Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A039205.528ON46646620480.0
SAKL0G04950g5.528ON5675667212e-88
KNAG0B036805.528ON4824777082e-87
ZYRO0D12584g5.528ON5793205652e-65
KAFR0C054005.528ON4812894692e-52
TPHA0K005205.528ON5605484663e-51
NDAI0C010605.528ON6373334465e-48
KLTH0G03784g5.528ON5693394163e-44
Smik_13.1445.528ON6393144184e-44
Suva_13.1555.528ON6453104132e-43
NCAS0H025605.528ON5873564102e-43
Skud_13.1475.528ON6652893861e-39
CAGL0H04631g5.528ON5883493822e-39
KLLA0A01760g5.528ON5831503363e-33
YML007W (YAP1)5.528ON6502143251e-31
TPHA0D023405.528ON5062533104e-30
Kpol_1023.975.528ON5911543037e-29
Kwal_47.186315.528ON584672958e-28
Kpol_1004.225.528ON475632583e-23
TBLA0G009305.528ON608542504e-22
NDAI0H016105.528ON5193242319e-20
NCAS0F011005.528ON4751062174e-18
Ecym_40645.528ON4261192085e-17
TBLA0D016405.528ON599601972e-15
ADR195C5.528ON288941842e-14
KAFR0E032905.528ON265911672e-12
CAGL0F03069g5.528ON486861686e-12
Smik_4.6985.528ON393921533e-10
YDR423C (CAD1)5.528ON409921533e-10
KNAG0C032105.528ON3841001453e-09
Suva_2.600singletonOFF382991355e-08
YPR199C (ARR1)na 1ON29495870.031
Skud_4.699singletonOFF5632740.13
YHL009C (YAP3)2.493ON330110820.14
Smik_8.332.493ON33172800.25
NDAI0B018002.493ON44664800.27
Suva_8.432.493ON33065790.34
Kwal_56.241726.241aON99482800.37
SAKL0E02420g2.493ON32298770.55
Skud_13.6singletonON31096770.55
KNAG0B031905.619ON27861760.68
KNAG0D009606.241aON989108761.1
KLTH0D05918g2.493ON31063751.1
CAGL0K02585g2.493ON36862722.9
Ecym_24302.493ON30862713.0
CAGL0M10087g2.493ON36859713.2
KLLA0E00265gna 1ON28830704.0
KAFR0F012706.241aON99376714.7
Skud_8.362.493ON332106694.9
KLLA0B13695g2.493ON37573695.3
KNAG0C056802.493ON35964687.1
Kwal_26.78482.493ON29129687.9
NCAS0A08020singletonON23871678.0
NOTE: 1 genes in the same pillar as TDEL0A03920 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03920
         (466 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   793   0.0  
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   282   2e-88
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   277   2e-87
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   222   2e-65
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   185   2e-52
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....   184   3e-51
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   176   5e-48
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   164   3e-44
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   165   4e-44
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   163   2e-43
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   162   2e-43
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   153   1e-39
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   151   2e-39
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   134   3e-33
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   129   1e-31
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   124   4e-30
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   121   7e-29
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   118   8e-28
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   103   3e-23
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   100   4e-22
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    94   9e-20
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    88   4e-18
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    85   5e-17
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    80   2e-15
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    75   2e-14
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    69   2e-12
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    69   6e-12
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    64   3e-10
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    64   3e-10
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    60   3e-09
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    57   5e-08
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    38   0.031
Skud_4.699 Chr4 complement(1239478..1239576,1239580..1239648) [1...    33   0.13 
YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}  YAP...    36   0.14 
Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON} YH...    35   0.25 
NDAI0B01800 Chr2 (429150..430490) [1341 bp, 446 aa] {ON} Anc_2.4...    35   0.27 
Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON} YH...    35   0.34 
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    35   0.37 
SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {O...    34   0.55 
Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)      34   0.55 
KNAG0B03190 Chr2 (618434..619270) [837 bp, 278 aa] {ON} Anc_5.61...    34   0.68 
KNAG0D00960 Chr4 (154539..157508) [2970 bp, 989 aa] {ON}               34   1.1  
KLTH0D05918g Chr4 (526400..527332) [933 bp, 310 aa] {ON} some si...    33   1.1  
CAGL0K02585g Chr11 complement(233972..235078) [1107 bp, 368 aa] ...    32   2.9  
Ecym_2430 Chr2 (837395..838321) [927 bp, 308 aa] {ON} similar to...    32   3.0  
CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} som...    32   3.2  
KLLA0E00265g Chr5 (12033..12899) [867 bp, 288 aa] {ON} weakly si...    32   4.0  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               32   4.7  
Skud_8.36 Chr8 complement(72120..73118) [999 bp, 332 aa] {ON} YH...    31   4.9  
KLLA0B13695g Chr2 complement(1199239..1200366) [1128 bp, 375 aa]...    31   5.3  
KNAG0C05680 Chr3 complement(1096585..1097664) [1080 bp, 359 aa] ...    31   7.1  
Kwal_26.7848 s26 (539163..540038) [876 bp, 291 aa] {ON} YHL009C ...    31   7.9  
NCAS0A08020 Chr1 (1585065..1585781) [717 bp, 238 aa] {ON}              30   8.0  

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/466 (84%), Positives = 396/466 (84%)

Query: 1   MERALPPLIXXXXXXXXXXXXXXXXXXXVKRPLEQSSSPMAPAAKGSKPGRKPLDEETKN 60
           MERALPPLI                   VKRPLEQSSSPMAPAAKGSKPGRKPLDEETKN
Sbjct: 1   MERALPPLISRTSTRSNTSSMSAMSASTVKRPLEQSSSPMAPAAKGSKPGRKPLDEETKN 60

Query: 61  KRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKYR 120
           KRTAQNRAAQRAFR             VQSLEQANRDTVVESEFLRSQLLTLVNELKKYR
Sbjct: 61  KRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQLLTLVNELKKYR 120

Query: 121 PAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHFXXXXX 180
           PAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHF     
Sbjct: 121 PAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHFPSPGS 180

Query: 181 XXXXXXXXXXXXXXXXXNKXXXXXXXXXXXXXXXXGWMDNVFYSDDAQKLPQFAIKGDST 240
                            NK                GWMDNVFYSDDAQKLPQFAIKGDST
Sbjct: 181 SMLSSSSASVNSAASPSNKRRSTASRSTSTSTSTTGWMDNVFYSDDAQKLPQFAIKGDST 240

Query: 241 ADPLFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWD 300
           ADPLFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWD
Sbjct: 241 ADPLFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWD 300

Query: 301 TVASPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAE 360
           TVASPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAE
Sbjct: 301 TVASPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAE 360

Query: 361 LLDEVEPTDNNFVNENLINEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRI 420
           LLDEVEPTDNNFVNENLINEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRI
Sbjct: 361 LLDEVEPTDNNFVNENLINEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRI 420

Query: 421 TTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHMDV 466
           TTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHMDV
Sbjct: 421 TTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHMDV 466

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  282 bits (721), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 210/566 (37%), Positives = 263/566 (46%), Gaps = 157/566 (27%)

Query: 30  KRPLEQSSSPMAPAAK-----GSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXX 84
           KRPL+  + P A A +      SKPGRKPL  E KNKRTAQNRAAQRAFR          
Sbjct: 27  KRPLD--NEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKEL 84

Query: 85  XXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTE---- 140
              V  LE       VE+EFLRSQL+TL++ELKKYRP ++ D QVL+YLAK E  +    
Sbjct: 85  EDKVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNS 144

Query: 141 --------------------PTDKEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHFXXXXX 180
                                ++  I  ++QKKMDFTF FPWKD     A    F     
Sbjct: 145 QDRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDN----AGRTQFPSPGS 200

Query: 181 XXXXXXXXXXXXXXXXXNKXXXXXXXXXXXXXXXXGWMDNVFYSDDAQKLPQFAI----K 236
                            N                     ++FY DDA  LP+F      +
Sbjct: 201 SSVSSNHKPSFSSNAPFNATNNTPSTSSASL--------DMFYQDDA--LPKFTSSSLER 250

Query: 237 GDST---ADPLFS--NEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQV-- 289
           G+++   AD  FS  N+F+F+  FDEQVS+FCT+MN+ACGTR+ P+P    Q  S Q   
Sbjct: 251 GNNSGTIADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVP----QTLSNQSSS 306

Query: 290 ----------------------------------ASPQI---LTNSWDTVASPAFGQ--- 309
                                             +SPQ    LTN+W+T   P+FG    
Sbjct: 307 TTTPITMTTTTRHDTATAPAPAPALAPEEPNAASSSPQAGLNLTNTWET---PSFGNLGF 363

Query: 310 ---------------------------QSLAPSKKQLTKTPPSQPE--LPFIDPTMAFPT 340
                                        L PS        PS     LPFID ++AFPT
Sbjct: 364 GGDGDSHGNGDGHGHGNGDDSNKWLFTSDLGPSPGAAAANTPSNSADILPFIDTSIAFPT 423

Query: 341 DDDEGLFFRTHRDENS--LFAELLDEVEPTDNNFVNENLI-------------------- 378
           + +E L FR     NS  +F E L+E +P  +    E  +                    
Sbjct: 424 EQNE-LVFRDTAANNSSTVFDEFLEE-DPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEE 481

Query: 379 NEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGEL 438
           N+   TT  +++E+   P    DVVPSRDGKLLKC E+WDRIT+HPKYS +DIDGLC EL
Sbjct: 482 NKGNYTTLPLSQESS-NPLVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMEL 540

Query: 439 MTKAKCSEKGVVVQAEDVQRVLDKHM 464
            TKAKCSEKGVVV A+DVQ+ L KHM
Sbjct: 541 RTKAKCSEKGVVVNADDVQKALAKHM 566

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  277 bits (708), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 240/477 (50%), Gaps = 60/477 (12%)

Query: 31  RPLEQSSSPMAPAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQS 90
           R LE   S   P  K +    KPLD+E + KRT QNRAAQRAFR             V  
Sbjct: 22  RDLEVVDSGAEPLKKRTHTASKPLDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDK 81

Query: 91  LEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKEIEQSV 150
           L +  +   VESEFLR QL+TLV+ELKKYRP  +ND +VL+YLAKH+   P  +    + 
Sbjct: 82  LTRIQKQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLAKHDNVPPNQQGQAPAA 141

Query: 151 QKKMDFTFAFPWKDRKEAEAQAQHFXXXXXXXXXXXXXXXXXXXXXXNKXXXXXXXXXXX 210
           + + DF+F FPWK R   E                                         
Sbjct: 142 RDRGDFSFEFPWKGRTAPEFD-----------------NSTTQETTTATPSPVSPGTKDQ 184

Query: 211 XXXXXGWMDNVFYSDDA-QKLPQFAIKGDSTADPLF---------SNEFNFDDQFDEQVS 260
                 W+D V  S +   K  Q  ++G+ +  P           SNE  FD QFDEQVS
Sbjct: 185 QGKPTDWLDEVLSSTELYAKQQQQQLQGNRSESPFLAGYDDSLTVSNEITFDTQFDEQVS 244

Query: 261 QFCTKMNKACGTRECPIP-GFTPQMASPQVASP----QILTNSWDTVASPAFGQQSLAPS 315
            FC +MN+ACG++  P+P      + S  V SP      L+N+W T  + A    S   S
Sbjct: 245 DFCVRMNEACGSKTNPVPKSKKGSVFSNSVLSPPSLLNSLSNTWGTDRTDAGSATSETTS 304

Query: 316 KKQLTKTPPSQP-----------ELPFIDPTMAFPTDD-------DEGLFFR-THRDENS 356
            +    +  +             E+PFI+ ++AFPTDD       D+ +FFR T  ++ S
Sbjct: 305 PRLTESSSSTVTTNNDLKLDADFEIPFINTSLAFPTDDGAVPQTVDDNIFFRDTQHEQRS 364

Query: 357 LFAELLDEVEPTDNNFVNEN------LINEEPSTTTAVAE---ETRPKPKTETDVVPSRD 407
              + L+E E TDN    ++      LINE P +  A  E      P    +  VVPS+D
Sbjct: 365 ALDDFLEEEELTDNQQQQQHEEKINLLINEVPFSIEADKEVPFSIEPNEDGDPQVVPSKD 424

Query: 408 GKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           GKLLKCSE+WDRIT HPKYS +DIDGLCGELMTKAKCSE+GVVV A+DV+  L++H+
Sbjct: 425 GKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALNRHI 481

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  222 bits (565), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 175/320 (54%), Gaps = 75/320 (23%)

Query: 216 GWMDNVFYSDDAQKLPQFAIKG----------DSTADP------LFSNEFNFDDQFDEQV 259
           GWMDNVFY+DDA++LPQF              D+T  P       FSN+FNF+D+FDEQV
Sbjct: 265 GWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQV 324

Query: 260 SQFCTKMNKACGTRECPIP-GFTPQMASPQV-ASPQILTNSWDTVAS------PAFGQQS 311
           S+FCTK+ + CGT++CPIP       +SP V  SP + +N+WDT +       P   +  
Sbjct: 325 SEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIVFSNTWDTPSEDPQQQLPTLEENL 384

Query: 312 LAPSKKQLT-------------------KTPPSQPELPFIDPTMAFPTDDDEGLFFRTHR 352
             PS +Q                      +P    ELPFID ++AFP + D    FR  +
Sbjct: 385 SDPSIRQTNAYSNTDGGDGDDEGIVVSMNSPEKNSELPFIDTSLAFPEEQD---LFREQQ 441

Query: 353 DENSLFAELLDE-------------VEPTDNNFVNENLINEEPSTTTA------------ 387
            +N +FAE ++                P  + F+   ++ EEP+ TT             
Sbjct: 442 PDN-MFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQEEPAVTTGEVKDNTNDNVKD 500

Query: 388 --VAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCS 445
             + +E +  P ++  VVPS DGKLLKCSEVWDRIT+HPKYS +DIDGLC ELM KAKCS
Sbjct: 501 GKIQDEGKEAPNSDV-VVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCS 559

Query: 446 EKGVVVQAEDVQRVLDKHMD 465
           E+GVVVQAEDVQ  L+  ++
Sbjct: 560 ERGVVVQAEDVQYALNNRVE 579

 Score =  147 bits (372), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 91/133 (68%), Gaps = 10/133 (7%)

Query: 42  PAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVE 101
           P  KG KPGRKPLD E K+KRTAQNRAAQRAFR             V +LE+ N+ ++VE
Sbjct: 32  PRKKGGKPGRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVE 91

Query: 102 SEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTD----------KEIEQSVQ 151
           +EFLRSQL+TLV ELK+YRP   ND QVL YLAK E ++  D          KEIE+SV+
Sbjct: 92  TEFLRSQLVTLVTELKRYRPENPNDSQVLQYLAKTENSKSDDSSQNKKDSESKEIEESVR 151

Query: 152 KKMDFTFAFPWKD 164
           +KM FTFAFPWK+
Sbjct: 152 RKMSFTFAFPWKN 164

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  185 bits (469), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 155/289 (53%), Gaps = 67/289 (23%)

Query: 216 GWMDNVFYSDDA--QKLPQFA----IKGDS-------TADPLFSNEFNFDDQFDEQVSQF 262
            W+DN+ +++D   ++L  F+     + DS       T   L SNEFNF+DQFDE+V+ F
Sbjct: 219 NWLDNMLHTEDLFNEQLSSFSNTPISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDF 278

Query: 263 CTKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWDTVASPAFGQ---QSLAPSKKQL 319
           C KMN+ CGTR  PIP  +     P   S  + TN++D   SP+FGQ   Q++  +    
Sbjct: 279 CIKMNQVCGTRSNPIPKKSTSNL-PSTESTPLFTNTFD---SPSFGQLNIQNIESTNSDN 334

Query: 320 TK---TPPSQPELPFIDPTMAFP--TDDDEGL------------------FFRTHRDENS 356
           T    TP       F++P++AFP  T  +  L                   FR    + S
Sbjct: 335 TNNDTTPDDNGIFSFLNPSLAFPSSTSPENSLSDGSINNNIDNNNNSSLNNFR----DTS 390

Query: 357 LFAELL-DEVEPTDNNFVNENLINEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSE 415
           +F + L  E EP+      E+LINEE                   DVVPS+D  LL+CSE
Sbjct: 391 IFDDFLKHEAEPSV-----EDLINEEIDDIN--------------DVVPSKDKNLLRCSE 431

Query: 416 VWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           VWDRIT HPKYS IDIDGLCGELM KAKCSEKGVVV AEDVQ  L KH+
Sbjct: 432 VWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480

 Score =  120 bits (300), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 83/145 (57%), Gaps = 14/145 (9%)

Query: 29  VKRPLEQSS---------SPMAPAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXX 79
            KRPLE ++         + +      SK  R  LD+E K KRTAQNRAAQRAFR     
Sbjct: 8   TKRPLESTTSTDNDTDDKNAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQRAFRERKER 67

Query: 80  XXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERT 139
                   V  L    +   +ESEFLRSQL+TLV ELKKYRP  AND QVL+YLAKHE  
Sbjct: 68  KMKELEAKVDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE-- 125

Query: 140 EPTDKEIEQSVQKKMDFTFAFPWKD 164
              +    +++ KK +F+FAFPW D
Sbjct: 126 ---NGNFNENLSKKSNFSFAFPWDD 147

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score =  184 bits (466), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 159/548 (29%), Positives = 229/548 (41%), Gaps = 149/548 (27%)

Query: 48  KPGRKPL-DEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLR 106
           K GRK L D + K+KRT QNR AQRAFR             V +LEQ N    +E+ FLR
Sbjct: 29  KVGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLR 88

Query: 107 SQLLTLVNELKKYRPAKANDLQVLDY------LAKH------------------------ 136
           S+L ++ +ELKKYRPA+++DL+VL+Y      LAK+                        
Sbjct: 89  SRLKSMADELKKYRPAQSSDLEVLEYLAKKEQLAKYNHNANPIKEEEEVKEEEEDEEGEE 148

Query: 137 ------------ERTEPTDKEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHFXXXXXXXXX 184
                       + +    +EI  +++KK DFTF +P +++  +   +            
Sbjct: 149 GGDNIHANQSFEQESAKQKQEILSNIEKKKDFTFEYPKQNKMPSPESSTS-------ITS 201

Query: 185 XXXXXXXXXXXXXNKXXXXXXXXXXXXXXXXGWMDNVFYSDDAQKLPQF----------- 233
                                           W+  VFY D+A++LPQF           
Sbjct: 202 SVVTSGKYNVQLQQGSVNNQVTTPDSSVSSSTWIHPVFYEDNAKQLPQFEQPKAVPTNMD 261

Query: 234 -----AIKGDSTAD------------------PLFSNEFNFDDQFDEQVSQFCTKMNKAC 270
                +    ST+D                   LFSN+FNFDD+F +QVS FC K+N   
Sbjct: 262 VSPANSDINQSTSDIVPGSAKSFDAIPFGYDSSLFSNDFNFDDKFSDQVSSFCDKVNN-- 319

Query: 271 GTRECPIPGFTPQMAS-PQVASPQILTNSWD-TVASP----AFGQQSLA----------- 313
                  P ++P+  S P + S      S + T+A P     FG++              
Sbjct: 320 -------PNYSPENNSLPSLVSENYNAESHNNTIALPDTTTEFGKKGFEFANSDATDTFS 372

Query: 314 ----------PSKKQLTKTPPSQPELP---------------FIDPTMAFPTDD------ 342
                     PS K    T   Q  +P               FI+ ++AFP         
Sbjct: 373 WNSGAFHEDDPSSKLFIDTLDKQYAVPTSDASIANDFSKANNFIESSLAFPESTASVANS 432

Query: 343 -DEGLFFRTHRDENSLFAELLDEVEPTDN-----NFVNENLINEEPSTTTAVAEETRPKP 396
            +  L+FR    +N++    L   +  D      + +  NL+ EE         +   K 
Sbjct: 433 MNGNLYFRDSNIDNTIDMLDLLADDDDDEDEVDESLIKNNLVTEECMDDAQAKSQLCDKY 492

Query: 397 KTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDV 456
           K    V+ + DG  LKCS+VW R+T HPKYS +DIDGLC ELM +AKCSEKGVVV++ DV
Sbjct: 493 KNT--VIRAEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDV 550

Query: 457 QRVLDKHM 464
           Q+ L K++
Sbjct: 551 QKALSKYL 558

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  176 bits (446), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 154/333 (46%), Gaps = 115/333 (34%)

Query: 244 LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASP---------------- 287
           L SN F+F+D+FDEQVS FC KM+ ACGTR  PIP     +++P                
Sbjct: 307 LISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPISPLN 366

Query: 288 ------------------QVASPQI----LTNSWDT-VASPA------------------ 306
                             Q  +PQ     LTN+W    ASP                   
Sbjct: 367 DSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIPSASPNSNDSSPNNIVPTQDNSNV 426

Query: 307 ---FGQQ--------------SLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFR 349
              FGQ               SL     + + +   +P LPFI+PT+AFP DD   LF +
Sbjct: 427 NMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPNDD---LFNK 483

Query: 350 TH------------RDENSLFAELL-DEVEPT--DNNFVN------------------EN 376
            +             DE+ L ++ L ++   T   NN +N                   N
Sbjct: 484 NNSNNDNNNNTTTTHDESDLLSQFLANDYSNTISTNNLMNSDDDEDEDDDDYEKKLVANN 543

Query: 377 LINEEPSTTTAVAEETRPKPKTETD-----VVPSRDGKLLKCSEVWDRITTHPKYSAIDI 431
           LINEEPS+T      T    + E +     +VPSRDG LL+CSE+WDRIT HPKYS +DI
Sbjct: 544 LINEEPSSTNKNNNLTSTSKEQENNDFDDFIVPSRDGGLLRCSEIWDRITAHPKYSELDI 603

Query: 432 DGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           DGLC ELMTKAKCSE+GVVV AEDVQ  L KHM
Sbjct: 604 DGLCSELMTKAKCSERGVVVNAEDVQMALTKHM 636

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 58/90 (64%)

Query: 44  AKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESE 103
           + G+   ++ LD E +NKRTAQNRAAQRAFR             V +L +  +   +ESE
Sbjct: 62  SNGNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESE 121

Query: 104 FLRSQLLTLVNELKKYRPAKANDLQVLDYL 133
           FLRSQL+TLVNELKKY+P   N  +VL+Y+
Sbjct: 122 FLRSQLITLVNELKKYKPNNENASKVLNYI 151

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  164 bits (416), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 163/339 (48%), Gaps = 101/339 (29%)

Query: 216 GWMDNVFYSDDA---QKLPQFAIKGDSTADPLFSNEFNFDDQFDEQVSQFCTKMNKACGT 272
           G +D  F  D A   Q LP+F        D      F+F+  FDEQVS FCT+MN+ CGT
Sbjct: 241 GSLD--FLGDSASNTQSLPKFPTSESGNGD------FDFNTHFDEQVSVFCTQMNEVCGT 292

Query: 273 RECPIP---------GFTPQMASP-QVASPQILT----------------------NSWD 300
           RECP+P           TP+  SP Q   P++                        N+WD
Sbjct: 293 RECPLPQALPPSTAASVTPRPISPIQEEQPELSKPAQAKIPAADAFLKQAQQQQPPNAWD 352

Query: 301 TVASPAFGQQSLA-----PSKKQL------------TKTPPSQPE-LPFIDPTMAFPTDD 342
              SP FG          P+ + L             + P ++ + +PFID +MAFPTD 
Sbjct: 353 ---SPQFGHSGFGMGTEDPTNRWLFPDFSSGNMSSTVRAPSAKIDSVPFIDTSMAFPTDQ 409

Query: 343 DEGLFFRTHRD-------ENSLFAELLDE----------VEPTDNNFVNENLINE----- 380
            + L  +   D       E+ + ++L  E          ++P+ ++  +++ ++      
Sbjct: 410 PDALLPQNSDDVLNQFFEEDPIVSQLTTEESNYDPFKPDLQPSADSETSKHSVSSCSNDS 469

Query: 381 -----EPSTTTAVAEETRPKPKT----------ETDVVPSRDGKLLKCSEVWDRITTHPK 425
                E + +TA+ E      KT          + DVVP+RDG LLKCSE+WDRIT HPK
Sbjct: 470 DPSRAESNASTALTEPNYTIDKTSVPSAVLAAEDADVVPARDGLLLKCSEIWDRITAHPK 529

Query: 426 YSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           YS IDIDGLC EL TKAKCSEKGVVV ++DVQ  L KHM
Sbjct: 530 YSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALAKHM 568

 Score =  113 bits (282), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 29  VKRPLEQSSSPM-APAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXX 87
           VKR LE S+ P   P  KGSKPGRKPLD E KNKRTAQNRAAQRAFR             
Sbjct: 4   VKRQLEASTPPADLPKRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQ 63

Query: 88  VQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHE 137
           V+ LE+    + +ESEFLRSQL  L+ E++KYRP +++D QVL YLA+ E
Sbjct: 64  VERLEKVREQSEMESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLAEAE 113

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  165 bits (418), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 150/314 (47%), Gaps = 54/314 (17%)

Query: 42  PAAKGSKPGRK-PLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVV 100
           P  KG+K  +K  LD ETK KRTAQNRAAQRAFR             VQSLE   +   V
Sbjct: 49  PKRKGTKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEV 108

Query: 101 ESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAK-------------HERTEPT---DK 144
           E+ FLR QL+TLVNELKKYRP   ND +VL+YLAK             H  + P    + 
Sbjct: 109 EATFLRDQLVTLVNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPND 168

Query: 145 EIEQSVQKKMDFTFAFPW-KDRKEAEAQAQHFXXXXXXXXXXXXXXXXXXXXXXNKXXXX 203
           EI+++V++KM+FTF +P   D  E + + +                        N     
Sbjct: 169 EIQENVKQKMNFTFQYPLDNDSDENKNKERQLPSPNDPNHSVSIPIAQKQKKSSNTTDSS 228

Query: 204 XXXXXX------------XXXXXXGWMDNVFYS------DDAQKLPQFAIKGDSTADPLF 245
                                    W+DNV Y+      DD  K     +  +     LF
Sbjct: 229 SATLDSLSNSNDVLNNTPNSSSSMDWLDNVIYTNKFVSGDDGCKRETKNVDSN-----LF 283

Query: 246 SNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQV-ASPQI-------LTN 297
           SN+FNF++QFDEQVS+FC+KMN+ CGTR+CPIP         +V AS  I       LTN
Sbjct: 284 SNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPVSTLDKEVFASSSILSANSPSLTN 343

Query: 298 SWD-----TVASPA 306
           +W+     TV +PA
Sbjct: 344 TWESHSNITVNTPA 357

 Score =  121 bits (303), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 97/188 (51%), Gaps = 47/188 (25%)

Query: 325 SQPELPFIDPTMAFPTDD------------------DEGLFFRTHRDENSLFAELLD--- 363
           S+ ++PFI+  +AFP ++                  D  +FFR    E +   E      
Sbjct: 452 SKDDIPFINANLAFPDENSTNIQLQPISESQSQNKFDYDMFFRDSSKEGNNLFEEFLEED 511

Query: 364 ------------EVEPTDNNFVNENLINEEPSTTTAVAEETRPKPKT------------- 398
                            +++ +   LINEEP +T     E+  +  +             
Sbjct: 512 DDDDDDGNKKAYNTSDDESSLIKNQLINEEPQSTLKNESESAQRKDSYVQEAIDNNNGNG 571

Query: 399 -ETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQ 457
            + DVVPS++G LL+CSE+WDRITTHPKYS ID+DGLC ELM KAKCSE+GVV+ AEDVQ
Sbjct: 572 NDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQ 631

Query: 458 RVLDKHMD 465
             L+KHM+
Sbjct: 632 LALNKHMN 639

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  163 bits (413), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 152/310 (49%), Gaps = 56/310 (18%)

Query: 42  PAAKGSKPGRK-PLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVV 100
           P  KGSK  +K  LD ETK KRTAQNRAAQRAFR             V SLE   ++  V
Sbjct: 49  PRRKGSKTSKKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEV 108

Query: 101 ESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHE------------RTEPT---DKE 145
           E+ FLR QL+TLV+ELKKYRP   ND +VL+YLA+ +             +EP    + +
Sbjct: 109 EATFLRDQLVTLVSELKKYRPETRNDSKVLEYLARRDPNLHPPNSNTNNNSEPIVTPNDD 168

Query: 146 IEQSVQKKMDFTFAFPW----KDRKEAEAQ---------AQHFXXXXXXXXXXXXXXXXX 192
           I+++V++KM+FTF +P      D K  E Q         + H                  
Sbjct: 169 IQKNVKQKMNFTFQYPLDNDDNDGKNMEKQLPSPNDPNHSAHVPIAPTQKKLSDATDSST 228

Query: 193 XXXXXNKXXXXXXXXXXXXXXXXGWMDNVFYSDDAQKLPQFAIKGD-------STADP-- 243
                                   W+DNV Y++      +F   GD       S + P  
Sbjct: 229 ATLDSFSNNNDVLNITPNSSSSMDWLDNVMYTN------KFVAGGDQKNASNESKSKPKG 282

Query: 244 ----LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQV--------AS 291
               +FSN+FNF++QFDEQVS+FC+KMN+ACGT++CPIP  +      +V        A+
Sbjct: 283 VDSNMFSNDFNFENQFDEQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVFASSSVLSAN 342

Query: 292 PQILTNSWDT 301
             +LTN+WD+
Sbjct: 343 SPVLTNTWDS 352

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 112/212 (52%), Gaps = 63/212 (29%)

Query: 311 SLAPSKKQLTKTPPSQPELPFIDPTMAFPTDD------------------DEGLFFR-TH 351
           S  PS +Q TK      ++PFI+ ++AFP D+                  D  +FFR + 
Sbjct: 440 SHNPSLQQSTKD-----DIPFINTSLAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSS 494

Query: 352 RDENSLFAELLDE-------------------VEPTDN--NFVNENLINEEPSTTTAVAE 390
           ++ N+LF E L+E                   V  +D+  N +   LINEEP   +    
Sbjct: 495 KEGNNLFEEFLEEDDDDDDDDGNDGNDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHL 554

Query: 391 ETRPKPKTE-----------------TDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDG 433
            T PK  +E                  +VVPS++G LL+CSE+WDRITTHPKYS ID+DG
Sbjct: 555 ST-PKNGSEVLQNKNSSNSEDVNDNDNEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDG 613

Query: 434 LCGELMTKAKCSEKGVVVQAEDVQRVLDKHMD 465
           LC ELM KAKCSE+GVV+ AEDVQ  L+KHM+
Sbjct: 614 LCSELMAKAKCSERGVVINAEDVQLALNKHMN 645

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  162 bits (410), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 166/356 (46%), Gaps = 111/356 (31%)

Query: 217 WMDNVFYSDDA--QKLPQFAIKGDSTA---------------DP-LFSNEFNFDDQFDEQ 258
           W DN+F +DD   Q+L   +   ++                 DP L +N F+  D+FDEQ
Sbjct: 234 WFDNMFNNDDLFNQQLLSLSNTANANKNTTTTATNTSLLQLDDPNLITNNFDVTDKFDEQ 293

Query: 259 VSQFCTKMNKACGTRECPIPGFTPQMASPQVAS-------------------------PQ 293
           VS FC KMN ACGTR  P+P      ++PQ  +                         P 
Sbjct: 294 VSDFCGKMNMACGTRYDPVPKSKSNTSTPQNNNSSLLSPPSNSKQIANQSNLFNLNTPPN 353

Query: 294 I-LTNSWDT---VASP-----AFGQQSLAPSKKQLTK-------------------TPPS 325
           + +TN++D    + SP     AFGQ  +  S + L+                        
Sbjct: 354 LNITNTFDFNSPLDSPQQQNQAFGQLGMPNSPQFLSAFELPTENSIQKQPQQQQPMASKK 413

Query: 326 QPELPFIDPTMAFPTDDDEGLFFRTHRDENS-------LFAE----LLDEVEPTDNN--- 371
            P LPFI+ ++AFPTDD   +F  T  + N+       LF E    L D +   D N   
Sbjct: 414 SPTLPFINSSLAFPTDD---IFNNTISNNNNNSNTNGPLFNESSSLLSDFIRNEDGNVSD 470

Query: 372 ------------FVNENLINEE-------PSTTTAVAEETRPKPKTETD----VVPSRDG 408
                        +N+NLIN+E       P+ T+  A         + D    +VPSRDG
Sbjct: 471 SDNDADSDFDNDLINKNLINQEISNPVLAPAPTSVPASTAATAAPEDEDDDEFIVPSRDG 530

Query: 409 KLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
            LL+CSE+WDRI+ HPKYS +DIDGLC ELMTKAKCSE+GVVV AEDVQ  L KHM
Sbjct: 531 GLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALTKHM 586

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 70/128 (54%), Gaps = 13/128 (10%)

Query: 34  EQSSSPMAPAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQ 93
           +Q  S  + AA  +   +K LD E KNKRTAQNRAAQRAFR             V +L +
Sbjct: 43  KQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTK 102

Query: 94  ANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKEIEQSVQKK 153
             +   +ESEFLR QL+TLVNELKKYR    N+ +VL+YL++H                 
Sbjct: 103 IQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYLSQHNGNNK------------ 150

Query: 154 MDFTFAFP 161
            DFTF FP
Sbjct: 151 -DFTFQFP 157

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  153 bits (386), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 135/289 (46%), Gaps = 47/289 (16%)

Query: 54  LDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLV 113
           LD ETK KRTAQNRAAQRAFR             VQ LE   +   VE+ FLR QL+TLV
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLV 121

Query: 114 NELKKYRPAKANDLQVLDYLAKHERTEPT----------------DKEIEQSVQKKMDFT 157
           NELKKYRP   ND +VL+YLA  +   PT                 +EI+++V++KM+FT
Sbjct: 122 NELKKYRPETRNDSKVLEYLASRDPNLPTSNNSTNSSSNRPIITPSEEIQENVRQKMNFT 181

Query: 158 FAFPW-KDRKEAEAQ---------AQHFXXXXXXXXXXXXXXXXXXXXXXNKXXXXXXXX 207
           F +    D K  E Q         +                                   
Sbjct: 182 FQYALDNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKSSDATDSSTATLDSLSNSHDVLNN 241

Query: 208 XXXXXXXXGWMDNVFYSDDAQKLPQFAIKGDSTA-------DPLFSNEFNFDDQFDEQVS 260
                    W+DNV Y++      +F   GD +          +FSN FNF++QFDEQVS
Sbjct: 242 TPNSSSSMDWLDNVIYTN------RFVAGGDGSKLEVKNVDSNMFSNNFNFENQFDEQVS 295

Query: 261 QFCTKMNKACGTRECPIPGFTPQMASPQV-ASPQI-------LTNSWDT 301
           +FC+KMN+ CGTR+CPIP         +V AS  I       LTN+W++
Sbjct: 296 EFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWES 344

 Score =  122 bits (305), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 74/115 (64%), Gaps = 21/115 (18%)

Query: 372 FVNENLINEEP-----STTTAVAEETRPKPKTETD----------------VVPSRDGKL 410
            +   LINEEP     ++ +++  E    PKT +                 VVPS++G L
Sbjct: 551 LIRNQLINEEPQPLNQNSLSSLNNEKETSPKTNSGGTQNANDSDGNDNDNDVVPSKEGSL 610

Query: 411 LKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHMD 465
           L+CSE+WDRITTHPKYS ID+DGLC ELM KAKCSE+GVV+ AEDVQ  L+KHM+
Sbjct: 611 LRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 665

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  151 bits (382), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 141/349 (40%), Gaps = 133/349 (38%)

Query: 249 FNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQ-------------------- 288
            +F++ FDEQVS+FCTK+N+ACGT+ CPIP       +P                     
Sbjct: 239 IDFNNFFDEQVSEFCTKLNQACGTKACPIPQSKSAATTPLPGTSSNGNSNSPMIINDTMG 298

Query: 289 ------------------VASPQILTNSWD----------TVASPAFGQQSL-------- 312
                             V  P  L+N+WD          T  +P FGQ           
Sbjct: 299 DVSLNMQGNEHGNATNNLVTDPAFLSNTWDDMSPASNQHSTGGAPGFGQLGFGDNLLGND 358

Query: 313 ----------APS------KKQLTKTPPSQP-----------ELPFIDPTMAFPTDDDEG 345
                     +PS       +++ ++P  Q              PFI+ ++AFP D D  
Sbjct: 359 ILFSPNSPAYSPSVLGSGRTQEVYRSPAVQKVVEKENESKSVNFPFINSSLAFPGDYDNN 418

Query: 346 LFFRTHRDE-----------------NSLFAELLDEVEPTDNNFVNENLINEEPS----- 383
            F  T                     N  F   + + + +D+  +   L+ EEPS     
Sbjct: 419 FFRETTDLNFDDNDQDDNFTNSNDLVNDYFTTNIPDTDNSDSALIANGLVKEEPSMQTED 478

Query: 384 -----TTTAVAEETRPKPKTETD-----------------------VVPSRDGKLLKCSE 415
                 T  +   +R K   +                         VVPSRD  LL+CSE
Sbjct: 479 TFKVQNTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDEDDENDNTVVPSRDDGLLRCSE 538

Query: 416 VWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           +WDRIT HPKYS IDIDGLC ELM KAKCSE+GVV+ A+DVQ  L+KHM
Sbjct: 539 IWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALNKHM 587

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 43  AAKGSKPGRKP----LDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDT 98
            A+ S   RK     LD ET+ KR AQNRAAQ+AFR             V  LE   +  
Sbjct: 8   GAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLN 67

Query: 99  VVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHE 137
            VE+ FLR QL  LV EL+KYRP    D +VL YL KH+
Sbjct: 68  EVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKHK 106

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  134 bits (336), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 88/150 (58%), Gaps = 21/150 (14%)

Query: 327 PELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAELLDEVEPTDNNFVNENLINEEPS--- 383
           PE+PFID  +AFP  DD  L       EN       D ++          LINEEPS   
Sbjct: 442 PEIPFIDTGLAFPDYDDPLLDILKEEQENEQVEGDSDPIQA---------LINEEPSMPL 492

Query: 384 -------TTTAVAEETRPKPKTET--DVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGL 434
                     +V+E  +   + E   D++PS DGKLLKCSEVWDRIT HP+YS +DIDGL
Sbjct: 493 CHDPAANAGASVSETDKLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGL 552

Query: 435 CGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           C EL TKAKCSEKGVVV AEDVQ+ L  HM
Sbjct: 553 CLELRTKAKCSEKGVVVNAEDVQKALISHM 582

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 78/145 (53%), Gaps = 17/145 (11%)

Query: 36  SSSPMAPAAKGS--KPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQ 93
           ++S  +PA+K    KPGRKPL+ E K+KRTAQNRAAQRAFR             V  LE 
Sbjct: 29  NNSGSSPASKRRERKPGRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLES 88

Query: 94  ANRDTVVESEFLRSQLLTLVNELKKYRPA--KANDLQVLDYLAKHERTE----------- 140
            N+ + +E++FLR+Q+  L++ELK+Y P   K  D  +LDYLAK  +             
Sbjct: 89  LNKQSELETKFLRNQVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFSAAA 148

Query: 141 --PTDKEIEQSVQKKMDFTFAFPWK 163
               + +   +     +F F FPWK
Sbjct: 149 NKAANSKDSSTAISSSNFQFEFPWK 173

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 29/37 (78%)

Query: 246 SNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTP 282
           ++EF+FD QFDE VS FC+K++ ACGT+  PIP  +P
Sbjct: 248 TSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPKASP 284

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 109/214 (50%), Gaps = 53/214 (24%)

Query: 303 ASPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDD------------------DE 344
            S   G  + + +   L ++  S+ ++PFI+  +AFP D+                  D 
Sbjct: 439 GSTGIGNNAASNTNPSLLQS--SKEDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDY 496

Query: 345 GLFFR-THRDENSLFAELLD---------EVEPTDNNFVNENLINEEP------------ 382
            +FFR + ++ N+LF E L+          +   +++ +   LINEEP            
Sbjct: 497 DMFFRDSSKEGNNLFGEFLEDDDDDKKAANMSDDESSLIKNQLINEEPELPKQYLQSVPG 556

Query: 383 -----------STTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDI 431
                      S   A           + DVVPS++G LL+CSE+WDRITTHPKYS ID+
Sbjct: 557 NESEISQKNGSSLQNADKINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDV 616

Query: 432 DGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHMD 465
           DGLC ELM KAKCSE+GVV+ AEDVQ  L+KHM+
Sbjct: 617 DGLCSELMAKAKCSERGVVINAEDVQLALNKHMN 650

 Score =  109 bits (272), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 76/124 (61%), Gaps = 16/124 (12%)

Query: 54  LDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLV 113
           LD ETK KRTAQNRAAQRAFR             VQSLE   +   VE+ FLR QL+TLV
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLV 121

Query: 114 NELKKYRPAKANDLQVLDYLAK-------------HERTEPTDK---EIEQSVQKKMDFT 157
           NELKKYRP   ND +VL+YLA+             H  +EP D    +I+++V++KM+FT
Sbjct: 122 NELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFT 181

Query: 158 FAFP 161
           F +P
Sbjct: 182 FQYP 185

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 49/70 (70%), Gaps = 15/70 (21%)

Query: 217 WMDNVFYSDDAQKLPQFAIKGDSTADP--------LFSNEFNFDDQFDEQVSQFCTKMNK 268
           W+DNV Y++      +F + GD  ++         +FSN+FNF++QFDEQVS+FC+KMN+
Sbjct: 256 WLDNVIYTN------RF-VSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVSEFCSKMNQ 308

Query: 269 ACGTRECPIP 278
            CGTR+CPIP
Sbjct: 309 VCGTRQCPIP 318

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  124 bits (310), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 117/253 (46%), Gaps = 42/253 (16%)

Query: 244 LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWDTVA 303
           LFS EF+F ++FDEQVS FC KMNK    R+  I  F  +        P+ +        
Sbjct: 263 LFSTEFDFANEFDEQVSTFCAKMNKTFENRKEMIKQFYTEKVRNSNNKPRTV-------- 314

Query: 304 SPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFP-----TDDDEGLFFRTHRDENSLF 358
             +  Q+     +  +  +  +      +  ++AFP        D    F    + N  +
Sbjct: 315 --SIKQEPTTTLQANIQPSDSNDVTESLVAASIAFPEQYNMVKSDSLYNFLKQNNNNIGY 372

Query: 359 AELLDEVEPTDNNFVNENLINEEPS--------------TTTAVAEETRPKPKT-ETD-- 401
            ++   +    N+ +  NL N E +               T    +     P   ETD  
Sbjct: 373 GDVRGNISTQPNSIMTNNLSNNEQNYNFSKDAQFIVSQQNTVRNIQTANEYPNIYETDDS 432

Query: 402 ----------VVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVV 451
                     +VP  DG+LL+C E+WDRITT+P+YS IDIDGLC ELM  AKCS+KGV+V
Sbjct: 433 SDGGDEVVGQIVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLV 492

Query: 452 QAEDVQRVLDKHM 464
            ++DVQ+VL + +
Sbjct: 493 SSDDVQKVLSRRL 505

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 61  KRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKYR 120
           KR AQNRAAQ+AFR             V+ LE  N    +E+ FLR+QLL+LVNELKKYR
Sbjct: 21  KRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYR 80

Query: 121 PAKAND--LQVLDYLAKHER 138
             K +D  L+ +    KHE+
Sbjct: 81  IDKNDDFRLKKIGSQLKHEK 100

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  121 bits (303), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 93/154 (60%), Gaps = 22/154 (14%)

Query: 29  VKRPLEQSSSPMAPAAKGS--------------------KPGRKPL-DEETKNKRTAQNR 67
           VKRPL++S + ++P    S                    K GRK L D E KNKRTAQNR
Sbjct: 6   VKRPLDESLTALSPNDNNSSILNASTDVDASTVANANKKKVGRKLLGDHEVKNKRTAQNR 65

Query: 68  AAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDL 127
           AAQRAFR             V  LE+  +   VESEFLR+QL  +++ELKKYRP K++D+
Sbjct: 66  AAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDI 125

Query: 128 QVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFP 161
           +VL+YLAKHE    T+K I++++Q+K DF+F +P
Sbjct: 126 KVLEYLAKHEENGSTEK-IKKNIQRKEDFSFEYP 158

 Score =  118 bits (295), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 90/148 (60%), Gaps = 14/148 (9%)

Query: 324 PSQPELPFIDPTMAFPTDD------DEGLFFRTHRDENSLFAELLDEVEPTDNNFVNENL 377
           P +  LPFID ++AFP         D  +FFR      SL   + D++   +++   +N 
Sbjct: 450 PRKEVLPFIDTSIAFPETKADFDAFDNQMFFRDDGFNESL--NISDDIVGAESDDEQDNN 507

Query: 378 INEEPSTTTAVAEETRPKPKTETD-VVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCG 436
            + +  +   V EE +     E D V+P+ DGKLLKCSEVWDRIT HP+YS IDIDGLC 
Sbjct: 508 NDNDLISKNLVCEEVK-----EHDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQ 562

Query: 437 ELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           ELM  AKCS+KGVVV ++DVQ+ L  HM
Sbjct: 563 ELMHNAKCSDKGVVVDSKDVQKALSNHM 590

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 48/97 (49%), Gaps = 34/97 (35%)

Query: 216 GWMDNVFYSDDAQKLPQFAIKGDSTA---------------------------------- 241
           GWMDNVFY DDAQ LP F     ST                                   
Sbjct: 226 GWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYD 285

Query: 242 DPLFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPIP 278
             LFSN+FNFDD FD+QVS FC KMN+ACGT++ P+P
Sbjct: 286 SDLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVP 322

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  118 bits (295), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 57/67 (85%)

Query: 398 TETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQ 457
           +E  VVP+RDG LLKCSEVWDRIT+HPKYS IDIDGLC EL TKAKCSEKGVVV  +DVQ
Sbjct: 517 SEDAVVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQ 576

Query: 458 RVLDKHM 464
           R L KHM
Sbjct: 577 RALTKHM 583

 Score =  106 bits (264), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%)

Query: 45  KGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEF 104
           KGSKPGRKPLD E KNKRTAQNRAAQRAFR             V+ LE+    + +ESEF
Sbjct: 21  KGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELESEF 80

Query: 105 LRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKE 145
           LRSQL  L+ E++KYRP +++D QVL++LAK E    + +E
Sbjct: 81  LRSQLQKLLAEIQKYRPRQSSDSQVLNFLAKAEERRKSSQE 121

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 106/271 (39%), Gaps = 66/271 (24%)

Query: 129 VLDYLAKHERTEPTD----KEIEQSVQKKMDFTFAFPWKDRKEAEAQAQHFXXXXXXXXX 184
           V  +L     + P D     +I  +VQ+KM+FTFA+  KD   +   A H          
Sbjct: 167 VPSHLRGSSNSSPADPDEAAKINANVQRKMNFTFAY-AKDPTTSTGNANH----SSTSGS 221

Query: 185 XXXXXXXXXXXXXNKXXXXXXXXXXXXXXXXGWMDNVFY-SDDAQKLPQFAIKGDSTADP 243
                        +                 G +D + Y S++ Q LP+F       ++P
Sbjct: 222 AAFPSPSGSVSTSSSHNRPFSLSSNTPRTSSGSLDFLGYNSNNNQSLPKFV-----PSEP 276

Query: 244 LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPI-PGF---------TPQMASPQ----- 288
               EF+F+  FDEQVS+FCT+MN+ CGTRECP+ P           TP  A PQ     
Sbjct: 277 A-KTEFDFNSHFDEQVSEFCTRMNEVCGTRECPVAPALPPSTAMAHTTPSSAQPQPDSLT 335

Query: 289 --------------VASPQILTNSWDTVASPAFGQQSLA-----PSKKQL---------- 319
                           SPQ  ++ WDT   P FG          P+ + +          
Sbjct: 336 RRPSQELSEKHLQNQLSPQAASSVWDT---PQFGHSGFGSDLEDPTNRWMFAGFNAATEG 392

Query: 320 ---TKTPPSQPELPFIDPTMAFPTDDDEGLF 347
                T  +   LPFID +MAFPTD  E L 
Sbjct: 393 GVIRTTSATADSLPFIDTSMAFPTDPQEDLL 423

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 54/63 (85%)

Query: 402 VVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLD 461
           VVPS D +L++CSE+WDRITT+P+Y+ +DIDGLC ELM  AKCS+KGVVV ++DV +VL 
Sbjct: 412 VVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLA 471

Query: 462 KHM 464
           KHM
Sbjct: 472 KHM 474

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (61%)

Query: 44  AKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESE 103
           +  +K  +  +D E + +RTAQNRAAQRAFR             V SLE  ++   VE+E
Sbjct: 29  STSNKIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETE 88

Query: 104 FLRSQLLTLVNELKKYRPAKANDLQVLDYLA 134
           FLRSQ+LTLVNELKKYR    +D ++L  ++
Sbjct: 89  FLRSQVLTLVNELKKYRSETTSDSKILKLVS 119

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 25/34 (73%)

Query: 244 LFSNEFNFDDQFDEQVSQFCTKMNKACGTRECPI 277
           LFSN+FNF++QFDEQVS FC KMN     R+  I
Sbjct: 186 LFSNDFNFNNQFDEQVSTFCAKMNNNFENRKKII 219

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  100 bits (250), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 41/54 (75%), Positives = 49/54 (90%)

Query: 411 LKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           ++CSEVWDRIT+HPKYS +DIDGLC ELM KAKCSEKGVVV+A+DVQ+ L KH+
Sbjct: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607

 Score = 93.2 bits (230), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 72/115 (62%), Gaps = 6/115 (5%)

Query: 29  VKRPLEQSSSPMAPAA------KGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXX 82
           +KR L+ S +    +A      K +K GRK  D+E K+KRTAQNRAAQRAFR        
Sbjct: 14  IKRHLDASDANETASATKETKKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQ 73

Query: 83  XXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHE 137
                V+SLE+ ++ + +ES+FLR QL  L+ EL++YRP + ND +V +YL+ H+
Sbjct: 74  ELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHK 128

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 132/324 (40%), Gaps = 93/324 (28%)

Query: 216 GWMDNVFYSDDAQKLPQFAIKGD------------------STADPL-----FSNEFNFD 252
            WMDNVF ++ A+ LP F    D                  +T + L     FSN+FNF+
Sbjct: 212 NWMDNVFENNIAEGLPPFLNNDDPEKIANMNNHTDTNNNLLTTGNLLDNSLMFSNDFNFN 271

Query: 253 DQFDEQVSQFCTKMNKACGTRECPIPG----------FTPQMASPQVASPQILTNSWDTV 302
           +QFDE V+        A      P  G              + SP  A   +LTN+WDT 
Sbjct: 272 NQFDEHVTNLL-----ADSLSRFPSDGNHHDSNIISKSNSSLTSP--AQSLMLTNTWDTN 324

Query: 303 ASPAFG----QQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFRTHRDENSLF 358
            SP+        ++  +      T       P ID T+AFP+             EN LF
Sbjct: 325 NSPSLDGIDTDNNIYVNDDSNKDTASIMNVRPIIDSTLAFPST----------MTENDLF 374

Query: 359 AE------------------LLDEVEPTDNN------------FVNENLINEEPSTTTAV 388
           A+                  L D+ + T N+             ++ NL+N+E   +   
Sbjct: 375 AQRYGTMQSSSSSLSESAMQLGDDKKCTCNDQCNSDDEEIECELLSRNLLNDESMKSIIK 434

Query: 389 AEETRPKPKTETDVVPSRDGKLLKCSEVWDRIT--------THPKYSAIDIDGLCGELMT 440
            ++TRP     +        +  KCS++W+RI         + P++   DID LC ELMT
Sbjct: 435 EKQTRPSNVAPSCCNGGYGNRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMT 494

Query: 441 KAKCSEKG-VVVQAEDVQRVLDKH 463
           KA+CS  G +V++  D+++ L KH
Sbjct: 495 KARCSTNGSIVIKTGDIKQSLMKH 518

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 88  VQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLA 134
           + SLE+   +  +E+ FLRS +  L+NE+ K+RP    D ++L YL+
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLS 54

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 63/106 (59%)

Query: 39  PMAPAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDT 98
           P+    +  +PGRKPLD   KN+RTAQNRAAQRAFR             +  LE+   + 
Sbjct: 14  PVVVKRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNN 73

Query: 99  VVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDK 144
            VES FLR  ++ L+ +++KYRP  + D +VL YL+  ++ +P+ K
Sbjct: 74  EVESTFLRDYMMDLICDMQKYRPNNSTDSKVLKYLSLKKKNQPSMK 119

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 124/300 (41%), Gaps = 87/300 (29%)

Query: 216 GWMDNVFYSDDAQKLPQF--------------AIKGDSTA----------DPLFSNEFNF 251
            W+DN+F  D A+ LP F              A   D +           + +F+NEF+F
Sbjct: 212 NWIDNIFDGDTAEGLPSFPASISSSSETPPVNANDNDHSHVDFTNNLLDHNMIFTNEFSF 271

Query: 252 DDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQVASPQ--ILTNSWDTVASPAFGQ 309
            +QFD+                  PI   T Q    Q    Q  +++N+WD   S + G 
Sbjct: 272 HNQFDDH-----------------PIIDLTTQQKPTQQQQQQAFVISNTWD---SNSNGN 311

Query: 310 QSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAELLDEVEPTD 369
            +   ++  +          P ID  +AFPTD +E   F         + E + + +P +
Sbjct: 312 STDNDTQSLIGNN--INNNNPLIDSNLAFPTDINENEVFVKQ------YQEYVSQQQPAE 363

Query: 370 NN-----------------------FVNENLINEEPSTTTAVAEETRPKPKTETDVVPSR 406
            +                       F++ NL+N E     ++    R K   +  +  + 
Sbjct: 364 QDTITCPCQHADTGADDDDEEIECEFISRNLLNNE-----SIPSILRDKTSIDGGMACN- 417

Query: 407 DGKLLKCSEVWDRITTH-PKYSAIDIDGLCGELMTKAKCSEKG-VVVQAEDVQRVLDKHM 464
             K  KCS +W R  T  PK+S  DID LC EL+TKAKCS++G +V+++ DV+  L KH 
Sbjct: 418 --KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 67/119 (56%), Gaps = 15/119 (12%)

Query: 45  KGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEF 104
           KG+KPGRKPLD E KN+RTAQNRAAQRAFR             V+ LE+    +  E + 
Sbjct: 41  KGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQS 100

Query: 105 LRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWK 163
           LR+Q+++L+ ELKKYRP       VL      +  EPT  E    +Q K  F   FPW+
Sbjct: 101 LRNQVVSLLRELKKYRPGSP----VL------QEPEPTGDE---EIQGK--FGLNFPWE 144

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 49/60 (81%), Gaps = 1/60 (1%)

Query: 401 DVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVL 460
           ++VP+ D ++L C+++WDRIT  PKY++ DI+ LC ELM+KAKCS+KGVVV + DV +VL
Sbjct: 528 EMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 36  SSSPMAPAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQAN 95
           +S+    A   +   +K  + E K+KRTAQNRAAQRAFR             V  LE+  
Sbjct: 10  NSNSNGTATTTTSKVQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVC 69

Query: 96  RDTVVESEFLRSQLLTLVNELKKYRPAK---ANDLQVLDYLAKHE 137
           R    E+ FLRSQL+    EL+K        +N+  + +Y  +H+
Sbjct: 70  RAHESETSFLRSQLILFGTELRKQHNTGNTPSNNNSISNYRNRHK 114

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 21/23 (91%)

Query: 249 FNFDDQFDEQVSQFCTKMNKACG 271
           FNFD+QFDEQ+S+FC K+N ACG
Sbjct: 356 FNFDNQFDEQISKFCLKLNSACG 378

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 53/94 (56%), Gaps = 2/94 (2%)

Query: 29  VKRPLEQSSSPMAPAAK--GSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXX 86
           VKR  E+   P     K  G+KPGRKPLD E KN+RTAQNRAAQRAFR            
Sbjct: 7   VKRSFEEQDGPYVGETKRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLED 66

Query: 87  XVQSLEQANRDTVVESEFLRSQLLTLVNELKKYR 120
            V+ LE+       E + LR  ++ LV EL+++R
Sbjct: 67  QVRRLEEERSSAECEVQSLRGHVIALVRELRRWR 100

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 48/91 (52%)

Query: 47  SKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLR 106
            +PGRK LD + KNKRT QNR AQRAFR             V  L+  N       EFL+
Sbjct: 10  GRPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEIIEFLK 69

Query: 107 SQLLTLVNELKKYRPAKANDLQVLDYLAKHE 137
             ++TL+ E+K YR     D ++LD + K E
Sbjct: 70  QNVMTLLGEIKNYRKQTNKDKKLLDTIGKLE 100

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 47/86 (54%)

Query: 48  KPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRS 107
           K GRK +D E KNKRTAQNRAAQRAFR             +  L+  N     E+E+L+ 
Sbjct: 11  KAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKE 70

Query: 108 QLLTLVNELKKYRPAKANDLQVLDYL 133
            L  L+ E+ KYRPA   D  +L  L
Sbjct: 71  CLSELLTEVTKYRPANEKDQGILKRL 96

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 16/114 (14%)

Query: 362 LDEVEPTDNNFVNENLINEEP-STTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRI 420
           LD+VE      + +++I  EP ST   + + TR     E D   S    +L+C ++   +
Sbjct: 376 LDDVE-LRCELLTQHIIYREPLSTVLQLLKRTRH----ERDARSSEGKPVLRCEDICGTV 430

Query: 421 TTHPKYSAIDIDGLCGELMTKAKCSEKG----------VVVQAEDVQRVLDKHM 464
                Y ++D + LC ELM KAK S+ G          VV++A D+QR L KH+
Sbjct: 431 GPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHI 484

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 54/92 (58%)

Query: 42  PAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVE 101
           P  K  +PGRK +D E KN+RTAQNRAAQRAFR             ++ LEQ +      
Sbjct: 13  PKRKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKSV 72

Query: 102 SEFLRSQLLTLVNELKKYRPAKANDLQVLDYL 133
            +FL+S L +L++E+ KYR    ND ++L +L
Sbjct: 73  IDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 413 CSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKG-VVVQAEDVQRVLDKHM 464
           C  +   I++ PKYS++DID LC ELMTKA+ ++   +VV+A D+Q  L K +
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (58%)

Query: 42  PAAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVE 101
           P  K  +PGRK +D E K++RTAQNRAAQRAFR             V+ LEQ +      
Sbjct: 29  PKRKVGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTT 88

Query: 102 SEFLRSQLLTLVNELKKYRPAKANDLQVLDYL 133
           ++FL   L +L++E+ KYR   ++D ++L +L
Sbjct: 89  TDFLLCSLKSLLSEITKYRAKNSDDERILAFL 120

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 413 CSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKG-VVVQAEDVQRVLDKHM 464
           C  + + I++ PKYS++DID LC EL+ KAKC++   +VV+A D+Q  L + +
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%)

Query: 43  AAKGSKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVES 102
           A K  +PGR+ LD E KNKRT QNR AQRA+R             + +LE+ N      +
Sbjct: 12  AKKVGRPGRRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRA 71

Query: 103 EFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPT 142
           E + + L  L+ E  K+R  K  D  V + L   + T  T
Sbjct: 72  ELMAAHLRDLLGEANKFRGEKPRDKTVRELLTARDPTRDT 111

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 402 VVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAK--CSEKGVVVQAEDVQRV 459
           +   R G    C+ V   +T  P Y   D++ LC ELM K K    +  + V  EDV+  
Sbjct: 318 IAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSA 377

Query: 460 LDKHM 464
           L++H+
Sbjct: 378 LERHI 382

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 8/99 (8%)

Query: 372 FVNENLINEEPSTTTAVAEETRP-----KPKTETDVVPSRDGKLLKCSEVWDRITTHPKY 426
            +  +LIN+EP  +   A   R       P+  T  +P  +     CS +   I++ PK+
Sbjct: 285 LITRHLINQEPLDSILPASAPRGGVLKLHPEPFTSKMPYNE--TFFCSHILRHISSIPKH 342

Query: 427 SAIDIDGLCGELMTKAKCS-EKGVVVQAEDVQRVLDKHM 464
           S++DID LC ELM KAKCS +  ++VQA  +Q VL + +
Sbjct: 343 SSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query: 57  ETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNE 115
           E KN+RTAQNRAAQ+AFR              + LE  +  + V +++L+  L +L+ E
Sbjct: 11  EAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLE 69

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 1/95 (1%)

Query: 370 NNFVNENLINEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAI 429
           NNF+ EN    E +  + V  +    P+    V       LL   ++W  +  HPK +  
Sbjct: 201 NNFITENTNAIETAAASMVIRQGF-HPRQYYTVDAFGGDVLLSAMDIWSFMKVHPKVNTF 259

Query: 430 DIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
           D++ L  EL   A CS   +++  +   +V    +
Sbjct: 260 DLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 19/29 (65%)

Query: 45 KGSKPGRKPLDEETKNKRTAQNRAAQRAF 73
          +G K GRKP     KNKR AQ RA+Q AF
Sbjct: 5  RGRKGGRKPSLTPPKNKRAAQLRASQNAF 33

>Skud_4.699 Chr4 complement(1239478..1239576,1239580..1239648)
          [168 bp, 56 aa] {OFF} YDR423C (HSP)
          Length = 56

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 42 PAAKGSKPGRKPLDEETKNKRTAQNRAAQRAF 73
          P  K S PG+K ++ E  NKRTAQ RAA RAF
Sbjct: 7  PGRKASGPGKKNINAEP-NKRTAQIRAAPRAF 37

>YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}
           YAP3Basic leucine zipper (bZIP) transcription factor
          Length = 330

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 21/110 (19%)

Query: 56  EETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNE 115
           +++K K+ AQNRAAQ+AFR                     +D ++ESE  R  LL  + E
Sbjct: 144 DDSKAKKKAQNRAAQKAFRERKEARMKEL-----------QDKLLESERNRQSLLKEIEE 192

Query: 116 LKKYRPAKAN-DLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWKD 164
           L+     KAN ++   + L      E   K+IE       ++ ++FP KD
Sbjct: 193 LR-----KANTEINAENRLLLRSGNENFSKDIEDDT----NYKYSFPTKD 233

>Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON}
           YHL009C (REAL)
          Length = 331

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 11/72 (15%)

Query: 47  SKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLR 106
           S P  + + +++K K+ AQNRAAQ+AFR             ++ L+    D ++ESE  R
Sbjct: 135 SIPHSENISDDSKAKKKAQNRAAQKAFR-------ERKEARLKELQ----DKLLESEKNR 183

Query: 107 SQLLTLVNELKK 118
             LL  + EL+K
Sbjct: 184 QSLLKEIEELRK 195

>NDAI0B01800 Chr2 (429150..430490) [1341 bp, 446 aa] {ON} Anc_2.493
           YHL009C
          Length = 446

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%)

Query: 55  DEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVN 114
           +EE K K+ AQNRAAQ+AFR             +   EQ  +D + E + LR   + +  
Sbjct: 183 EEEIKAKKKAQNRAAQKAFRERKDAKLKELREKLNESEQNRQDLLKEVDSLRKLNMEINA 242

Query: 115 ELKK 118
           E KK
Sbjct: 243 ESKK 246

>Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON}
           YHL009C (REAL)
          Length = 330

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 54  LDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLV 113
           L  ++K K+ AQNRAAQ+AFR             ++ LE    D ++ESE  R  LL  +
Sbjct: 138 LSGDSKAKKKAQNRAAQKAFR-------ERKEARLKELE----DKLLESEKNRQSLLKEI 186

Query: 114 NELKK 118
            EL+K
Sbjct: 187 EELRK 191

>Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {ON}
           YBL022C (PIM1) - mitochondrial ATP-dependent protease
           [contig 165] FULL
          Length = 994

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 35/82 (42%), Gaps = 7/82 (8%)

Query: 291 SPQILTNSWDTVASPAFGQQSLA------PSKKQLTKTPPSQPELPFIDPTMAFPTDDDE 344
           +P IL +  D V S   G  S        PS   L    P Q    F+D  + FP D   
Sbjct: 564 NPLILLDEIDKVLSVHVGGGSSGASLNGDPSAALLEVLDPEQ-NATFVDHYVGFPVDLSN 622

Query: 345 GLFFRTHRDENSLFAELLDEVE 366
            LFF T  D + + A LL+ VE
Sbjct: 623 VLFFCTANDLSRISAPLLNRVE 644

>SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {ON}
           some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 322

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 2/98 (2%)

Query: 55  DEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVN 114
           ++E + ++ AQNRAAQRAFR             +   EQ     + E E LR Q L +  
Sbjct: 145 EKEIQARKKAQNRAAQRAFRERKEAKLKELERKLMESEQNRESLLKEVEQLRRQNLEINT 204

Query: 115 ELKKYRPAKANDL--QVLDYLAKHERTEPTDKEIEQSV 150
           E K       + L  +VL    K + T PT+ E   S+
Sbjct: 205 ENKLLLEKGGSSLPSKVLSDPLKDKFTFPTEDEFFSSI 242

>Skud_13.6 Chr13 (6426..7358) [933 bp, 310 aa] {ON} YPR199C (REAL)
          Length = 310

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 3/96 (3%)

Query: 370 NNFVNENL-INEEPSTTTAVAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSA 428
           NNF  E +   E  + +T +        +  TD   S    LL   ++W  I  H + + 
Sbjct: 217 NNFFTEEVDAMETAAASTVITPGFHSGQRYTTDSFES--DVLLSAMDIWHFIKVHSRVNT 274

Query: 429 IDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464
            D++ L  EL   A CS   +++  +   RV    +
Sbjct: 275 FDLENLGTELKKTAICSNFDILISLKHFVRVFSSKL 310

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query: 45 KGSKPGRKPLDEETKNKRTAQNRAAQRAF 73
          +G K GRKP     K+KRTAQ RA+Q AF
Sbjct: 21 RGRKGGRKPSFTPPKDKRTAQLRASQNAF 49

>KNAG0B03190 Chr2 (618434..619270) [837 bp, 278 aa] {ON} Anc_5.619
           YOR028C
          Length = 278

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 10/61 (16%)

Query: 61  KRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANR---DTVVESEFLRSQLLTLVNELK 117
           KR AQNR+AQ+AFR             +++LEQ ++   D V E++ L+ QL +L + L+
Sbjct: 225 KRAAQNRSAQKAFR-------LRREKYIKNLEQKSKIFDDIVRENQQLKEQLNSLTSRLQ 277

Query: 118 K 118
           +
Sbjct: 278 Q 278

>KNAG0D00960 Chr4 (154539..157508) [2970 bp, 989 aa] {ON} 
          Length = 989

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 43/108 (39%), Gaps = 14/108 (12%)

Query: 264 TKMNKACGTRECPIPGFTPQMASPQVASPQILTNSWDTVASPAFGQQSLA-----PSKKQ 318
           T +   CGT           +      +P IL +  D +AS +F   ++      PS   
Sbjct: 521 TYVGSMCGT-------VINALRKSGTMNPLILLDELDKIAS-SFADGNVQNGNGDPSAAL 572

Query: 319 LTKTPPSQPELPFIDPTMAFPTDDDEGLFFRTHRDENSLFAELLDEVE 366
           L    P Q    F+D  + FP D  + LF  T  D N +   LLD +E
Sbjct: 573 LEILDPEQ-NFSFVDHYVGFPVDLSQVLFMCTANDINGIPKPLLDRME 619

>KLTH0D05918g Chr4 (526400..527332) [933 bp, 310 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 310

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%)

Query: 53  PLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTL 112
           P+++ +  K+ AQNRAAQRAFR             + + E+  +  + + E LR + L +
Sbjct: 132 PIEDASARKKKAQNRAAQRAFRERKEAKMKQLQEQLVTSERDKQSLLRQMEELRERNLKM 191

Query: 113 VNE 115
           + E
Sbjct: 192 LTE 194

>CAGL0K02585g Chr11 complement(233972..235078) [1107 bp, 368 aa]
           {ON} some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 55  DEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVV-ESEFLRSQLLTLV 113
           ++E K ++ AQNRAAQ+AFR             +  +E+ NRD +V E E LR +L   +
Sbjct: 191 EDEIKARKKAQNRAAQKAFRERKEARLKELENKLSDIEK-NRDLLVNELEDLR-RLNMEI 248

Query: 114 NE 115
           NE
Sbjct: 249 NE 250

>Ecym_2430 Chr2 (837395..838321) [927 bp, 308 aa] {ON} similar to
           Ashbya gossypii ABR018C
          Length = 308

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 55  DEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTV-VESEFLRSQLLTLV 113
           D   K K+ AQNRAAQ+AFR             ++  E+ NRD +  E E L+ Q   + 
Sbjct: 126 DGYVKEKKKAQNRAAQKAFRERKEARLKELEQRLKESEE-NRDALNKEMEELKKQNFVIH 184

Query: 114 NE 115
           NE
Sbjct: 185 NE 186

>CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 11/59 (18%)

Query: 61  KRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKKY 119
           K+ AQNRAAQRAFR             V+           ESE  R QLL  + +L+K+
Sbjct: 169 KKKAQNRAAQRAFRERKEAKFKELQRKVR-----------ESEIDRDQLLKELEKLRKW 216

>KLLA0E00265g Chr5 (12033..12899) [867 bp, 288 aa] {ON} weakly
          similar to uniprot|Q06596 Saccharomyces cerevisiae
          YPR199C ARR1 Transcriptional activator of the bZIP
          family required for transcription of genes involved in
          resistance to arsenic compounds
          Length = 288

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 45 KGSKPGRKPLDEETKNKRTAQNRAAQRAFR 74
          +G   GRKP     K+KRTAQ R +Q+ +R
Sbjct: 5  RGRNGGRKPSSSPPKDKRTAQLRKSQKTYR 34

>KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON} 
          Length = 993

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%)

Query: 291 SPQILTNSWDTVASPAFGQQSLAPSKKQLTKTPPSQPELPFIDPTMAFPTDDDEGLFFRT 350
           +P IL +  D + +   G+ +       L +T   +    F+D  +  P D  + LF  T
Sbjct: 571 NPLILLDEIDKIGTSPAGRTNTGDPSSALLETLDFEQNFSFMDHYVGLPIDLSQVLFICT 630

Query: 351 HRDENSLFAELLDEVE 366
             D +++   LLD +E
Sbjct: 631 ANDLSTISRPLLDRME 646

>Skud_8.36 Chr8 complement(72120..73118) [999 bp, 332 aa] {ON}
           YHL009C (REAL)
          Length = 332

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 19/106 (17%)

Query: 59  KNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVNELKK 118
           K K+ AQNRAAQRAFR             ++ L+    D +++SE  R  LL  + EL+K
Sbjct: 148 KAKKKAQNRAAQRAFR-------ERKEARLRELQ----DKLMKSEKNRQSLLKEIKELRK 196

Query: 119 YRPAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWKD 164
                  + ++L            +++    +    D  ++FP KD
Sbjct: 197 VNTEINAENRLL--------LRSGNEKCSNDLTNDTDHKYSFPTKD 234

>KLLA0B13695g Chr2 complement(1199239..1200366) [1128 bp, 375 aa]
           {ON} some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 375

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 12/73 (16%)

Query: 47  SKPGRKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLR 106
           S  G K  +E+ + KR A NRAAQ+AFR             V+ LE+  +D    SE  R
Sbjct: 175 SATGAKDSEEQIRRKR-ALNRAAQKAFR-------ERKEARVKQLEKQLKD----SENDR 222

Query: 107 SQLLTLVNELKKY 119
            QLL  + +L+K+
Sbjct: 223 EQLLNELEQLRKH 235

>KNAG0C05680 Chr3 complement(1096585..1097664) [1080 bp, 359 aa]
           {ON} Anc_2.493 YHL009C
          Length = 359

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 11/64 (17%)

Query: 55  DEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVVESEFLRSQLLTLVN 114
           +E  K ++ AQNRAAQ+AFR             ++ LE+     + ESE  R  L+  + 
Sbjct: 145 EEVNKARKKAQNRAAQKAFR-------ERKEARLKELEE----KLAESENSRHDLMLEIG 193

Query: 115 ELKK 118
           +LKK
Sbjct: 194 KLKK 197

>Kwal_26.7848 s26 (539163..540038) [876 bp, 291 aa] {ON} YHL009C
           (YAP3) - bZip DNA binding proteins [contig 55] FULL
          Length = 291

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 46  GSKPGRKPLDEETKNKRTAQNRAAQRAFR 74
           G +  +   +E+   K+ AQNRAAQRAFR
Sbjct: 104 GRQQDKSSQEEDLARKKKAQNRAAQRAFR 132

>NCAS0A08020 Chr1 (1585065..1585781) [717 bp, 238 aa] {ON} 
          Length = 238

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 51  RKPLDEETKNKRTAQNRAAQRAFRXXXXXXXXXXXXXVQSLEQANRDTVV-ESEFLRSQL 109
           RKP+      KR AQNR AQ+AFR             +  L+    D +V E+  LR Q+
Sbjct: 175 RKPISTA---KRAAQNRNAQKAFR-----QRKERYIKILELKSIKYDELVRENTCLREQM 226

Query: 110 LTLVNELKKYR 120
             L N+L+  R
Sbjct: 227 DALRNQLQNIR 237

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,631,744
Number of extensions: 1893719
Number of successful extensions: 5679
Number of sequences better than 10.0: 88
Number of HSP's gapped: 5811
Number of HSP's successfully gapped: 133
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)