Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0B001808.849ON58258230770.0
ZYRO0C14850g8.849ON59457519900.0
SAKL0D01188g8.849ON58156816860.0
Skud_13.4578.849ON60257116820.0
Suva_13.4748.849ON60258216800.0
NCAS0C003208.849ON60859016810.0
Smik_13.5008.849ON60256016770.0
YMR284W (YKU70)8.849ON60256816710.0
NDAI0K003608.849ON62059716510.0
KAFR0L019508.849ON58856716120.0
Kwal_27.101998.849ON57256815970.0
TPHA0I003108.849ON60858115750.0
KLTH0C03586g8.849ON57856715400.0
KNAG0M02650singletonON57456615080.0
KLLA0C06226g8.849ON59257314600.0
Kpol_1068.18.849ON51447514390.0
TBLA0B028908.849ON64861713610.0
CAGL0I02662g8.849ON60656913451e-180
AFR443CsingletonON57657211181e-146
Ecym_46208.849ON5975509641e-122
ABL117C8.849ON6025627141e-85
Suva_13.4778.853ON969173761.2
CAGL0L03377g1.277ON120999751.7
TPHA0F013602.233ON1022144742.6
NCAS0D017105.133ON37150714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0B00180
         (582 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...  1189   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   771   0.0  
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   654   0.0  
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   652   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   651   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   652   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   650   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   648   0.0  
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     640   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   625   0.0  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   619   0.0  
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   611   0.0  
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   597   0.0  
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   585   0.0  
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   566   0.0  
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   558   0.0  
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   528   0.0  
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   522   e-180
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   435   e-146
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   375   e-122
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   279   1e-85
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...    34   1.2  
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    33   1.7  
TPHA0F01360 Chr6 complement(314026..317094) [3069 bp, 1022 aa] {...    33   2.6  
NCAS0D01710 Chr4 (321870..322985) [1116 bp, 371 aa] {ON} Anc_5.133     32   4.7  

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score = 1189 bits (3077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/582 (100%), Positives = 582/582 (100%)

Query: 1   MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS 60
           MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS
Sbjct: 1   MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS 60

Query: 61  QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ 120
           QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ
Sbjct: 61  QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ 120

Query: 121 FLPYDASKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLR 180
           FLPYDASKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLR
Sbjct: 121 FLPYDASKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLR 180

Query: 181 HLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIK 240
           HLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIK
Sbjct: 181 HLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIK 240

Query: 241 SRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFS 300
           SRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFS
Sbjct: 241 SRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFS 300

Query: 301 RRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETC 360
           RRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETC
Sbjct: 301 RRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETC 360

Query: 361 LHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVP 420
           LHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVP
Sbjct: 361 LHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVP 420

Query: 421 SDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFE 480
           SDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFE
Sbjct: 421 SDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFE 480

Query: 481 PSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESA 540
           PSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESA
Sbjct: 481 PSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESA 540

Query: 541 NSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKGL 582
           NSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKGL
Sbjct: 541 NSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKGL 582

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/575 (63%), Positives = 460/575 (80%), Gaps = 2/575 (0%)

Query: 7   NEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITR 66
           +++ T  K YR+Y++HEGIIFCIELS GMF EL ELNYK+QL+EILETL+QLMSQLVI R
Sbjct: 15  DKQHTQSKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVR 74

Query: 67  PSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDA 126
           P TGIGCYF+NCN+ DAK+ IY F PL+D+NA++MKKLSDLL+DL  +R TL++FLPYD 
Sbjct: 75  PGTGIGCYFYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLPYDE 134

Query: 127 SKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDL 186
           S+ TPL+ L   +++EF+K+V  QKAFNNKK+F FTDNDSPPEA D + KSRLRHLV+D+
Sbjct: 135 SERTPLDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRHLVDDM 194

Query: 187 DDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTK-ASDEFDGPNTTPISAAYIKSRVLR 245
           DD FINFTTFFIGK   PFD+ FYSD+L+LGAT +  + EFDGPNTTPISA+YIKSRVLR
Sbjct: 195 DDHFINFTTFFIGKEEAPFDDSFYSDVLKLGATAEDPNTEFDGPNTTPISASYIKSRVLR 254

Query: 246 KQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYL 305
           KQE+KRIMFQC LILEE+ +F+VG+KGYTII  E+PG RY+LVYE +++R+EA S+RK+L
Sbjct: 255 KQEVKRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFL 314

Query: 306 NAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYN 365
           ++ TGE I++GLTKV+PYGDLDI +++ ++ E+R  Y  EESFLK+IGF+    C+HY+N
Sbjct: 315 DSNTGEVIEEGLTKVFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFN 374

Query: 366 NIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEAS 425
           NI++A FVVPDE R+EGSIRTL+SLFKNLR K KVA+VWGKLK+NS+PA+F   PS    
Sbjct: 375 NIDRALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRNED 434

Query: 426 PNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFK 485
           PNEGFYLYR+PF +ELRR P  LI H      +Y  LK+ TK +I+HF    G+ PSEF+
Sbjct: 435 PNEGFYLYRIPFAEELRRFPQSLIRHNSYDTPEYNQLKDTTKSIIDHFQFAKGYRPSEFR 494

Query: 486 NPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDP 545
           NP LQKHFKILHDYLLQ+E+E E D  E  + +LL EDDSL +++QIRDKI +SA S DP
Sbjct: 495 NPDLQKHFKILHDYLLQVEQEEEDDSPESSKQRLLSEDDSLLKLAQIRDKIMDSAQSSDP 554

Query: 546 NKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKK 580
            K +L +Y  +WN LY+ +  + T + DAP+ K K
Sbjct: 555 KKFQLDEYFQLWNRLYEDV-SKATTLEDAPRPKPK 588

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/568 (54%), Positives = 427/568 (75%), Gaps = 8/568 (1%)

Query: 16  YRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYF 75
           Y++Y++H GI+FCIEL++ M+ ++ ELN+KIQL+EILE+L +LMSQL++T P+TG+GCYF
Sbjct: 19  YKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYF 78

Query: 76  FNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESL 135
           F CN+ +++ GIY FLPLKDVNA+ MKKL+DLLEDLQ++R TL +  P+  S    LES+
Sbjct: 79  FQCNKDNSEHGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESV 138

Query: 136 LELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTT 195
           L  +RE+F+K++P++KA+NN K+F FTDN  P    +++++S LR +VNDL+D +INFT 
Sbjct: 139 LVFLREQFIKELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTP 198

Query: 196 FFIGKPGLPFDEGFYSDILRLGATTK---ASDEFDGPNTTPISAAYIKSRVLRKQEIKRI 252
           FFI     PFD+ FYSDIL+L A T     S+ FDGPNTTPI A+YIKSRV RK+E +R+
Sbjct: 199 FFIDTEEKPFDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRV 258

Query: 253 MFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEE 312
            FQCPLIL++++ F + +KGYTIISHEKPG RYKLVYENE +R+EAFS R+YL+A TG +
Sbjct: 259 KFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVD 318

Query: 313 IKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATF 372
           + D + K++PYGD +IELS+ D+A++        SFLK+IGF+ST+ CL YYNN++K  F
Sbjct: 319 VSDKVAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAF 378

Query: 373 VVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYL 432
           VVPDE  YEGSIR ++SL++NLR K K A+VWGKLK NSNP I+   PS E  PNEGFYL
Sbjct: 379 VVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYL 438

Query: 433 YRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKH 492
            R+PF+DE+RR P +      +   DY ++ +AT+ +I +FNL+NG++PSEFKNPGLQ +
Sbjct: 439 TRIPFIDEIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHY 498

Query: 493 FKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSK 552
           F +LHD LL+ +EE   D  E Q S    +DD+L ++SQIRDKI ES+ S +P +Q+LSK
Sbjct: 499 FSLLHDQLLEAKEESSAD--EEQESL---KDDTLLKLSQIRDKIIESSKSDEPGRQRLSK 553

Query: 553 YLAIWNSLYDKIFDQETAIADAPKTKKK 580
           Y   WN+LY+K ++Q  +     K  K+
Sbjct: 554 YFKGWNTLYNKEYNQHLSFECGEKKTKR 581

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/571 (54%), Positives = 421/571 (73%), Gaps = 9/571 (1%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
           GYR++DIHEGI+FC+ELS  MF E  EL+YK  L+EILE+L++LMSQLVITRP T IGCY
Sbjct: 22  GYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81

Query: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ---FLPYDASKHTP 131
           F+ C+R DAK GI+ F PL+D+NA  MK+L+DLLEDL   R TL +   F P +  +  P
Sbjct: 82  FYYCSRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPTEKQRQMP 141

Query: 132 LESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFI 191
           L  L   + + F++D+P Q+  ++KK+F FTDND P EA D D ++RLR L  DL D  +
Sbjct: 142 LGVLFTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLTIDLFDNKV 201

Query: 192 NFTTFFIGKPGLPFDEGFYSDILRLGATTKA----SDEFDGPNTTPISAAYIKSRVLRKQ 247
           NF+TFFIG     FD  FYSDIL+LG+ T      + EFDGPNT PI+A YIKS++LRK+
Sbjct: 202 NFSTFFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPINAKYIKSKILRKK 261

Query: 248 EIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNA 307
           EIKRIMFQCPL+  E   F VGVKGYT+ SHEK GVRYKLVYE+ED+R+EAFS+RK+LN 
Sbjct: 262 EIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKFLNP 321

Query: 308 KTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNI 367
            TGE++     KVYPYGDLDI  SE+    +   Y  +++FL++IGF+S+   +HY+NNI
Sbjct: 322 MTGEDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHYFNNI 381

Query: 368 EKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPN 427
           EK+ F+VPDE +YEGS+RTL+SLFK LR+K+K+AI+WGKLK+NS+ ++F   PS     N
Sbjct: 382 EKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSSIKEYN 441

Query: 428 EGFYLYRVPFLDELRRIPPML-ISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKN 486
           EGFYLYRVPFLDE+R+ P +L   +GE    DYEN+K+ T+ ++ +FNLK+G+ PS+F+N
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLLSYDNGEKYKLDYENMKKITQNIMGYFNLKDGYNPSDFRN 501

Query: 487 PGLQKHFKILHDYLLQIEEEPEKDDV-EWQRSKLLEEDDSLRRISQIRDKIDESANSKDP 545
           P LQKHFK+LHDYLLQIE  PE ++  + + ++++ EDDSLR++  IR+KI +S  S+DP
Sbjct: 502 PSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLRKLYHIRNKILDSEKSEDP 561

Query: 546 NKQKLSKYLAIWNSLYDKIFDQETAIADAPK 576
             Q+L+KY+ IWN  Y+K  D   ++ +  K
Sbjct: 562 AIQRLNKYVKIWNVFYNKFNDDSISVKEEKK 592

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/582 (54%), Positives = 422/582 (72%), Gaps = 9/582 (1%)

Query: 1   MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS 60
            + + S  + T    YR++DIHEGI+FCIELS  MF E PELNYK  L+EILE+L++LMS
Sbjct: 8   FNSIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMS 67

Query: 61  QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ 120
           QLVITRP T IGCYF+ C R DAK+GIY   PL+D+NA+ MK L+DLLED+   R TL +
Sbjct: 68  QLVITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFE 127

Query: 121 FLPYDASK---HTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKS 177
           +  +  S+     PL  L   + + F++D+P QK  ++KKIF FTDND P E+ D D ++
Sbjct: 128 YFNFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERA 187

Query: 178 RLRHLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGA-TTKASD---EFDGPNTTP 233
           RLR L  DL D  +NF TFFIG     FD  FYSDIL+LG+   K  D   EFDGPNT P
Sbjct: 188 RLRRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKP 247

Query: 234 ISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENED 293
           I A YIKS++LRK+E+KRI FQCPLI +E + FI+GVKGYT+ SHEK GVRYKLVYE+ED
Sbjct: 248 IDAKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHED 307

Query: 294 IRQEAFSRRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIG 353
           IRQEA+S+RK+LN  TG ++     KVYPYGDLDI LSE     I   Y  ++ FL++IG
Sbjct: 308 IRQEAYSKRKFLNPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIG 367

Query: 354 FQSTETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNP 413
           F+S  + +HY+NNIEK+TF+VPDE +YEGSIRTL+SL K LR+K+KVAIVWGKLKSNS+P
Sbjct: 368 FRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHP 427

Query: 414 AIFFFVPSDEASPNEGFYLYRVPFLDELRRIPPML-ISHGEIQDDDYENLKEATKKLINH 472
           ++F   PS     NEGFYLYR+PFLDE+R+ P +L    GE  + +Y+N+K  ++ ++ +
Sbjct: 428 SLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEKHELEYDNMKRISQSIMGY 487

Query: 473 FNLKNGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQR-SKLLEEDDSLRRISQ 531
           FNL++G+ PS+FKNP LQ+HFK+LHDYLLQIE   E+++    R ++++ EDDSLR++  
Sbjct: 488 FNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYH 547

Query: 532 IRDKIDESANSKDPNKQKLSKYLAIWNSLYDKIFDQETAIAD 573
           IR+KI ES  S+DP  Q+L+KY+ IWN+ Y+K  D   ++ D
Sbjct: 548 IRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNISVKD 589

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/590 (54%), Positives = 431/590 (73%), Gaps = 23/590 (3%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
            +++YDIHEGIIFCIELS  MF+E+PELNYK+QL+EILE+L +LMSQLVI RPSTGIGCY
Sbjct: 13  SFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCY 72

Query: 75  FFNCNR--SDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYD------A 126
           F  C+R   D+K+GIY F PL+DVNA+ MKK+SDL+EDL  +R TL ++  +D      +
Sbjct: 73  FHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDS 132

Query: 127 SKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDL 186
            K  PLE+L   + ++F K   D   +++KKIF FTDNDSP E +D DA  R+R +V+D+
Sbjct: 133 QKRVPLETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDM 192

Query: 187 DDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASD-------------EFDGPNTTP 233
           +D +INF TFFIG+ G PF   FYS+IL+LG+     +             E+DGPNTTP
Sbjct: 193 NDNYINFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGPNTTP 252

Query: 234 ISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENED 293
           I A+YIKS++LRK+EIKR MFQCPLIL+E++ FIV V+GY I++ EKP  RYKLVYE+E+
Sbjct: 253 IPASYIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHEN 312

Query: 294 IRQEAFSRRKYLNAKTGEEIK-DGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVI 352
           IR+EA SRRK+LN  TGEEIK D L KV+PYGD DIEL++ ++A+I +DY+  ESFLKVI
Sbjct: 313 IRKEASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVI 372

Query: 353 GFQSTETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSN 412
           GF+ST+  + Y+NNI+KA FVVPDE +YEG+I+T++SLF+ L++++K  IVWGK+KSNSN
Sbjct: 373 GFRSTKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSN 432

Query: 413 PAIFFFVPSDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINH 472
             ++   P+     NEGFYLYR+PFLDE+R+ P +L  +     +DY NL   T+ +I +
Sbjct: 433 LRLYILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGY 492

Query: 473 FNLKNGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKD-DVEWQRSKLLEEDDSLRRISQ 531
           FNLK G+ PS+FKNP LQ+H+K LHDYLLQ+E+   +D D + Q S+ L+EDD+L +I  
Sbjct: 493 FNLKKGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILH 552

Query: 532 IRDKIDESANSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKG 581
           IR+KI  S  S D  +Q+LSKY+++WN+ Y K+  +     D     KKG
Sbjct: 553 IREKIIASKESDDVTQQRLSKYVSLWNTFYIKMEKESGIDIDTSHKLKKG 602

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/560 (56%), Positives = 413/560 (73%), Gaps = 13/560 (2%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
           GYR++D+HEGI+FC+ELS  MF E  EL+YK  L+EILE+L++LMSQLVITRP T IGCY
Sbjct: 22  GYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCY 81

Query: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDAS---KHTP 131
           F+ C R DAK+GIY   PL+D+N + MKKL+DLLEDL  ER TL ++  +  +   K  P
Sbjct: 82  FYYCYRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMP 141

Query: 132 LESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFI 191
           L SL   + + F++D   QK  NNK++F FTDND P EA + D ++RLR L  DL D  I
Sbjct: 142 LASLFTFILDTFLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKI 201

Query: 192 NFTTFFIGKPGLPFDEGFYSDILRLGA----TTKASDEFDGPNTTPISAAYIKSRVLRKQ 247
           NFTTFFIG     FD  FYSDIL+LG+    T   + EFDGPNT PI A YIKSR+LRK+
Sbjct: 202 NFTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKR 261

Query: 248 EIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNA 307
           E+KRIMFQC LI +EK+ FI+G+KGYT+ SHEK GVRYKLVYE+EDIRQEA+S+RK+LN 
Sbjct: 262 EVKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNF 321

Query: 308 KTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNI 367
            +GE++ D   KVYPYGDLDI LSE     +   Y  +++FLK+ GF+S+   +HY+NNI
Sbjct: 322 MSGEDVTDNTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381

Query: 368 EKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPN 427
           EK++F+VPDE +YEGSIR L+SL K LR+K+K+AI+WGKLKSNS+P++F   PS+    N
Sbjct: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441

Query: 428 EGFYLYRVPFLDELRRIPPML-ISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKN 486
           EGFYLYRVPFLDE+R+ P +L    G   + DY+N+K+ T+ +I +FNL++G+ PS+FKN
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSDHEIDYDNMKKVTQSIIGYFNLRDGYNPSDFKN 501

Query: 487 PGLQKHFKILHDYLLQIE---EEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSK 543
           P LQKH+K+LHDYLLQ E   EE E  D +  R  ++ EDDSLR++  IR+KI ES  S+
Sbjct: 502 PLLQKHYKVLHDYLLQTETAFEENETSDTKMDR--IVHEDDSLRKLYHIRNKILESEKSE 559

Query: 544 DPNKQKLSKYLAIWNSLYDK 563
           DP  Q+L+KY+ IWN  Y K
Sbjct: 560 DPAIQRLNKYVKIWNMFYKK 579

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/568 (55%), Positives = 419/568 (73%), Gaps = 9/568 (1%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
           GYR++DIHEGI+FCIELS  MF E  +L YK  L+EILE+LD+LMSQLVITRP T IGCY
Sbjct: 22  GYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCY 81

Query: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDAS---KHTP 131
           F+ CNR DAK+GIY   PL+D+NA  MKKL+DLLEDL   R +L  +  +  +   K   
Sbjct: 82  FYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVR 141

Query: 132 LESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFI 191
           L  L   + + F++++P QK  +NK++F FTD D P EA DID ++RLR L  DL D  +
Sbjct: 142 LSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKV 201

Query: 192 NFTTFFIGKPGLPFDEGFYSDILRLGATTKAS----DEFDGPNTTPISAAYIKSRVLRKQ 247
           NF TFFIG    PFD  FYSDIL+LG+ T  +     EFDGP+T PI A YIKSR+LRK+
Sbjct: 202 NFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRILRKK 261

Query: 248 EIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNA 307
           E+KRIMFQCPLIL+EK+ FIVGVKGYT+ +HEK GVRYKLVYE+EDIRQEA+S+RK+LN 
Sbjct: 262 EVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNP 321

Query: 308 KTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNI 367
            TGE++     KVYPYGDLDI LS+S    +   Y  +++FLK+IGF+S+   +HY+NNI
Sbjct: 322 ITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNI 381

Query: 368 EKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPN 427
           +K++F+VPDE +YEGSIRTL+SL K LR+K+K+AI+WGKLKSNS+P+++   PS     N
Sbjct: 382 DKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYN 441

Query: 428 EGFYLYRVPFLDELRRIPPML-ISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKN 486
           EGFYLYRVPFLDE+R+ P +L    G     DY+N+K+ T+ ++ +FNL++G+ PS+FKN
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSDFKN 501

Query: 487 PGLQKHFKILHDYLLQIEEEPEKDDV-EWQRSKLLEEDDSLRRISQIRDKIDESANSKDP 545
           P LQKH+K+LHDYLLQIE   ++++    ++ +++ EDDSLR++  IR+KI ES  S+DP
Sbjct: 502 PLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRNKILESEKSEDP 561

Query: 546 NKQKLSKYLAIWNSLYDKIFDQETAIAD 573
             Q+L+KY+ IWN  Y K  D   +I +
Sbjct: 562 IIQRLNKYVKIWNMFYKKFNDDNISIKE 589

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/597 (52%), Positives = 430/597 (72%), Gaps = 28/597 (4%)

Query: 11  TPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTG 70
            P   Y++YDIHEGIIFCIELS  MF E+PELNY +QL+EILE+L +LMS LVI RPSTG
Sbjct: 20  APSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTG 79

Query: 71  IGCYFFNCNRSDAK---------DGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQF 121
           +GCY   CN+ D           DGIY   PL+DVNA  MKKLSDL EDLQ+ER TL ++
Sbjct: 80  VGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKY 139

Query: 122 LPYDA----SKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKS 177
             +D      K  PLE L   + ++F     D+ +++++KIF FTDNDSP E+ + +AK 
Sbjct: 140 FQFDNDENFKKQVPLEKLFGFLLDKFTLANVDRNSYHSRKIFLFTDNDSPIESEEHEAKL 199

Query: 178 RLRHLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASD------------- 224
           R+R LV+D++D +INFTTFFIG P  PFD+ FYSD+L+LGA T+ +              
Sbjct: 200 RIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYS 259

Query: 225 EFDGPNTTPISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVR 284
           EFDGPNT PI A YIKSR+LRK+EIKRI FQ PLIL E ++FI+G++GY + SHEKP  R
Sbjct: 260 EFDGPNTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTR 319

Query: 285 YKLVYENEDIRQEAFSRRKYLNAKTGEEIK-DGLTKVYPYGDLDIELSESDIAEIRNDYA 343
           YKLVYE E++R+EAFS RKYLN  TGEE++ D   K++PYGD++IEL++ ++ ++  + +
Sbjct: 320 YKLVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEIS 379

Query: 344 GEESFLKVIGFQSTETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIV 403
             E+FLK+IGF+S   CL+Y+NNI   TFVVPDE +YEGSIRT++SLF+ L++K+KVAI+
Sbjct: 380 CPEAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAII 439

Query: 404 WGKLKSNSNPAIFFFVPSDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLK 463
           WGK+K+NS P ++   P+  +  NEGFYLYR+PFL+E+R+ P +L       + DY NL 
Sbjct: 440 WGKMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLI 499

Query: 464 EATKKLINHFNLKNGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEED 523
           + T K++ +F+L+NG+ PSEF+NP LQ+ +++LHDYLLQ+E+   + D + Q  KLLEED
Sbjct: 500 KITSKIVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEED 559

Query: 524 DSLRRISQIRDKIDESANSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKK 580
           D+LR+ISQIRDKI  S  S DP +Q+L KY+ +WN+ Y K+  +E ++++ PK K K
Sbjct: 560 DTLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYYVKL-QEENSLSNPPKKKSK 615

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/567 (53%), Positives = 409/567 (72%), Gaps = 3/567 (0%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
            Y++++ HE +IF +ELS+GMF+ +PELN KIQLIEILE+L++LMSQL++ RP+  IGCY
Sbjct: 16  SYKKFESHEAMIFSVELSDGMFETVPELN-KIQLIEILESLEELMSQLIVVRPNAAIGCY 74

Query: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLES 134
           F  C +     GIY F PL D+NA+ MKKLSDLLEDL+ +R  L  F  Y+ +K T +E 
Sbjct: 75  FHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQYNNAKKTSMEK 134

Query: 135 LLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFT 194
           L      +F  +V  Q+ +  ++IF FTDNDSP +  D +AKS LR +V+DLD+  +NF 
Sbjct: 135 LFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHVNFV 194

Query: 195 TFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIKSRVLRKQEIKRIMF 254
            FFIG+P  PF+   YS+IL+LGA   +S E+DGPNTTPI A+YIKS+VLRK+EIKR+ F
Sbjct: 195 PFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGPNTTPIQASYIKSKVLRKREIKRVAF 254

Query: 255 QCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEIK 314
           +CPLIL EK  FIVG++GY  +SHEK   RYKLVYE E++RQEAFSRRK+L+++T EEIK
Sbjct: 255 RCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEIK 314

Query: 315 DG-LTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFV 373
              LTK++  GDLDIE+ E    E+        SFLKV+GF+S ++C+ Y NNI+K  FV
Sbjct: 315 GKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMFV 374

Query: 374 VPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLY 433
           VPDE +Y  SI+ L+SLFK LR K K AI+WGKLK+NSNP++F   PS E  PNEGFYL+
Sbjct: 375 VPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYLH 434

Query: 434 RVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHF 493
           RVPFLDE+R++P M+         DYENL + T+ ++ +FNLK G+ P + KNP +QK+F
Sbjct: 435 RVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKYF 494

Query: 494 KILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKY 553
           KILHDYLLQIE++   +    ++ +LL EDD+LR++S IR+KI  S+ S+D   QKLSKY
Sbjct: 495 KILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVSHIREKIISSSRSEDAGAQKLSKY 554

Query: 554 LAIWNSLYDKIFDQETAIADAPKTKKK 580
           + +WN+ Y KI ++E+   +  KTKK+
Sbjct: 555 IKVWNNFYAKI-EKESVSLEPSKTKKR 580

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/568 (52%), Positives = 414/568 (72%), Gaps = 8/568 (1%)

Query: 16  YRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYF 75
           Y+++++HEGIIFCIELS GMF++  ++N K+QL+EILETL +LMSQ++I+ P TGIGCYF
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDMN-KVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 76  FNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESL 135
           F+C   +A  GIY  LPL DVNA++MKKL+DLL+D+    TTL +  P D    TPLE++
Sbjct: 69  FHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLSTPLETV 128

Query: 136 LELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTT 195
             L++E+F+  VP QKA+NNKKIF FTDNDSP EA D D + RLR +V+DLDD  INFTT
Sbjct: 129 FILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINFTT 188

Query: 196 FFIGKPGLPFDEGFYSDILRLGATTKAS---DEFDGPNTTPISAAYIKSRVLRKQEIKRI 252
           FFIG    PFD+ FYSDIL+LGA   AS     F+GP+T PI+A  IK+R LRK+EIKRI
Sbjct: 189 FFIGTEQKPFDQSFYSDILKLGAKKTASQGGSTFNGPSTAPINANLIKARALRKKEIKRI 248

Query: 253 MFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEE 312
            FQC L L E + F V +KGYT++SHE+ G +YK VY++  +R+E  S RKYLNA TGE+
Sbjct: 249 RFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNANTGED 308

Query: 313 IKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATF 372
           + D + +V+ + ++DIE SE ++A+I  DY+  +SFLK+IGF+ T  CL +Y+NI  ++F
Sbjct: 309 VTDSIARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIGNSSF 368

Query: 373 VVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYL 432
           VVPDE   EGSI+T+SSLF++L +K K A+VWGKLKSNSNPA++   PS     NEGFYL
Sbjct: 369 VVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNEGFYL 428

Query: 433 YRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKH 492
            RVPF+DE+R+ PP+     E+   ++E + + T+ LI++F+L+  ++PS+FKNP LQKH
Sbjct: 429 TRVPFVDEVRKFPPIPRYDEELGGKNFEQMCKITETLISYFSLRRPYKPSDFKNPTLQKH 488

Query: 493 FKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSK 552
           FK+L+DYLLQ+E +   + V+      L+ DD+L ++ Q+R KI ES +SKDP +++L  
Sbjct: 489 FKLLYDYLLQVEVDCSSESVDGA----LKHDDTLLKLYQVRRKIQESLSSKDPEEERLGT 544

Query: 553 YLAIWNSLYDKIFDQETAIADAPKTKKK 580
           Y+  WNSLY+KI +QE       K +KK
Sbjct: 545 YVKAWNSLYNKISNQELTPDKGMKKQKK 572

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/581 (54%), Positives = 411/581 (70%), Gaps = 12/581 (2%)

Query: 11  TPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTG 70
            P   YR+Y+ HEG +FCIELS  MF E+ +LNYK+QLIE+LE+L +LMSQLVITRPSTG
Sbjct: 30  NPKASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTG 89

Query: 71  IGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDA--SK 128
           +GC+FFNC+  ++K  IY FLPL+D+N   MKKL DLL+D++ ER ++R    +D    K
Sbjct: 90  VGCFFFNCDNKESKKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDK 149

Query: 129 HTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDD 188
              LESL  L+++ F  ++P QK + NKK+F FTDND P E++D +   RLR L +D+ D
Sbjct: 150 GNSLESLFLLIQDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISD 209

Query: 189 RFINFTTFFIGK--PGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIKSRVLRK 246
            +I F TFFI K      FD+ FYSDIL+L  +   S EFDGP+T PIS AYIK++VLRK
Sbjct: 210 NYIQFVTFFINKIDSSDNFDDSFYSDILKLRNSN--SIEFDGPSTKPISVAYIKNKVLRK 267

Query: 247 QEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLN 306
           +EIKRIMFQCPLIL   S F V VKGYTIISHEKPG RYKLVYE+E+IR+EAFS+RK LN
Sbjct: 268 KEIKRIMFQCPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLN 327

Query: 307 AKTGEEI-KDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYN 365
            KTG  + KD   K++  G+  I   E++  +  ++   +E FLK+IGF+S E  LH +N
Sbjct: 328 GKTGTVVTKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFN 387

Query: 366 NIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEAS 425
           NI KA F+VPDE R  GSIRTLSS+++ +R KN+ AIVWGKLKSNSNP I+   PSD   
Sbjct: 388 NIGKALFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTK 447

Query: 426 -PNEGFYLYRVPFLDELRRIPPMLI---SHGEIQDDDYENLKEATKKLINHFNLKNGFEP 481
             NEGFYLY+VPFLDE+R+IP       S   I++ DYENLK  T+ ++ +FNL NG+ P
Sbjct: 448 DQNEGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSP 507

Query: 482 SEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQ-RSKLLEEDDSLRRISQIRDKIDESA 540
            EFKNP LQK++K+LHDYLLQ+E  PE +  + Q + K+LEEDD++R+   IRDKI +SA
Sbjct: 508 LEFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSA 567

Query: 541 NSKDPNKQKLSKYLAIWNSLYDKIFDQETAIADAPKTKKKG 581
           +S + +KQ+LS    IWN +Y K+   E A+ +    K+K 
Sbjct: 568 SSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQKN 608

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/567 (52%), Positives = 418/567 (73%), Gaps = 10/567 (1%)

Query: 1   MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS 60
           M     NE       Y+++++HEGIIFC+ELS  MF E  +LN K+QL+EILETL +LM+
Sbjct: 1   MDATVGNEGKDSESKYKKFEVHEGIIFCVELSEAMFKEPFDLN-KVQLLEILETLLELMT 59

Query: 61  QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ 120
           Q++I  P TGIGC+FF C+   AK GIY FLPL DVNA++MKKL+DLL+DL+   TTL +
Sbjct: 60  QVIIILPGTGIGCFFFQCSHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNE 119

Query: 121 FLPYDASKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLR 180
             P++  ++T LE++  L++E+F + V  QKA+NNKKIF FTDND P E+ D +AK+RLR
Sbjct: 120 QFPFNDKQNTSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLR 179

Query: 181 HLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASD---EFDGPNTTPISAA 237
            +++DLDD FIN   FF+G    PFD+ FYSDIL+LGA  KASD   +++GPNTTPISA 
Sbjct: 180 KVIDDLDDSFINIIPFFVGSEQRPFDQSFYSDILKLGAKKKASDGPFKYEGPNTTPISAK 239

Query: 238 YIKSRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQE 297
            IKSRVLRK+EIKR+ FQC LIL E S F V +KGYT ISHE+ G +YK VY+++ +R+E
Sbjct: 240 LIKSRVLRKKEIKRVRFQCSLILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKE 299

Query: 298 AFSRRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQST 357
           A S RKYL+A TGE++ + + KV+ + ++DIELSE +IA++  DY+  +SFLK++GF+ T
Sbjct: 300 ALSHRKYLDANTGEDVTERVVKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDT 359

Query: 358 ETCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFF 417
             C+ Y+NNI  ++FVVPD+  ++GSI+T++SLF+ LR+K K A+VWGKLKSNSNP+++ 
Sbjct: 360 NRCVFYFNNISNSSFVVPDDSVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYT 419

Query: 418 FVPSDEASPNEGFYLYRVPFLDELRRIPPMLISHGEI-QDDDYENLKEATKKLINHFNLK 476
             PS+    NEGFYL RVPF+DE+R+ PP    HG + +   +E + + T+ LI++F+L+
Sbjct: 420 LTPSNFNDHNEGFYLTRVPFIDEIRKFPPTAY-HGNLSKTKTFEQMCKITETLISYFSLR 478

Query: 477 NGFEPSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKI 536
           + + PS+F+NP LQKHF++LHDYLLQ+E +P        +  LL++DD+L ++ Q+R KI
Sbjct: 479 HSYRPSDFENPTLQKHFELLHDYLLQVEVDP----TSGSKEHLLKKDDTLLKLHQVRAKI 534

Query: 537 DESANSKDPNKQKLSKYLAIWNSLYDK 563
            ESA S DP + +LS Y+  WNS+Y++
Sbjct: 535 LESAESDDPVQARLSNYVKAWNSMYNR 561

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/566 (50%), Positives = 409/566 (72%), Gaps = 11/566 (1%)

Query: 1   MSDVPSNEEFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMS 60
           M+D+  N+      GY++YD HEGI+FCIEL+  +F+ +  L  +  L+EIL +L +LM 
Sbjct: 1   MTDLEVNKTVDGEYGYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMY 60

Query: 61  QLVITRPSTGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQ 120
           QLVI RP + +GC F   + + A DG+Y FLPL+DVNA+ MK LSD LED++ +R  + Q
Sbjct: 61  QLVIVRPGSSVGCIFHYTDINGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQ 120

Query: 121 FLPYDASKHTPLESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLR 180
           +  +D SKH  LE L +L+ E++ ++  D K F +K+ F FTDND+PPE++D +A  R+ 
Sbjct: 121 YFKFDGSKHVSLERLFQLIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRIS 180

Query: 181 HLVNDLDDRFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASDEFDGPNTTPISAAYIK 240
            +V+DLD+  ++FTTFFIG    PFD  FYS++L+LGA  K SD +DGP+  PI+ + IK
Sbjct: 181 KIVDDLDETAVSFTTFFIGSEEAPFDNRFYSNVLKLGAQLKHSD-YDGPSVRPITGSDIK 239

Query: 241 SRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFS 300
           +R+LR +EIKR MFQCPL L + S FI+G++GY I++HEK G RYKL YE EDIRQEAFS
Sbjct: 240 ARILRGKEIKRTMFQCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFS 299

Query: 301 RRKYLNAKTGEEI--KDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTE 358
           +RKYLN+KTGEE+  KD ++KV PYGD++IELS   + ++R  Y  E  F+KV+GF+ST+
Sbjct: 300 KRKYLNSKTGEEVDPKD-ISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTD 358

Query: 359 TCLHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFF 418
            C+ Y+NNI+K +F+VPDE +YEGSI+TL+SLF+ LR KNK AI+WGK KSNSN A++  
Sbjct: 359 LCVKYFNNIDKPSFIVPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIM 418

Query: 419 VPSDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNG 478
           VPS     N+GFY++R+PFLDELR++P  ++ +   Q D+  +L   T+ ++ +FNL+ G
Sbjct: 419 VPSHREDRNDGFYMHRIPFLDELRKVPIKMVDNDWTQLDN--DLLTVTETILKYFNLRQG 476

Query: 479 FEPSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDE 538
           + PSEFKNPG+Q ++K+LHDY+LQ+ EE + +  ++ + +LL +DD+L++IS IR KI E
Sbjct: 477 YIPSEFKNPGIQNYYKVLHDYILQV-EEIKHEGWDFSQEELLRQDDTLKKISHIRGKI-E 534

Query: 539 SANSKDPNKQKLSKYLAIWNSLYDKI 564
           ++N  D   + LS Y+ +WN  Y  +
Sbjct: 535 ASNDSD---KVLSGYMNMWNLFYKSL 557

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/573 (48%), Positives = 404/573 (70%), Gaps = 18/573 (3%)

Query: 14  KGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGC 73
           K +RRY+ H+GI+FCI+L+  M+   P+L  KIQL+EIL++L+ LMSQLV+  PST +GC
Sbjct: 26  KKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVGC 85

Query: 74  YFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLE 133
           Y +NC+  +A+D +Y  +PL+DVN + MK++SDLLED++ +R  L+  +P  A  + P+E
Sbjct: 86  YIYNCSHPNAEDNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPI-ADPNNPIE 144

Query: 134 --SLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFI 191
              +L  VRE F++ +  QK   NKKIF+FTD+D P E  ++D++SRLR +V+DL D +I
Sbjct: 145 LSPVLIKVRETFLQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYYI 204

Query: 192 NFTTFFIGKPGLPFDEGFYSDILRLGATTKASDEF---DGPNTTPISAAYIKSRVLRKQE 248
           NF TFFIG    PFD+  Y+DIL+ G+    +  +    GP+T PI+A+YIKS+V R +E
Sbjct: 205 NFVTFFIGSEDKPFDDSMYADILKWGSKINEAQSWLSSHGPSTNPINASYIKSKVKRTKE 264

Query: 249 IKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAK 308
           IKRI F+CPL+L+E++  +V V GYTI+SHE PG +YKLVY N  +R+EA+S R+YL+A+
Sbjct: 265 IKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDAE 324

Query: 309 TGEEIKDG-LTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNI 367
           TGE + +  L+KVY +GD  IEL+E +  +I++ Y+  ESFLK+IGF+STE CLHYY+NI
Sbjct: 325 TGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDNI 384

Query: 368 EKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPN 427
           +   FVVP+E  Y GSI+TL+SL++ +  K K A+VWGKL+ NS P++F   PS +   N
Sbjct: 385 DVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDYN 444

Query: 428 EGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNP 487
           +GFYLY+VPF++E+R++P  L     I+ DDY+ + + T+ LIN FNLKNG+ PS+F NP
Sbjct: 445 QGFYLYKVPFMEEVRKLPDFLNHSALIESDDYKVMSKVTETLINFFNLKNGYRPSDFHNP 504

Query: 488 GLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNK 547
            LQKHFKIL +YLLQIE +  K +         E D++L+++ QI  +I  SA S D  +
Sbjct: 505 ALQKHFKILREYLLQIEVDKSKPED--------EGDETLQKVKQIYARIASSAKSDDVKQ 556

Query: 548 QKLSKYLAIWNSLYDKIFDQETAIADAPKTKKK 580
           Q+L KYL +WNS Y+++ + E    D   TK K
Sbjct: 557 QRLVKYLKLWNSFYNRLSNLE---VDTKPTKNK 586

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/475 (57%), Positives = 365/475 (76%), Gaps = 7/475 (1%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
            YR+YD+HEGI+FC+ELS  MF +LPELNYK+QL+EILE+L +LMSQLVITRP TG+GCY
Sbjct: 40  SYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGCY 99

Query: 75  FFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLES 134
            +NC++ ++ + I+ F+PL+DVN + MKK++DLL+DL  ERTTL ++ PYD ++ TPLES
Sbjct: 100 IYNCHKDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLES 159

Query: 135 LLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFT 194
           LLEL ++E VK+V   K FNNKK+F FTDNDSP EASD   K+RLR L +D ++ FI F 
Sbjct: 160 LLELTQDELVKNVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDDNNENFITFV 219

Query: 195 TFFIGKPGLPFDEGFYSDILRLGATTKASD----EFDGPNTTPISAAYIKSRVLRKQEIK 250
            FFI +   PFD  FYSDI +LG +   S     EFDGP+T PISA+YIKSRVLRKQEIK
Sbjct: 220 PFFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIK 279

Query: 251 RIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTG 310
           R++FQC LIL ++  F V +KGY+I+S EK G RYK+VYE+ED+R+EAFS+RK LN  T 
Sbjct: 280 RVLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITA 339

Query: 311 EEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKA 370
           EE+K+GLTKV+PYGDL+IELSE DI +++  Y  +  FLK++GF+S E  LHYYNNI K 
Sbjct: 340 EEVKEGLTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKP 399

Query: 371 TFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGF 430
           +FVVPDE + +GSIR L+SLF+ +R+KNKVA++WGKLK NS+P ++    S+ + PNEGF
Sbjct: 400 SFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGF 459

Query: 431 YLYRVPFLDELRRIPPMLIS---HGEIQDDDYENLKEATKKLINHFNLKNGFEPS 482
           +LYR+PFLDE+R+ P +  S      +   +YEN+K  T+ ++ +FNLK+G+ PS
Sbjct: 460 FLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/617 (45%), Positives = 398/617 (64%), Gaps = 52/617 (8%)

Query: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74
            Y+++ IHEGIIFC+ELS+ MF+ LPEL  K QL+EILE+L  L  QL+I+RP+T IG Y
Sbjct: 22  SYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFY 81

Query: 75  FFNCNRSDA----KDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHT 130
            F+ + SD+    K GIY F  L D+N +TMKK++DLLEDL ++R  L     +D S+ T
Sbjct: 82  LFH-HTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPT 140

Query: 131 PLESLLELVREEFVK--DVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDD 188
            LE +  +V+E+F+    +   K FN KK+F FT+ND P E+ + + + +LR +VNDL++
Sbjct: 141 KLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNE 200

Query: 189 RFINFTTFFIGKPGLPFDEGFYSDILRL-------------------------------- 216
             I F+TFFI KP   FD+ FYSDIL+L                                
Sbjct: 201 SEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLK 260

Query: 217 -GATTKASDE--------FDGPNTTPISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFI 267
             + +K +D         F  PNT PI A+ IK R+LRKQEI+R+ FQCPLIL+E S FI
Sbjct: 261 DTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFI 320

Query: 268 VGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEIKD-GLTKVYPYGDL 326
           +G+ GY I S EKPG RYKLVYE+E++R+EAFSRRK+L+  TGEE+KD    KVY YGD+
Sbjct: 321 IGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDI 380

Query: 327 DIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFVVPDEGRYEGSIRT 386
           +IELS+     I+N+Y     F+K++GF+S +  L YYNNI+KA+FVVPDE  YEGSI+T
Sbjct: 381 NIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKT 440

Query: 387 LSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLYRVPFLDELRRIPP 446
           ++SLF+ L +K KVAIVWG   S  +P I    PS+E   NEG YL++VPFLDE+RR P 
Sbjct: 441 MASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPA 500

Query: 447 ML-ISHGEIQD-DDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHFKILHDYLLQIE 504
           +   S G  ++  +YE +K+ T+ ++   +L+ G+ PS ++NP LQK++KILHDYLLQIE
Sbjct: 501 LTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIE 560

Query: 505 EEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKYLAIWNSLYDKI 564
           +    D  +    + + EDD+L R+ ++R +I +S+ + +   Q+LSK++  WN ++ KI
Sbjct: 561 DTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKKI 620

Query: 565 F-DQETAIADAPKTKKK 580
             D +  I   P T KK
Sbjct: 621 NEDAQMDIEPTPVTLKK 637

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  522 bits (1345), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 254/569 (44%), Positives = 381/569 (66%), Gaps = 12/569 (2%)

Query: 9   EFTPGKGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPS 68
           E      ++R++IHEGI+FCIELS  MF+   EL+ K Q+  IL +L +LM  L++TRPS
Sbjct: 24  EVNKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPS 83

Query: 69  TGIGCYFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASK 128
           T IGCYF+NC R D+K+ I+ F+PL D+N Q MKK++DLLED+  +R T +++L Y+  +
Sbjct: 84  TAIGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYNIDQ 143

Query: 129 HTPL------ESLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHL 182
           +  L      E L  L+ E F +++  QK FN+KK+F FTDND P   S   +   L+ +
Sbjct: 144 NKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDVLKGI 203

Query: 183 VNDLDDRFINFTTFFIGKPGLPFDEGFYSDILR--LGATTKASDEFDGPNTTPISAAYIK 240
           + D+DD  INFT FFI K   PF+  FYS +LR      +  S  + GP+T PI    IK
Sbjct: 204 LKDIDDNMINFTNFFISKKDKPFNPAFYSKVLRNDRDYNSLGSQAYFGPSTKPIGVNDIK 263

Query: 241 SRVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFS 300
            R+ +++EI+R++FQCPL+L+E + F++ +KGY+I +HEK  VRYKLVYEN++IR+EAFS
Sbjct: 264 ERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKEAFS 323

Query: 301 RRKYLNAKTGEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETC 360
           +RK++N KTGE++     K+ PYG+ +IE+ + +IA   N Y    + L VIGF + +  
Sbjct: 324 KRKFINPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNEDNS 383

Query: 361 LHYYNNIEKATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVP 420
           L +YNNI+K  F+ PDE   EGS    +SLF+ L++  KV +VWG  KSNS+P+++   P
Sbjct: 384 LVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYLLWP 443

Query: 421 SDEASPNEGFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFE 480
           S +   N+GFYL +VPF+DE+R+ P +   +   + ++Y+N+KE T+ +I+HFNLK+G+ 
Sbjct: 444 SKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELTQGIISHFNLKSGYH 503

Query: 481 PSEFKNPGLQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESA 540
             EF+NP L +H+K+LHDYLLQ+E   + +D+   R + L EDD+L +I++IR++I +  
Sbjct: 504 AEEFRNPALNRHYKLLHDYLLQVEIPQDDNDI---RDRYLREDDTLLKITKIRERIMKDT 560

Query: 541 NSKDPNKQKLSKYLAIWNSLYDKIFDQET 569
              D  K++LSKYL +WN  Y K F ++T
Sbjct: 561 TIDDVEKRRLSKYLEVWNIYYRK-FKEDT 588

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  435 bits (1118), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 237/572 (41%), Positives = 354/572 (61%), Gaps = 26/572 (4%)

Query: 14  KGYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGC 73
           K + RY++HEGI+FC+ELS+ M+   PEL  K QL+EILE L +LM QLV   P TG+GC
Sbjct: 23  KRHLRYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGC 82

Query: 74  YFFNCNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLE 133
           YFF C   +AK GIY   PL+DVN   MKK+  LLE ++  + +L + LPYD    T L+
Sbjct: 83  YFFQCRHREAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPYDGRHPTSLD 142

Query: 134 SLLELVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINF 193
            +   ++++F+++VP+Q+ +NNKKIF FTDNDSPPE   + +++RLR +V+DL+D +INF
Sbjct: 143 VVFTSIQDQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDYYINF 202

Query: 194 TTFFIGKPGLPFDEGFYSDILRLGATTKASDE----FDGPNTTPISAAYIKSRVLRKQEI 249
           +TFFIG    PFDE FYSDIL+LGA   A       +DGP+T PIS +YI+SRVLRK+E+
Sbjct: 203 STFFIGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISVSYIRSRVLRKKEV 262

Query: 250 KRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKT 309
           +R+ + CPL L E+   +V VKGY   ++E+PG RY++VY++ED+++EAFS R+YL+  T
Sbjct: 263 RRLRYSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQREAFSHRRYLDPDT 322

Query: 310 GEEIKDGLTKVYPYGDLDIELSESDIAEIRNDYA-GEESFLKVIGFQSTETCLHYYNNIE 368
           GEE  + L KVY  GD  ++L +     I N  A   +SFL+++G ++    L YYNNI 
Sbjct: 323 GEEATEDLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSRTAVAVLPYYNNIH 382

Query: 369 KATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNE 428
             TF+VPD+  Y GS   L+SL + LR   +  +++GKL++ S PA++   P+    P+ 
Sbjct: 383 HVTFLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPALYALAPAAAPLPDA 442

Query: 429 GFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPG 488
            F L R+PF +E+R+ P +      +   DY  L++ T ++I+   L + + P++FKNP 
Sbjct: 443 VFILARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRIIDLLVLSSPYAPADFKNPV 502

Query: 489 LQKHFKILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQ 548
           +  HF++L D+L +  ++P  DD                    I   +       D  + 
Sbjct: 503 IATHFRLLSDHLFETAQDPRTDDT-------------------IARLLRLRHRVLDDPES 543

Query: 549 KLSKYLAIWNSLYDKIFDQETAIADAPKTKKK 580
           +L+KYL  WN+ Y +   Q+ A     K  K+
Sbjct: 544 RLAKYLRHWNAFYAR--HQQVASPSPTKYSKR 573

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  375 bits (964), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 198/550 (36%), Positives = 324/550 (58%), Gaps = 12/550 (2%)

Query: 18  RYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYFFN 77
           +++  + II CIELS+ ++    E++ K QL E+LE L +LM QL +  P++ + CY + 
Sbjct: 17  KHERRQSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQ 75

Query: 78  CNRSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESLLE 137
           C R + KDGIY  LPL+ VN Q + K+S LL D++ ++  L+  +P++    +PL S+L 
Sbjct: 76  CRRLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLA 135

Query: 138 LVREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTTFF 197
            ++ +      D+  F NK+I   T ND P E  D + + + ++ +N L D   +  TFF
Sbjct: 136 KIQHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195

Query: 198 IGKPGLPFDEGFYSDIL----RLGATTKASDEFDGPNTTPISAAYIKSRVLRKQEIKRIM 253
           I     PF++ FY+D+L    R     K    +DGPNT PI    +K ++L+K+E  +  
Sbjct: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKKEGNKFH 255

Query: 254 FQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEI 313
           F+C  I+ +++ FI+ +KG+  I+ EK G R+K +Y+     Q+AFS RK+ NA  GE  
Sbjct: 256 FKCAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEAA 315

Query: 314 KDGLTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFV 373
              LTKV+  G L+IE +E    ++ N ++  E+FL++IGF+S +    YYNNI  +++V
Sbjct: 316 DSRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYV 375

Query: 374 VPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLY 433
           +PD+  YEGS +TLS L+ ++ +K K AIVWGKL   ++P +F  V  D  + N+GFYL 
Sbjct: 376 IPDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLV 435

Query: 434 RVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHF 493
           R+PF++E+RR P  L  +  +   +Y  +K+ T  +I  FNLK+ +  +EF +P L+  +
Sbjct: 436 RLPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFY 495

Query: 494 KILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKY 553
             L D LLQ     +    +W     L  D +L ++  +R+ I++S  S++  +  L+KY
Sbjct: 496 TTLSDKLLQ-----KSLSDQWGMGFKLSNDITLGKVQHLRELINKS--SQNMEQPILAKY 548

Query: 554 LAIWNSLYDK 563
           +  WN+ Y+K
Sbjct: 549 MKYWNTYYNK 558

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  279 bits (714), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 165/562 (29%), Positives = 304/562 (54%), Gaps = 27/562 (4%)

Query: 20  DIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYFFNCN 79
           D ++ I+ CIELS  +      L     ++E++  L  ++ +L+I +P++ +GC  F   
Sbjct: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG 84

Query: 80  RSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESLLELV 139
           R  A+DGI    PL+ ++A  ++ +SD + DL+ E   + Q  P+ A+    L+ +L   
Sbjct: 85  RR-AEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTATVPASLDVMLAAS 142

Query: 140 REEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTTFFIG 199
              F +D   Q A N  +IF  TD D+P E +D     +++  +  L  R I+ TTFF+ 
Sbjct: 143 DRYFTEDT--QNADN--RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLH 198

Query: 200 KPGLPFDEGFYSDILRLGATTKASDEFDGP----NTTPISAAYIKSRVLRKQEIKRIMFQ 255
                F++  Y++IL+       + E+  P    +T+P+S   ++ ++L ++++ R  F 
Sbjct: 199 TEHAAFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKLREKMLSQKDLNRAYFS 251

Query: 256 CPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEIKD 315
           CPL++ + +  +V V GY   +HE+PG RYK + +++   +     RKY      + I+D
Sbjct: 252 CPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRD 311

Query: 316 G-LTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFVV 374
              + VY  G   IE++++++ ++    +  ESFL+++GF++  T   YY+NI +A +++
Sbjct: 312 ADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYIL 371

Query: 375 PDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLYR 434
           P E  + GS + L+SL +++ +K K AIVWG+LK+  +P +F  +PSD  +      L R
Sbjct: 372 PRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC--ALRLVR 429

Query: 435 VPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHFK 494
           +PF++E+R  P +          +YE +K  ++ LI HF+L+  + PS+ +NP L+  + 
Sbjct: 430 IPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYS 489

Query: 495 ILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKYL 554
            L+    +  ++ ++   E Q   L E D +L ++  +RD+I+ S    +P    +S+Y+
Sbjct: 490 TLYH---EQSQDAKRKMPELQ--YLPESDSTLHKVQLVRDRIENSIIHDEP--PIISEYI 542

Query: 555 AIWNSLYDKIFDQETAIADAPK 576
             WN  Y+ I D+      APK
Sbjct: 543 NCWNIYYNHIIDKAVYEYGAPK 564

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 30/173 (17%)

Query: 85  DGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTL----RQFLPYDASKHTPLESLLEL-- 138
           D + P LP      +++  LSDL +  Q  RT       + LP    K  P+E +     
Sbjct: 599 DLVVPMLP------ESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGK--PIEIIYNSLK 650

Query: 139 VREEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTTFFI 198
           +R+  V + P     +  +I   TD+++PP   D+++ S +  L+ +L  +  N      
Sbjct: 651 IRKGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNN------ 704

Query: 199 GKPGLPFDEGFYSDILRLGATTKA-------SDEFDGPNTTPISAAYIKSRVL 244
               + F EGF   ++ L    +        SD+ + P+T  +S   I +  L
Sbjct: 705 ---AVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTL 754

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 9/99 (9%)

Query: 242 RVLRKQEIKRIMFQCPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSR 301
           + L+K E+K       LILE    F++   G  ++     G R KL       R      
Sbjct: 569 KSLKKPELKVF----SLILE----FVLAFDGCNLLHTLSNGGRLKLAETTGAFRNILDKW 620

Query: 302 RKYLNAKTGEEIKDG-LTKVYPYGDLDIELSESDIAEIR 339
           + Y + K  EE+ +  L +   Y +LDI L++SDI EI+
Sbjct: 621 KLYHSIKDHEELHESQLMQADHYSNLDIFLTKSDIVEIQ 659

>TPHA0F01360 Chr6 complement(314026..317094) [3069 bp, 1022 aa] {ON}
           Anc_2.233 YIL128W
          Length = 1022

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 30/144 (20%)

Query: 369 KATFVVPDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNE 428
           K  F+  DE + + S+  LS++  NL            LK N    IF F  S       
Sbjct: 47  KNEFISEDEKKRQQSLHCLSNILNNLSS--------ATLKKNELNVIFNFYQSK------ 92

Query: 429 GFYLYRVPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPG 488
                    +DEL  +  +L     +   D  ++ E +  L+N   + N +EPS+F  P 
Sbjct: 93  ---------IDELNNMTEILSGFNSLTTMDSVSMLEIST-LLNI--ISNEYEPSKFLTPT 140

Query: 489 LQKHFKILHD----YLLQIEEEPE 508
             + F IL +    Y ++++E+P+
Sbjct: 141 RYQTFLILSNIIEKYKIEMKEDPK 164

>NCAS0D01710 Chr4 (321870..322985) [1116 bp, 371 aa] {ON} Anc_5.133
          Length = 371

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 96  VNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESLLELVREEFVK 145
           V    ++KLS L+  LQ   TT R+     A  H  LESLLELV +   K
Sbjct: 5   VGMSHLRKLS-LMSPLQMLHTTKRKLSSVTAKNHASLESLLELVPQTATK 53

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,806,981
Number of extensions: 3461088
Number of successful extensions: 12984
Number of sequences better than 10.0: 98
Number of HSP's gapped: 13412
Number of HSP's successfully gapped: 98
Length of query: 582
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 467
Effective length of database: 40,294,809
Effective search space: 18817675803
Effective search space used: 18817675803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)