRRL Q       + 
Sbjct: 288 LYPDTNNIIAIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILT--EP 345

Query: 395 KDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSV 454
              K  +   CW++M     +K   + +D   L LL +     R+   A  V++     +
Sbjct: 346 NANKGFILGQCWSLM-----EKQEKVEFDGVLLELLREKIVKVRDVPLALRVLKMIV--I 398

Query: 455 YAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIK--EWNVDKINQHYLLDYFM 512
             K+   I++ +M+LLL +QK     +    +  + ++L+   ++ ++K N+ ++  Y+ 
Sbjct: 399 ELKKVNFINELDMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYYF 458

Query: 513 RHRRKYDLTRDXXXXXXXXXXXXYDNMEEEDMLLGRLW 550
            ++R+    ++            YD M+EEDM++G+LW
Sbjct: 459 ENKREK-RKKNKRSNQYDDLQRKYDEMDEEDMIIGKLW 495

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 157/364 (43%), Gaps = 42/364 (11%)

Query: 159 EIIFNLYQIYCTY--VIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQG 216
           E +   + I+  Y   I    N LT +Q+HD N     FI   QLKKAQ  + FL+ +  
Sbjct: 110 ENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDV 169

Query: 217 LHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQPFL 276
                   DV  I  + +LRCG+                   K   + K+Y +  +    
Sbjct: 170 ------KFDVFMIKNYTKLRCGS----------------SFGKQTLNNKAYKVFDQNTVF 207

Query: 277 EIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGIS---------EDG 327
           +++  +  D     R     ++ IV SL       L++ YI   W IS         +  
Sbjct: 208 QLIGKVEAD-----RKFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKID 262

Query: 328 HVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLS 387
           H+   +   P  +VL  IVS+Y   +    + + I+++F K YP+  L   FW  LL  +
Sbjct: 263 HLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCA 322

Query: 388 FHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVV 447
                 +   + L    CWN+MK+WH Q+   + + S  L  + +  + T N  G  +++
Sbjct: 323 IKCGGSKDPSQFL---ACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDIL 379

Query: 448 RTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYL 507
           +     +Y K+   I + E D+L+ +QK  L+ +  K +YN     I +W++D  N+  L
Sbjct: 380 QYWLGPLYLKRG-NIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDL 438

Query: 508 LDYF 511
             ++
Sbjct: 439 EAFY 442

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 157/387 (40%), Gaps = 15/387 (3%)

Query: 131 FSTFINRXXXXXXXXXXXSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINR 190
           FS FI+R            +++       ++  LY  Y            +P ++HD N 
Sbjct: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192

Query: 191 FIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNS 250
           F + F+ E++L+ A+     L+        L   D ETI   LQL  GA   FWR   NS
Sbjct: 193 FARWFMAESKLRLARTVFAELVGNPTELAKLPR-DTETIITLLQLHLGAKHIFWRDPGNS 251

Query: 251 TKVLGE--DSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLG 308
               G+     H     +YN L E+  L ++  L  D  W+   SP +D  I+ +L+   
Sbjct: 252 VGRGGQLFTPAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDLDRNIILALAFHN 311

Query: 309 QTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMK 368
           +  L+       +  +  GH       +P   ++  +V+A+  K+    +GL I  QF+ 
Sbjct: 312 RLDLVHAQAARYYAPAAPGHGLPSTPLLPDGALVGAVVTAFAFKH-QLAQGLAIAYQFLD 370

Query: 369 KYPQTELEKLFWRRLLQLSFHNWDKQK----DKKALVCHGCWNIMKQWHEQKGVSITYDS 424
           ++     E   W+ +       W  ++     + A +    W+ M+  + + G    YD 
Sbjct: 371 RFTHLPNEHELWKIIF-----TWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDY 425

Query: 425 GTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALK 484
              R  Y++ +   + R    ++    S +Y +QP    +D + LLL  Q   +  +   
Sbjct: 426 SIARASYRIVRRDSSLRRVRALLNDYMSPLY-QQPAVAPRDRL-LLLKCQAHIVGRLVRA 483

Query: 485 GRYNEPLQLIKEWNVDKINQHYLLDYF 511
            R +     + +W +D   + +LL++ 
Sbjct: 484 RRNSAAADFVDQWALDSEARSHLLEHI 510

>Kwal_27.11978 s27 (1030513..1030935) [423 bp, 140 aa] {OFF}
          [contig 26] FULL
          Length = 140

 Score = 31.6 bits (70), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 6  HSIQQVFKAFNSTLSVDYAAAQASIVGAPVKHEE-----RHTQTLTSSSI 50
          HSI+++     S  S   ++A+A  +G+PV HEE      H+   ++SS+
Sbjct: 2  HSIEEISSFLCSIRSASLSSARALTLGSPVDHEELNAFSAHSTAYSTSSL 51

>TDEL0H00980 Chr8 (159829..172068) [12240 bp, 4079 aa] {ON}
           Anc_1.216 YKR054C
          Length = 4079

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 179 GLTPLQVHDINRF---IKRFIDEAQLKKAQECLQFL-IDKQGLHNILQSGDVETITQFLQ 234
           G+T LQ   +N     + R I+E  L K +E L+ + + +Q L   L+   +    + +Q
Sbjct: 809 GMTTLQFETLNELTSLLNRHIEEIILSKTREELRSMQLGRQALVVTLKGTSLSCSPELIQ 868

Query: 235 LRCGALQKFWRVDSNSTKVLGEDSKHFKSPKS 266
           ++   ++K  ++    TKV G+   H KS K+
Sbjct: 869 IKSSWIKKIEQI---VTKVAGQPKIHLKSSKA 897

>TPHA0B00610 Chr2 complement(139975..143637) [3663 bp, 1220 aa] {ON}
            Anc_4.305 YLR425W
          Length = 1220

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 162  FNLYQIYCTYVIKDSQNGLTPLQVHDINRFIKRFI 196
            F  Y+IY  Y++  S + L  L++HDI  F K FI
Sbjct: 991  FKFYKIYKKYLLPISTSSLLTLEIHDIVVFKKSFI 1025

>Kwal_56.23124 s56 complement(409746..412085) [2340 bp, 779 aa] {ON}
           YOL076W (MDM20) - involved in mitochondrial inheritance
           and actin assembly [contig 183] FULL
          Length = 779

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 61/147 (41%), Gaps = 20/147 (13%)

Query: 277 EIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQL-----KWGISEDGHVAV 331
           EI+  L   K   LR++  +   +V   S+    K+++QY++      K+         +
Sbjct: 7   EIIELL---KRGNLRAAQQLARKLVTQFSSASYPKVLEQYVKFRQNKQKYSYESGLEPLL 63

Query: 332 KNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTE---------LEKLFWRR 382
           K  + P     ++++  + L+ G   + L +    M+KYP  E         +E +  ++
Sbjct: 64  KATSPPSDARSLSLLHTFLLELGRLDEVLNVYGAAMQKYPNLETGCNWFVKAIEDMNLKQ 123

Query: 383 LLQLSFHNWDKQKDKKALVCHGCWNIM 409
           ++Q SF       D + L     WN M
Sbjct: 124 MVQASFQMRRLSSDPRML---QFWNAM 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,843,310
Number of extensions: 2389366
Number of successful extensions: 6439
Number of sequences better than 10.0: 32
Number of HSP's gapped: 6536
Number of HSP's successfully gapped: 32
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)