Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A079708.848ON48948925950.0
Kpol_1068.28.848ON49149214570.0
NCAS0C003508.848ON48649014330.0
KNAG0J002208.848ON49949314200.0
SAKL0D01276g8.848ON50248914180.0
YMR283C (RIT1)8.848ON51349414180.0
KAFR0B039808.848ON48348714140.0
Suva_13.4728.848ON51048713950.0
KLTH0C03696g8.848ON47447613870.0
NDAI0K003508.848ON50450413890.0
Skud_13.4558.848ON49449513870.0
ZYRO0G14344g8.848ON47248513800.0
Smik_13.4968.848ON49449413790.0
Kwal_27.102198.848ON50048813780.0
Ecym_46238.848ON48048813530.0
TPHA0I003008.848ON49348913520.0
KLLA0D01386g8.848ON48949812991e-176
AFR451C8.848ON40841710171e-134
Kwal_34.157614.4ON584126761.1
KLLA0A10571g3.252ON56195732.0
NDAI0H028002.413ON86863732.2
TBLA0E01070singletonON27969704.5
KNAG0H002502.654ON89637714.7
TDEL0H029307.130ON20585686.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A07970
         (489 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...  1004   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   565   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   556   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   551   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   550   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   550   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   549   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   541   0.0  
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   538   0.0  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   539   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   538   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   536   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   535   0.0  
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   535   0.0  
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   525   0.0  
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   525   0.0  
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   504   e-176
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   396   e-134
Kwal_34.15761 s34 complement(47913..49667) [1755 bp, 584 aa] {ON...    34   1.1  
KLLA0A10571g Chr1 (922516..924201) [1686 bp, 561 aa] {ON} weakly...    33   2.0  
NDAI0H02800 Chr8 complement(688625..691231) [2607 bp, 868 aa] {O...    33   2.2  
TBLA0E01070 Chr5 (239221..240060) [840 bp, 279 aa] {ON}                32   4.5  
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    32   4.7  
TDEL0H02930 Chr8 complement(488780..489397) [618 bp, 205 aa] {ON...    31   6.6  

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/489 (100%), Positives = 489/489 (100%)

Query: 1   MVVDQMDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNER 60
           MVVDQMDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNER
Sbjct: 1   MVVDQMDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNER 60

Query: 61  CGLWYCNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKV 120
           CGLWYCNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKV
Sbjct: 61  CGLWYCNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKV 120

Query: 121 PDALSKTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKS 180
           PDALSKTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKS
Sbjct: 121 PDALSKTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKS 180

Query: 181 LEVINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCT 240
           LEVINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCT
Sbjct: 181 LEVINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCT 240

Query: 241 VSYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQ 300
           VSYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQ
Sbjct: 241 VSYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQ 300

Query: 301 LSLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS 360
           LSLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS
Sbjct: 301 LSLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS 360

Query: 361 VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI 420
           VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI
Sbjct: 361 VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI 420

Query: 421 CCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRAT 480
           CCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRAT
Sbjct: 421 CCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRAT 480

Query: 481 LNSVNSYLM 489
           LNSVNSYLM
Sbjct: 481 LNSVNSYLM 489

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/492 (57%), Positives = 360/492 (73%), Gaps = 7/492 (1%)

Query: 2   VVDQMDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERC 61
           +V ++++++  S+  I+KDIKKEYKSL+NR+QSILLD  FL   V+P FPE+P++PNERC
Sbjct: 1   MVSKVEDDY--SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERC 58

Query: 62  GLWYCNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVP 121
           GLWYCNPK F QTSYFKSTDGH NQWDFS+RRLNFH++PT+A++ GI+IVDSTRRGKK+P
Sbjct: 59  GLWYCNPKLFEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIP 118

Query: 122 DALSKTIPIWCAVLNHLMLES--QGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLK 179
           DALSKT+PIWCAVLN LMLES  Q      + L+VPP TV  SE+  I  ++P L+E+L 
Sbjct: 119 DALSKTVPIWCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLN 178

Query: 180 SLEVINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIIL 238
            L +I+G +L+KQ  GKLLRP WI+PGSS+LQSTTDIFTGE T+D W  P D  IIPIIL
Sbjct: 179 KLAIIDGSDLYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIIL 238

Query: 239 CTVSYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFV 298
           CTVSY+AQDGVDKR GFTYVQGAADDHELWSHGLN  +FW NI+   + + SE+ L+  V
Sbjct: 239 CTVSYRAQDGVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTV 298

Query: 299 SQLSLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358
             L         E +  +AF  +D++T ++ LG + D L     L  E+    S+VIV S
Sbjct: 299 EDLLAAKQKEVSETETLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFS 358

Query: 359 QSVNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHI-LDLDKQRKP 417
           +S        E E  ++ I I++LQSGSK SS+ L+  L ++   IE     D  K   P
Sbjct: 359 ESCKLSVSKNE-EKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELP 417

Query: 418 VLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPP 477
           +LICCNSGTDMSI L+L++LC++Y++DW  + P  V+KI+++KHL KLISHLKGRNVNP 
Sbjct: 418 ILICCNSGTDMSIALVLMLLCKHYDLDWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPS 477

Query: 478 RATLNSVNSYLM 489
           RATLNSVN YLM
Sbjct: 478 RATLNSVNEYLM 489

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 357/490 (72%), Gaps = 10/490 (2%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD   ++SL  INKDI+KE KS+RNRLQSILLD  FL  EVLPCFP++P++PNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
             P+DF QTSYFKSTDGHTNQWDFS+RRLNFH+ PT+  S GIIIVDSTRRGKK+PDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 126 KTIPIWCAVLNHLMLESQGGSVK---QETLYVPPETVSESEFYSIKSRIPELVEKLKSLE 182
           KTIPIWCAVLN++ML SQ GS      + L+ PPET+S++E+  I  RIP+LV KL  L+
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 183 VINGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIILCTV 241
           +++G EL   L GKLLRPFW+YPGSS+LQS+ D+FTGE+T D W +P   +IIPIILCT+
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240

Query: 242 SYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL 301
           SY+AQDG DKR GFTYVQGAADDHELWS GL   +FWS+I+   N   +EE++ +FV  L
Sbjct: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300

Query: 302 SLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSV 361
                D  ++   +DAF  ID VTP+L LG + DN+     L  ++    +L I+LS++V
Sbjct: 301 VQEQDDAGEQSDINDAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENV 360

Query: 362 NFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLIC 421
                  + EN      I KLQSGSK SS+ L+ ++ +I+ L+E  +   +   KP+LIC
Sbjct: 361 ELDP--VDNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQM--NNALNKPILIC 416

Query: 422 CNSGTDMSIGLLLVVLCRNYNMDWQLNTPTS--VSKIVVKKHLAKLISHLKGRNVNPPRA 479
           CN+GTDMSIG+LL +LCRNY+  W L    +  + KI+++K L +LISHL+GR +N  RA
Sbjct: 417 CNTGTDMSIGILLALLCRNYSERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRA 476

Query: 480 TLNSVNSYLM 489
           TLNSVN+YLM
Sbjct: 477 TLNSVNNYLM 486

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/493 (56%), Positives = 356/493 (72%), Gaps = 14/493 (2%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD N + SL  I+K++K++ +SLRNR+QSILLD  FL T V   FP++PL+PNERCGLWY
Sbjct: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           CNP  F QTSYFKSTDGH NQWDFS+RRLNFH++PT+ ++ G++IVDSTRRGKK+PDALS
Sbjct: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131

Query: 126 KTIPIWCAVLNHLMLESQGGSVK-QETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184
           KT+P+WCAVLN LMLES G      + L+VPPETV ESE   +  ++P+LVEKLK L V 
Sbjct: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191

Query: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIILCTVSY 243
           +G +  + L GKLLRPFW++PGSS+LQS TDIFTGE   +KW +  D +I+PIILCTVSY
Sbjct: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSY 251

Query: 244 QAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL-S 302
           QAQDG+DKR GFTYVQGAADDHELWSHGL A IFWSNID   N    + EL   V ++ +
Sbjct: 252 QAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVT 311

Query: 303 LRGCDLSKEIQ---FSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQ 359
            +  ++ +  Q          ID VT  LSLG + DN+  + + I ++ + +S VIVLS+
Sbjct: 312 QQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSE 371

Query: 360 SVNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVL 419
           +V+   K A  +N  E + I +L SGSK SS+NL+  L  I   I   I  + +  KP+L
Sbjct: 372 TVHL-DKDASQDN--EMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAI--ILQPIKPLL 426

Query: 420 ICCNSGTDMSIGLLLVVLCRNYNMDWQL---NTPTSVSKIVVKKHLAKLISHLKGRNVNP 476
           ICCN+G DMSIG+LL VLC+NY+  W L   +   SVSKIV+++HL KLI+HL GRNVNP
Sbjct: 427 ICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNP 486

Query: 477 PRATLNSVNSYLM 489
            RATLNS+NS+LM
Sbjct: 487 SRATLNSINSFLM 499

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 362/489 (74%), Gaps = 17/489 (3%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD   + SL  I K+IKKEYKSLRNRLQSI+ D+ FL T V+P FP+YPLVPNERCGLWY
Sbjct: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           CNP+ F+Q SYFKSTDGH NQWDFS+RRLNFH++P+IA+  GI+I+DSTRRGKK+PDALS
Sbjct: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145

Query: 126 KTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185
           KTIPIWCAV+N L+LE+   S  +E L+ PP TV +SE+  IK+RIP LVEKLK+L +++
Sbjct: 146 KTIPIWCAVINTLILEASNRS--EEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVS 203

Query: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVT-SDKW-IPVDNSIIPIILCTVSY 243
           G EL KQ GGK+LRP W+YPGSS+  S+TDIFTG+ T S KW  P D   +P+ILCT SY
Sbjct: 204 GDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASY 263

Query: 244 QAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSL 303
           Q QDGVDKR GFTYVQGAADDHELW+ GL   +FW N + LG++  SE+EL  +V++   
Sbjct: 264 QCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKR 323

Query: 304 RGCDLSKEIQFSD---AFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS 360
              + +KE   +D    F  +D +T EL LG V+D LE N KL+ ++   ++L +VLS+S
Sbjct: 324 EATERTKEASGNDLNQCF-SVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSES 382

Query: 361 VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI 420
           V    K+A ++       I  L SG+K SS+ L+++L++I PLI+  +        P+LI
Sbjct: 383 V----KIASIQENPN-TKIFPLTSGNKKSSKELRSKLIEICPLIQASL----NSPLPILI 433

Query: 421 CCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRAT 480
           CCN+G DMS+G+LL  LC+NY+ DW + +P S +K +++KHL +LISHLKGRNVNP RAT
Sbjct: 434 CCNTGKDMSVGVLLATLCQNYDEDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRAT 493

Query: 481 LNSVNSYLM 489
           LNSVN+YLM
Sbjct: 494 LNSVNAYLM 502

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/494 (56%), Positives = 355/494 (71%), Gaps = 10/494 (2%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD N   SL  INKDI+KE KS+RNRLQSILLD  FL   V+P FP YPL+PNERCGLWY
Sbjct: 20  MDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWY 79

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           CNP  F QTSYFKSTDGH NQWDFS+RRLNFH++ TI  + GIIIVDSTRRGKK+PDALS
Sbjct: 80  CNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 139

Query: 126 KTIPIWCAVLNHLML-ESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184
           KT+PIWCAVLN LML E++      + LY+PPETV +SE+  IK +IPELV KL+ L +I
Sbjct: 140 KTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNII 199

Query: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTS-DKW-IPVDNSIIPIILCTVS 242
           + K+L++   GKLLRP W++PGSS+L  + D FTGEV   + W  P D +IIPIILCTVS
Sbjct: 200 DSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVS 259

Query: 243 YQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS 302
           YQAQDG+DKR GFTYVQGAADDHELWS GL++ +FW++I+ LG+   S+++L  ++  L+
Sbjct: 260 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLA 319

Query: 303 ---LRG-CDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358
              LR  C +  +    + F  ID +T E+SLG V   L  N  L  +++  +  VI+ S
Sbjct: 320 AAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFS 379

Query: 359 QSVNFPQKVAEMENASE--FISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRK 416
            SV   +   + E +    FISI+KLQSG K SS+ L++   +I   I+    + D++ K
Sbjct: 380 NSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIK 439

Query: 417 PVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPT-SVSKIVVKKHLAKLISHLKGRNVN 475
           P+LICCN+GTDMSIG++L +LC  Y  +W L +    +SK++V+KHL KLISHLKGRNVN
Sbjct: 440 PMLICCNTGTDMSIGVILSILCTKYTEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVN 499

Query: 476 PPRATLNSVNSYLM 489
           P RATLNSVNS+LM
Sbjct: 500 PSRATLNSVNSFLM 513

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/487 (58%), Positives = 359/487 (73%), Gaps = 12/487 (2%)

Query: 11  IDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKD 70
           +DSL  I KDIK EY+SL+NRLQSI+LD +FL  EV+PCFP YP++PNERCGLWYC+PK 
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 71  FTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPI 130
           F QTSYFKSTDGH NQWDFS+RRLNFH++P +AKSNGIIIVDSTRRGKK+PDALSKTIPI
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 131 WCAVLNHLMLESQGGSV--KQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKE 188
           WCAVLN L+LE         ++ L+VPP TVS SE++ I  +I ELV KLK+LEV+  KE
Sbjct: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180

Query: 189 LHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIILCTVSYQAQD 247
           L+    GKL+RPFW+YPGSS+L +  D FTGE T ++W +P + +IIPIILCTVSYQAQD
Sbjct: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240

Query: 248 GVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCD 307
           GVDKRRGF YVQGAADDHELWS GL  K FW NID L +   ++  L+ FV  L+L    
Sbjct: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300

Query: 308 LSK-EIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFPQK 366
             K      D F  ++ VTPE+SLG +IDN   + KL GE+    SLVI+LS+++    +
Sbjct: 301 EKKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETI----E 356

Query: 367 VAEMENA-SEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDK-QRKPVLICCNS 424
           + ++E A ++ I + KLQSGSK SS++L+ +L +I   I  +  D     +KP+LICCNS
Sbjct: 357 ITKLEEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNS 416

Query: 425 GTDMSIGLLLVVLCRNYNMDWQLNTPTS--VSKIVVKKHLAKLISHLKGRNVNPPRATLN 482
           G DMS+ ++L +L + Y+  WQL T     +SK V++KHLAKLIS L+GRNVNP RATLN
Sbjct: 417 GNDMSVAVILTILSKKYSEGWQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLN 476

Query: 483 SVNSYLM 489
           S+NSYLM
Sbjct: 477 SINSYLM 483

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/487 (56%), Positives = 349/487 (71%), Gaps = 10/487 (2%)

Query: 13  SLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKDFT 72
           SL  INKD++KE KS+RNRLQSILLD  FL   VLP FP +P+VPNERCGLWYC P  F 
Sbjct: 24  SLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPSSFE 83

Query: 73  QTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPIWC 132
           QTSYFKSTDGH NQWDFS+RRLNFH++  I ++ GIIIVDSTRRGKK+PDALSKT+PIWC
Sbjct: 84  QTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVPIWC 143

Query: 133 AVLNHLMLESQGGSVK-QETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKELHK 191
           AVLN +ML+    +V   + LYVPPETV +SE+  IK +IPELV+KL+ L  I+ K L+K
Sbjct: 144 AVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKTLNK 203

Query: 192 QLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDK-W-IPVDNSIIPIILCTVSYQAQDGV 249
              GK+LRP W++PGSS+L  + D FTGE+   + W  P D +IIPIILCTVSYQAQDG+
Sbjct: 204 LFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSYQAQDGM 263

Query: 250 DKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCDLS 309
           DKR GFTYVQGAADDHELWS GL++K+FWS+ID LG+  +S+++L  +++ L  +  +  
Sbjct: 264 DKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKLEYQ 323

Query: 310 KEIQ----FSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFPQ 365
             IQ      D F  ID +T E+SLG VI  L  N KL  E++  +  VI+ S SV    
Sbjct: 324 LSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVAIAA 383

Query: 366 KVAEMENA--SEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCN 423
               +E +    FIS++KLQSG K SS+ L++    I   ++    +  K  KP+L+CCN
Sbjct: 384 HADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKGMKPILVCCN 443

Query: 424 SGTDMSIGLLLVVLCRNYNMDWQLNTPTS-VSKIVVKKHLAKLISHLKGRNVNPPRATLN 482
           +GTDMSIG++L +LC  YN +W L +    V+KI+++KHL KLISHL GRNVNP RATLN
Sbjct: 444 TGTDMSIGVILSILCAKYNEEWILTSELPVVNKIIIRKHLTKLISHLHGRNVNPSRATLN 503

Query: 483 SVNSYLM 489
           SVNS+LM
Sbjct: 504 SVNSFLM 510

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/476 (55%), Positives = 343/476 (72%), Gaps = 16/476 (3%)

Query: 17  INKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKDFTQTSY 76
           +N++IKKEY+SLRNRLQSI+ D+ FL  +V   FP+YP++PNERCG+WYC+PKD+ QTSY
Sbjct: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71

Query: 77  FKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPIWCAVLN 136
           FKSTDGHTNQWDFS RRLNFH++P +A S GI++VDSTRRGK++PDALSKT+PIWCAVLN
Sbjct: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131

Query: 137 HLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKELHKQLGGK 196
            L+LE QG  ++ E L+ PP+TVSE EF  IKSRIP+LV K K + ++ G ++ +   GK
Sbjct: 132 SLLLEYQG--LEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKGK 189

Query: 197 LLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVD-NSIIPIILCTVSYQAQDGVDKRRGF 255
           +LRP W++PG+S+L S  D FTGEV S KW   +  + IP++LCTVSYQ QDGVDKR GF
Sbjct: 190 ILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRHGF 249

Query: 256 TYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCDLSKEIQFS 315
           TYVQGAADDHELW+ GL A++FW +I IL N   S++ELE FV          S E   S
Sbjct: 250 TYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAENGLS 309

Query: 316 -DAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFPQKVAEMENAS 374
            D     D++T EL LG +  N+     L+ E+R  +SLVI+LS +V   +  A      
Sbjct: 310 LDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAA----- 364

Query: 375 EFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCNSGTDMSIGLLL 434
             I I KLQS  K SS+ L+TEL+KI PL E ++        P+L+CCN+G DMS+ + L
Sbjct: 365 --IKIFKLQSECKKSSKALRTELIKICPLAEAYL----PNSLPMLVCCNTGKDMSVCVSL 418

Query: 435 VVLCRNYNM-DWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATLNSVNSYLM 489
            +LCRNYN+  W LN   S+ KI +KKHL+K+I+ L+GRNVNPPRA+LNSVN+YLM
Sbjct: 419 AILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/504 (55%), Positives = 360/504 (71%), Gaps = 29/504 (5%)

Query: 10  FIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPK 69
           F DSL  INKDIKKEYKSLRNRLQSILLD  FL  E++  FP YP++PNERCGLWY +P 
Sbjct: 6   FFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPS 65

Query: 70  DFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIP 129
            + QTSYFKSTDGHTNQWDFS+RRLNFH++ TIAKS GI I+DSTRRGKK+PDALSKTIP
Sbjct: 66  QYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIP 125

Query: 130 IWCAVLNHLML-ESQGGS--VK-QETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185
           IWCAVLN++ML E +GG+  VK ++ L+VPP TV +SE+  I  +IP LVEKL  LE+IN
Sbjct: 126 IWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIIN 185

Query: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQA 245
             EL     GKLLRP WIYPGSSIL S+ D+FTGE T         +IIPI+LCT+SYQA
Sbjct: 186 ANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAPENIIPIVLCTISYQA 245

Query: 246 QDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL-SLR 304
           QDGVDKR GFTYVQGAADDHELWS GL  ++FWS+I+ LGN   S++EL  +V  +  ++
Sbjct: 246 QDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMK 305

Query: 305 GCDLSK---EIQFSDAFPQ-IDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQS 360
             D +    E+     FP  +D +TPE+SLG + +N++    ++ E ++  SLV++LS++
Sbjct: 306 IKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSET 365

Query: 361 VNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLI 420
           V       + E  S+ + I+KL SGSK SS+ L+TE+ KI  ++ +++ +     KP+LI
Sbjct: 366 VTLNSDDKD-EQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTN----GKPILI 420

Query: 421 CCNSGTDMSIGLLLVVLCRNYNMD------W--------QLNTPTS-VSKIVVKKHLAKL 465
           CCN+GTD+SIG++L +LC+NY +D      W          N P   + K +++K+L  L
Sbjct: 421 CCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTL 480

Query: 466 ISHLKGRNVNPPRATLNSVNSYLM 489
           ISHL+GRNVNP RATLNSVN YLM
Sbjct: 481 ISHLEGRNVNPSRATLNSVNDYLM 504

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/495 (54%), Positives = 354/495 (71%), Gaps = 12/495 (2%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD   + SL  INKD+++E KS+RNRLQSILLD  FL   V+  FP +P+VPNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           C P  F +TSYFKSTDGH NQWDFS+RRLNFH++ TI    GIII+DSTRRGKK+PD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 126 KTIPIWCAVLNHLMLESQGGSVK-QETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184
           KT+PIWCAVLN +ML+ +   V   + LYVPPETV +SE+  IK +IPELV KLK L V+
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTS-DKW-IPVDNSIIPIILCTVS 242
           + ++L+    GK+LRP W++PGSS+L  + D FTGE+   + W  P D +IIPIILCTVS
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 243 YQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS 302
           YQAQDG+DKR GFTYVQGAADDHELWS GL++++FWS++D LG+ + S+++L  +++ L 
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 303 LRGCDLSKEIQ----FSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358
            +  +    I+      + F  ID++T E+SLG VI  L  + KL  E++  +  VIV S
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 359 QSVNFPQKVAEMENAS--EFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRK 416
            SV   +     E +S   FIS+ KLQSG K SS+ L+T   +I   ++    + D   K
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK 420

Query: 417 PVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPT--SVSKIVVKKHLAKLISHLKGRNV 474
           P+LICCN+GTDMSIG++L +LC  Y  DW+L TP    V+KI++++HL KLISHL+GRNV
Sbjct: 421 PILICCNTGTDMSIGVILSILCTKYTEDWKL-TPELPEVNKIIIRRHLTKLISHLRGRNV 479

Query: 475 NPPRATLNSVNSYLM 489
           NP RATLNSVNS+LM
Sbjct: 480 NPSRATLNSVNSFLM 494

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/485 (54%), Positives = 347/485 (71%), Gaps = 14/485 (2%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD +   SL  IN+DIKKEY SLRNR+QSIL D  F+   V+P FP YPL+PNERCGLWY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           C+PKDF QTSYFKSTDGHTNQWDFS+RRLN H++P + + NGIIIVDSTRRGK +PDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 126 KTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185
           KTIPIWCAVLN LM        K E L+ PP+ VS+SE  SIK+RIP LV++L+ L++++
Sbjct: 121 KTIPIWCAVLNSLMQPD-----KSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILD 175

Query: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDN-SIIPIILCTVSYQ 244
            ++L  +  GK+LRPFW+YPGS +L+S+TD FTGE+   +W P  N  IIPIILCT SY+
Sbjct: 176 AQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYR 235

Query: 245 AQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLR 304
           AQDGVDKR GFTYVQGAADDHELWS GL+ K+ W+N     + + +++ELE  V  L   
Sbjct: 236 AQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIEL 295

Query: 305 GCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFP 364
                     +D   ++D +T ELSLG + D+    P +  E+    SLVI+LSQSV   
Sbjct: 296 AETTDHRNHLADIV-EMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLS 354

Query: 365 QKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCNS 424
           +         +FI  + LQSGSK SS++L+  L++I  ++  H+     +RKP+++CCNS
Sbjct: 355 KPF-------DFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNS 407

Query: 425 GTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATLNSV 484
           GTD+S+G++L++LC+ Y+ DW L  P SV+K V+++HL ++I+ +K RNVNP RATLNS+
Sbjct: 408 GTDISVGVILMILCKYYSQDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSI 467

Query: 485 NSYLM 489
           NS+LM
Sbjct: 468 NSFLM 472

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/494 (53%), Positives = 356/494 (72%), Gaps = 10/494 (2%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD     SL  IN+D++KE KS+RNRLQSILLD  FL   V+P FP +PLVPNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           C P  + QTSYFKSTDGH NQWDFS+RRLNFH++ TI  + GIIIVDSTRRGKK+PDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 126 KTIPIWCAVLNHLML-ESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184
           KT+PIWCAVLN +ML E++      + LY+PPETV +SE+  IK +IPELV KL+ L +I
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTS-DKW-IPVDNSIIPIILCTVS 242
           + K+L++   GK+LRP W++PGSS+L  + D FTGE+   + W  P D +IIPIILCTVS
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 243 YQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS 302
           YQAQDG+DKR GFTYVQGAADDHELWS GL++K+FW++++ L ++ +S+++L  +++ L 
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 303 LRGCDLSKEIQ----FSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLS 358
            +       IQ      + F ++D +T E+SLG V+  L  N KL  E++  +  V++LS
Sbjct: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360

Query: 359 QSVNFPQK--VAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRK 416
            SV   +   V E   ++ FI+++KLQSG K SS+ L++ L KI   +E    +  ++ +
Sbjct: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 417 PVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPT-SVSKIVVKKHLAKLISHLKGRNVN 475
           P+L+CCN+GTDMSIG++L +LC  Y  +W L      V+KI+++KHL KLISHL GRNVN
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVN 480

Query: 476 PPRATLNSVNSYLM 489
           P RATLNSVNS+LM
Sbjct: 481 PSRATLNSVNSFLM 494

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/488 (54%), Positives = 350/488 (71%), Gaps = 18/488 (3%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD  F  +L  +NK+IKKE K+LRNRLQSIL D+ FL  +VL  FP YPL+PNERCGLWY
Sbjct: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           C+P+ ++QTSYFKSTDGH+NQWDFS RRLN H++PTI +  GI+IVDSTRRGK++PDALS
Sbjct: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146

Query: 126 KTIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVIN 185
           KT+PIWCAVLN +MLE  G   ++E L+ PP TVS SEF  IKSRIP LV + K L +  
Sbjct: 147 KTVPIWCAVLNSIMLE--GRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFT 204

Query: 186 GKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQA 245
             EL K L GK+LRP W+YPG+S+L S  D FTG++ +  W   + + +P++LCTVSYQ 
Sbjct: 205 SDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWEAQNENFMPVVLCTVSYQC 264

Query: 246 QDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRG 305
           QDGVDKR GFTYVQGAADDHELW+ GL A++FW +I+I  +   S++EL  +V+ L   G
Sbjct: 265 QDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSG 324

Query: 306 ---CDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVN 362
                L+K ++  D     +L T EL LG V +N+E +  L+ +++  +SLV++LS S++
Sbjct: 325 DANNKLTKSLRLDDMLNANEL-TRELHLGQVAENIELDKNLVDQLKLKYSLVVLLSTSIS 383

Query: 363 FPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICC 422
             ++       +E I I KLQSGSK SSR L+  L +I PLIE ++    +   PVLICC
Sbjct: 384 VYEE-------AENIRIFKLQSGSKKSSRALRAALTQICPLIEANL----QNSLPVLICC 432

Query: 423 NSGTDMSIGLLLVVLCRNYNMD-WQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATL 481
           N+G DMS+ ++L VLCRN+N++ WQL    SV K ++KKHLAK+I+ L GRN+NPPR +L
Sbjct: 433 NNGKDMSVCVVLSVLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSL 492

Query: 482 NSVNSYLM 489
           NSVN YLM
Sbjct: 493 NSVNDYLM 500

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/488 (52%), Positives = 348/488 (71%), Gaps = 15/488 (3%)

Query: 7   DNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYC 66
           D + +D+L+ I K+I+++  SLRNRLQS+  D  F+  EVLP FP YPLVPNERCGLWYC
Sbjct: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62

Query: 67  NPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSK 126
           NP  + QT YFKSTDGHTNQWDFS+RRLNFHI+  +A++ GIIIVDSTRRGKK+PDALSK
Sbjct: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122

Query: 127 TIPIWCAVLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVING 186
           TIPIWCAVLN+LML+ +G      +L+ PP TVS+ EF  I S++P+LVEKLK L +I+G
Sbjct: 123 TIPIWCAVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISG 182

Query: 187 KELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQAQ 246
           +EL+    GK+LRPFW+YPGS +L ++ DIFTGEV  + W    NS IP+ILCT SYQ Q
Sbjct: 183 EELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSEQNS-IPVILCTASYQCQ 241

Query: 247 DGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLS---- 302
           DG DK  GFTYVQGAADDHELW++GLN +IFW NI+ LG+ + SE ELE FV ++     
Sbjct: 242 DGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRTEK 301

Query: 303 -LRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSV 361
                +   + + S +F ++D +T  L LG V + +     +  E++  +SL I+ SQSV
Sbjct: 302 LTAQSNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSV 361

Query: 362 NFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLIC 421
                 A+ +   E I ++ + + SK SSR+L+  L++I  LI++HI D    + P+LIC
Sbjct: 362 -----TAKADCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITD----QLPILIC 412

Query: 422 CNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATL 481
           CN+G D+SIG++L  LC++Y++ W L    +V+K +VKKHLA++I+ L G N+NP R+TL
Sbjct: 413 CNTGKDISIGIMLTALCQHYDLQWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTL 472

Query: 482 NSVNSYLM 489
            +VN++L+
Sbjct: 473 KNVNAFLL 480

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/489 (54%), Positives = 345/489 (70%), Gaps = 13/489 (2%)

Query: 13  SLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKDFT 72
           S+  I KDI+KE KSL+NR+ SILLD  FL  +V+P FP YPLVPNERCGLWYC   +FT
Sbjct: 6   SVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANFT 64

Query: 73  QTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPIWC 132
            TSYFKSTDGH NQWDFS+RRLNFH+IP I +  GIII+DSTRRGKK+PDALSKT+PIWC
Sbjct: 65  TTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIWC 124

Query: 133 AVLNHLMLE--SQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKELH 190
           AVLN ++L+         +E L+VPP TVS+SE+  IK++IPELVEKL  L+VI+GK+L+
Sbjct: 125 AVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKLY 184

Query: 191 KQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSD-KW--IPVDNSIIPIILCTVSYQAQD 247
           +Q  G LLRP WI+PGSSILQS  D FTGE+ S+  W     +  IIPI+LCTVSYQ QD
Sbjct: 185 EQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQD 244

Query: 248 GVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCD 307
           GVD R GFTYVQGAADDHELWSHGL+ ++FW NI++L N E SEE LE +V ++ L    
Sbjct: 245 GVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLSESM 304

Query: 308 LSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFP--- 364
               ++    F  ID +T EL LG ++D LE    L+    +++SLVI+LS S+      
Sbjct: 305 KITNLEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIKLASDE 364

Query: 365 ---QKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLIC 421
              Q      + +  I + +LQSGSK SS+ L++ L +I  L+   +      +KP+L+C
Sbjct: 365 QNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKKPILVC 424

Query: 422 CNSGTDMSIGLLLVVLCRNYNMDWQLNTP-TSVSKIVVKKHLAKLISHLKGRNVNPPRAT 480
           CN+G+DMSI ++LV L + Y  +W+  +  T ++KI ++KHL K+ISHL GRNVNP RAT
Sbjct: 425 CNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRNVNPSRAT 484

Query: 481 LNSVNSYLM 489
           LNSVN +LM
Sbjct: 485 LNSVNDFLM 493

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  504 bits (1299), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 258/498 (51%), Positives = 346/498 (69%), Gaps = 23/498 (4%)

Query: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65
           MD   +  ++ I+K+++KE KSL+NRLQSI+ D  FL  +V P F +YP+VPNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125
           C+PK +  TSYFKSTDGH NQWDFS+RRLNFH++P + ++ G++I+DSTRRGKK+PDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 126 KTIPIWCAVLNHLMLESQGGS--VKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEV 183
           KT+PIWCAVLN+LMLE+ G     ++E L+VPP TV ESEF  + +++PELV+KLK L++
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 184 INGKELHKQL-----GGKLLRPFWIYPGSSILQSTTDIFTGEVTSD-KWIPVDNSIIPII 237
           I+ K+L K L       KLLRP W+YPGSS+LQ   D+F+GEV  +  W P  N IIP+I
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPPSN-IIPVI 238

Query: 238 LCTVSYQAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERF 297
           LCTVSYQ QDG DKR GFTYVQGAADDHELW+  L  ++FW NID LG+   S+ EL+  
Sbjct: 239 LCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKDS 298

Query: 298 VSQLSLRG-----CDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHS 352
            + + LR       D+S +I       +ID +T  L LG +       PK +  + Q +S
Sbjct: 299 YNAVILRAKVQNSLDISGDIS---KMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYS 355

Query: 353 LVIVLSQSVNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLD 412
            V++  ++++    V E+      I I  L SGSK SSR L++ L+KI  LIE+ +   D
Sbjct: 356 AVVLCHEAIS----VTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPD 411

Query: 413 KQRK-PVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKG 471
                P+LI C+SG D+S+ +LLV LC+ YN+DW+L    SV+K ++KKHLAK+I  L+G
Sbjct: 412 TAANLPILIACDSGKDISVSILLVALCKYYNLDWELQPQDSVNKTIIKKHLAKIIESLQG 471

Query: 472 RNVNPPRATLNSVNSYLM 489
           RNVNP RA+LNSVNS+LM
Sbjct: 472 RNVNPSRASLNSVNSFLM 489

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  396 bits (1017), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 199/417 (47%), Positives = 278/417 (66%), Gaps = 14/417 (3%)

Query: 74  TSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPIWCA 133
           T YFKSTDGH N WDFS RRLNFH++P +A+ +G IIVDSTRRGKK+PDALSKTIPIWCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 134 VLNHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKELHKQL 193
           VLN L+LE   GS   E L+ PP TVS+ E+  I++++PELV+KLK ++ I+G EL   L
Sbjct: 65  VLNTLILEHTEGS--GEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSLL 122

Query: 194 GGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVDNSIIPIILCTVSYQAQDGVDKRR 253
           GG+LLRPFW+YPG+++L +T D+FTGE   + W P    +IP+ILCT S Q QDGVDK +
Sbjct: 123 GGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQP-PPGVIPLILCTASRQCQDGVDKSQ 181

Query: 254 GFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL-SLRGCDLSKEI 312
           G+ YVQGAADDHELW++GL   +FW+N+ +L +    E+ L+  V ++  L     ++ +
Sbjct: 182 GYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTHTEAV 241

Query: 313 QFSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFPQKVAEMEN 372
                  + D+VT  L LG V    + + K    + Q +SLV++   S+           
Sbjct: 242 AHELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSAAAPHPR- 299

Query: 373 ASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCNSGTDMSIGL 432
               I I+ L SG K SSR L+  L++I+PLI   +     +  PVLICC+SG+D+S+G+
Sbjct: 300 ----IRIYPLNSGCKKSSRALRPALIEIIPLISTALC----EALPVLICCSSGSDISVGI 351

Query: 433 LLVVLCRNYNMDWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATLNSVNSYLM 489
           +L  LC+NY+++W+      ++K ++KKHL KL S + GR +NP R TLNSVN++LM
Sbjct: 352 VLAALCKNYDLEWRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>Kwal_34.15761 s34 complement(47913..49667) [1755 bp, 584 aa] {ON}
           YHL038C (CBP2) - Cytochrome B pre-mRNA processing
           protein [contig 274] FULL
          Length = 584

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/126 (20%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 279 SNIDILGNQESSEEELERFVSQLSLRGCDLSKEIQFSDAFPQIDLVTPELSLGLVIDNLE 338
           SN++ +    ++++E + F+ +L++    ++ E++ +    +  L++ ++++  V+D + 
Sbjct: 379 SNMNSINTIVAAKKEFDEFLQELNIYNVIINAELRAASKTEKSTLLSRQVNIVRVLDTVF 438

Query: 339 FNPKLIGEIRQAHSL----VIVLSQSVNFPQKVAEMENASEFISIHKLQSGSKVSSRNLK 394
            + K IGE+  + SL     ++    ++ PQ    + +A E  +I  +++  +  S+ LK
Sbjct: 439 LHCKFIGELYPSFSLELQSAVIKGNMIDVPQNEQVLGDAGEIFAI--VRALVEFESQTLK 496

Query: 395 T-ELLK 399
           T EL++
Sbjct: 497 TPELMR 502

>KLLA0A10571g Chr1 (922516..924201) [1686 bp, 561 aa] {ON} weakly
           similar to uniprot|P38229 Saccharomyces cerevisiae
           YBR045C GIP1 Meiosis-specific protein proposed to be a
           regulatory subunit of the protein phosphatase Glc7p,
           required for spore wall formation and proper septin
           organization
          Length = 561

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 13/95 (13%)

Query: 98  IIPTIAKSNGIIIVDSTRRGKK----VPDALSKTIPIWCAVLNHLMLESQGGSVKQETLY 153
           +IP+ +      I  +T +G++     PD  SK+  ++ A+ N  +     GS  Q+   
Sbjct: 176 VIPSSSDVLKTKIATATEKGQREGQLSPDNHSKSSGVYRALANQAISYCNSGSATQK--- 232

Query: 154 VPPETVSESEFYSIKSRIPELVEKLKSLEVINGKE 188
                 S S  Y   S +P+L+  L+SL  ++GK+
Sbjct: 233 ------SSSYEYGNPSALPDLLYGLESLPTVSGKD 261

>NDAI0H02800 Chr8 complement(688625..691231) [2607 bp, 868 aa] {ON}
           Anc_2.413 YMR125W
          Length = 868

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 399 KIVPLIEKHILDLDKQRKPVLICCNSGTDMSIGLLLVVLCRNYNMDWQLNTPTSVSKIVV 458
           K+  ++   I DL  Q    ++  N  +DM I    V   R +N+ W+  T TS  K ++
Sbjct: 768 KLCIIVNGTIKDLGVQEDEDIVVPNVSSDMDIDFTDVNESRRFNLSWKYATVTSFIKSLL 827

Query: 459 KKH 461
           +K+
Sbjct: 828 RKY 830

>TBLA0E01070 Chr5 (239221..240060) [840 bp, 279 aa] {ON} 
          Length = 279

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 370 MENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCNSGTDMS 429
             +  +F SI  LQ  SK + +   +E L      + +  D   Q K VLICC +G  + 
Sbjct: 70  FSSGGDFSSITSLQYKSKDALKTWVSEYLSR----DLYTCDQFYQHKKVLICCLNGPAVG 125

Query: 430 IGLLLVVLC 438
           +   LV LC
Sbjct: 126 LSAALVALC 134

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 136 NHLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIP 172
           N+ + E+ GGS    TL +PP  VS+ E  + +SR+P
Sbjct: 37  NNAVAENMGGSYIAPTLSIPPRKVSKKEKKANRSRLP 73

>TDEL0H02930 Chr8 complement(488780..489397) [618 bp, 205 aa] {ON}
           Anc_7.130 YIL007C
          Length = 205

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 291 EEELERFVSQLSLRGCDLSKEIQFSDAFPQIDLVTPELS-----LGLVIDNLEFNPKLIG 345
           E EL+R   +L   G DLS  +   D FP+ D+   E+      L ++ ++L        
Sbjct: 38  ESELDRNFDRLKGHGADLSSPLITEDGFPRQDIDVLEVRLLRNYLNMLRNDLRAVIDRSQ 97

Query: 346 EIRQAHSLVIVLSQSVNFPQKVAEM 370
            +   HS + V SQ+ + P   AE+
Sbjct: 98  PLLATHSSLPVASQTTSTPTAFAEI 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,187,118
Number of extensions: 2326536
Number of successful extensions: 7036
Number of sequences better than 10.0: 36
Number of HSP's gapped: 7138
Number of HSP's successfully gapped: 36
Length of query: 489
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 375
Effective length of database: 40,409,475
Effective search space: 15153553125
Effective search space used: 15153553125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)