Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A038905.525ON83183144910.0
ZYRO0D12518g5.525ON88186922270.0
SAKL0G04884g5.525ON93091122110.0
NCAS0F010705.525ON90487220570.0
Kpol_1028.825.525ON92590820420.0
KAFR0E033105.525ON93876220290.0
NDAI0H015805.525ON90988519220.0
Skud_4.6955.525ON95492419220.0
YDR421W (ARO80)5.525ON95091619210.0
Suva_2.5985.525ON96592019190.0
KLLA0A01804g5.525ON94578619160.0
Smik_4.6965.525ON94991518910.0
KLTH0G03718g5.525ON85784418270.0
TPHA0L003505.525ON85986718050.0
KNAG0C032505.525ON93678716890.0
TBLA0D016705.525ON101880516390.0
ADR199C5.525ON94493815710.0
CAGL0F03025g5.525ON92892413961e-179
YKL015W (PUT3)2.654ON9791121165e-05
KLLA0E18129g2.654ON865621139e-05
Kpol_538.528.879ON907501131e-04
KAFR0C039002.654ON818801112e-04
Suva_11.2132.654ON985681102e-04
TBLA0E047504.344ON1283591102e-04
Smik_11.2402.654ON976681093e-04
KAFR0A03060singletonON860441074e-04
TBLA0C062306.60ON7951141057e-04
SAKL0D00264g8.879ON848391057e-04
TBLA0G011308.879ON1132471050.001
AAL175W8.879ON883391040.001
Skud_11.2142.654ON981641040.001
Ecym_81598.879ON908391040.001
NCAS0H034202.654ON902881040.001
NDAI0C048408.423ON9481011030.001
TBLA0E034803.109ON1046421020.002
KLTH0D02222gna 1ON847911010.002
Kwal_27.96888.879ON841531010.002
TPHA0C049808.879ON852531010.002
KLTH0H16170gna 2ON619541000.003
CAGL0I07755g3.109ON1053771000.003
KNAG0A071002.547ON1286771000.003
TDEL0G04890singletonON58466990.004
KAFR0C013203.109ON10061091000.004
KLTH0E16500g8.879ON83345990.004
Kpol_1001.34.344ON85670990.005
NDAI0I007406.279ON103364980.006
TBLA0A007302.654ON103769980.006
Kpol_1039.112.231ON99268970.006
KNAG0A044808.423ON101357970.007
KNAG0G021308.283ON63249960.007
KNAG0D006906.279ON87562970.008
Smik_18.3singletonON70483960.008
NDAI0D031804.344ON98958960.009
ABL099W3.264ON80073960.009
ZYRO0A00440g8.879ON85049960.009
NCAS0D041906.279ON89064950.011
KNAG0F037207.512ON76678950.011
KLLA0B04620g4.344ON91949950.011
KLLA0F14322g1.277ON71783950.012
TBLA0F029207.512ON92362950.013
KLLA0A06039g1.199ON65755940.013
TBLA0I025408.423ON125956950.014
Ecym_1146na 3ON66544940.015
TPHA0G003807.512ON87353940.016
Suva_2.1873.264ON784103940.016
SAKL0G19470g2.654ON83157940.016
TBLA0A04280singletonON89252940.017
ZYRO0E00572g2.654ON83848940.017
Ecym_33922.654ON84765940.017
AFR096W1.277ON85255940.018
KAFR0I002804.344ON93683940.018
ZYRO0B14718g4.344ON103553930.020
KLLA0F19602g8.283ON60387930.020
KAFR0B014502.547ON108850930.021
KAFR0L021308.879ON88239930.021
NDAI0F012206.279ON96090930.021
TBLA0F012003.109ON108682930.021
NDAI0F00110singletonON50839920.022
SAKL0E08998g2.231ON82395930.023
SAKL0H13024g8.423ON754108920.025
Ecym_63401.277ON95265920.026
NDAI0C002602.654ON104165920.027
KLTH0B09262gsingletonON82059920.027
TPHA0F013802.231ON89074920.027
CAGL0H06875g8.879ON70245910.030
KLTH0D07260g2.547ON97946920.031
Smik_4.2693.264ON778109910.031
ZYRO0A10956g5.235ON85540910.033
KAFR0G035206.154ON44463900.033
Skud_2.397.389ON115941910.034
KNAG0D034504.121ON688234910.034
ACL096W2.654ON83555910.034
KLLA0E02663gna 4ON110965910.036
CAGL0L09691g2.654ON82443910.037
KLLA0A02585gna 5ON37045900.037
SAKL0G17908g4.344ON80948910.040
TDEL0B074902.654ON86550900.041
CAGL0C01199g8.423ON92272900.041
Suva_2.517.389ON115541910.041
YBL066C (SEF1)7.389ON114841900.043
KNAG0D052407.512ON86961900.046
SAKL0H00682gna 6ON92278900.047
NDAI0D03540na 7ON110789900.047
SAKL0D05654g1.277ON91992900.048
KNAG0M00120singletonON88149900.050
Smik_2.507.389ON115041900.050
CAGL0F07909g3.109ON104957900.050
KLTH0F03014gsingletonON612108890.052
CAGL0L01903g2.547ON128770900.054
TDEL0B004808.879ON83553890.056
KLLA0D10197g8.879ON85639890.059
KLLA0B04840gna 3ON77148890.059
ZYRO0E06270g2.565ON91263890.060
KNAG0J002508.845ON123760890.064
KNAG0H002502.654ON89675890.064
TBLA0B062404.344ON143543890.064
YKL038W (RGT1)2.547ON117044890.066
Suva_13.764.344ON94682890.068
SAKL0B04620gna 5ON36248870.070
KLTH0C00814g2.654ON834121880.071
ADR405Cna 8ON807131880.072
TBLA0C019105.577ON114843880.082
YML076C (WAR1)4.344ON94468880.083
TDEL0D036103.264ON72493880.087
Suva_16.25singletonON14344820.088
Kwal_55.20722singletonON82747880.090
Skud_13.664.344ON93968880.090
Kpol_455.108.879ON83052870.091
KLLA0C16489gna 9ON72839870.093
Smik_6.4526.279ON87864870.096
NCAS0A150207.512ON80953870.096
KLLA0F10835gna 10ON75649870.098
TDEL0D00820na 3ON68554870.100
Smik_11.2102.547ON116944870.10
Skud_11.1902.547ON117144870.11
NCAS0A061904.344ON89458870.11
Smik_13.1832.565ON91190870.11
Smik_17.27singletonON68861870.11
NDAI0A087907.17ON105978870.12
NCAS0H00780singletonON90949870.12
NCAS0A047502.547ON114149870.12
KLTH0H01672gna 9ON701161860.12
Skud_12.2968.423ON81463860.12
CAGL0H00396g7.512ON94048860.12
Suva_15.773.109ON102985860.13
Suva_11.1872.547ON117144860.13
TBLA0H006808.423ON88056860.14
Suva_10.3238.423ON81363860.14
Ecym_4635na 4ON85667860.14
YLR228C (ECM22)8.423ON81463860.14
Kwal_14.9152.654ON82255860.14
NCAS0A094101.277ON932116860.15
NCAS0C002208.879ON83939860.15
YDR213W (UPC2)8.423ON91355860.15
NCAS0A03570na 7ON97849860.15
KLLA0F00572gna 11ON597113850.15
Kwal_56.226053.109ON865117860.16
Kwal_56.246707.360ON64362850.16
Smik_12.2898.423ON81263850.16
KLTH0B00352gsingletonON93455850.16
KNAG0E041004.344ON90349850.17
KLLA0E20307g7.389ON111968850.17
Kpol_534.286.154ON43546850.17
Ecym_72037.512ON88463850.17
KLTH0C07480g3.264ON77585850.17
Ecym_2345na 12ON63780850.18
NDAI0B038502.231ON93059850.18
Smik_10.251.128ON77254850.18
KAFR0F014901.128ON65866850.18
Kpol_1002.52.547ON95861850.18
CAGL0D03850g5.322ON83442850.19
Smik_16.15singletonON46344840.19
ZYRO0G15136g1.277ON102745850.19
NDAI0A03410na 7ON98053850.19
Suva_13.498.879ON88239850.20
CAGL0A04455g7.389ON109841850.20
NCAS0C047803.109ON91454850.20
NCAS0A03070singletonON65647840.21
Kwal_47.168624.344ON74342840.21
SAKL0G02992gna 4ON106154850.21
Smik_12.1578.283ON64472840.21
Smik_4.4608.423ON91855840.21
Smik_13.644.344ON94468840.22
ZYRO0D01650g7.512ON860310840.22
SAKL0F12342g7.389ON104348840.22
NDAI0K001508.879ON95339840.22
Smik_16.20na 13ON47396840.22
KAFR0F010406.279ON83466840.22
TDEL0C044802.231ON85263840.22
KLLA0F02387g7.56ON72735840.23
Suva_2.3818.423ON91895840.23
KLLA0F04213g3.264ON76848840.23
TDEL0D007304.344ON80656840.23
AGL091W8.423ON86693840.25
Kwal_23.6529na 14ON59841840.25
Kwal_47.16939na 3ON66947840.25
YPL248C (GAL4)6.279ON88164840.26
KLTH0D16852g4.344ON81144840.27
Kpol_1049.19na 15ON94349840.27
TPHA0A06090singletonON84778840.27
Sklu_YGOB_gneas1na 16ON48042830.27
KLTH0C06776g7.389ON105453840.28
KAFR0J017102.231ON848117830.28
Suva_16.596.279ON89564830.29
NCAS0H012406.154ON47541830.30
TBLA0B04800singletonON77747830.30
Skud_4.4758.423ON91346830.30
Kwal_23.6537na 17ON55241830.31
ZYRO0B03278g7.389ON123951830.31
NDAI0D00900singletonON86544830.31
Skud_13.438.879ON88039830.32
Kpol_495.213.109ON108556830.32
Kpol_1018.927.389ON106053830.33
NCAS0G011006.279ON93588830.33
TDEL0C015807.389ON116949830.34
SAKL0D03586g3.264ON80181830.34
Kwal_23.31228.423ON78872830.34
Kwal_55.218847.512ON88255830.34
KLTH0G09108g2.231ON782222830.34
YJL206C1.128ON75854830.35
Kwal_23.6425na 18ON73547820.35
TDEL0F054708.423ON81063820.36
TBLA0H03910singletonON76796820.36
KLLA0F25630g2.547ON100761830.36
Kwal_26.81092.547ON97041830.36
Smik_13.368.879ON88039820.37
ZYRO0D08316gna 19ON68047820.37
TBLA0D054201.277ON75741820.38
YML099C (ARG81)8.879ON88052820.38
AFR171Wna 12ON61267820.39
TDEL0D051503.109ON99658820.39
KNAG0K020603.109ON91488820.39
YPR196WsingletonON47044820.40
Skud_7.638singletonON47344820.40
NCAS0H002707.512ON90659820.41
Smik_12.775.235ON90339820.41
KAFR0A014801.277ON72543820.41
Skud_15.643.109ON103267820.42
KLLA0E19603g7.360ON68168820.42
KNAG0A025508.423ON73063820.42
KNAG0C059804.113ON96872820.43
KLTH0D03564g1.277ON862104820.43
CAGL0M03025g8.845ON1254108820.43
YOR380W (RDR1)na 17ON54651810.44
Kwal_27.108527.389ON104641820.44
KNAG0K008203.109ON105091820.45
Kpol_1031.478.423ON89454820.45
Suva_13.1862.565ON89450820.46
KLLA0C17050gna 20ON95563820.46
YLR014C (PPR1)5.235ON90439820.47
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03890
         (831 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...  1734   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   862   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   856   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   796   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   791   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   786   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   744   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   744   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   744   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   743   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   742   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   733   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   708   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     699   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   655   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   635   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   609   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   542   e-179
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    49   5e-05
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    48   9e-05
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    48   1e-04
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    47   2e-04
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    47   2e-04
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    47   2e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    47   3e-04
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    46   4e-04
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    45   7e-04
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    45   7e-04
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    45   0.001
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    45   0.001
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    45   0.001
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    45   0.001
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    45   0.001
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    44   0.001
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    44   0.002
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    44   0.002
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    44   0.002
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    44   0.002
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    43   0.003
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    43   0.003
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    43   0.003
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    43   0.004
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    43   0.004
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    43   0.004
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    43   0.005
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    42   0.006
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    42   0.006
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    42   0.006
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    42   0.007
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    42   0.007
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    42   0.008
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    42   0.008
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    42   0.009
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    42   0.009
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    42   0.009
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     41   0.011
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    41   0.011
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    41   0.011
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    41   0.012
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    41   0.013
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.013
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    41   0.014
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    41   0.015
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       41   0.016
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    41   0.016
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    41   0.016
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    41   0.017
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    41   0.017
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    41   0.017
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    41   0.018
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    41   0.018
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    40   0.020
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    40   0.020
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    40   0.021
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    40   0.021
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    40   0.021
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    40   0.021
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 40   0.022
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    40   0.023
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    40   0.025
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    40   0.026
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    40   0.027
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    40   0.027
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    40   0.027
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    40   0.030
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    40   0.031
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    40   0.031
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    40   0.033
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    39   0.033
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    40   0.034
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     40   0.034
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    40   0.034
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    40   0.036
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    40   0.037
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    39   0.037
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    40   0.040
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.041
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    39   0.041
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    40   0.041
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.043
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    39   0.046
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    39   0.047
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.047
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    39   0.048
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      39   0.050
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.050
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    39   0.050
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    39   0.052
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    39   0.054
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    39   0.056
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.059
KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON} conser...    39   0.059
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    39   0.060
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    39   0.064
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    39   0.064
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    39   0.064
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    39   0.066
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    39   0.068
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    38   0.070
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    39   0.071
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    39   0.072
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    39   0.082
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    39   0.083
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.087
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    36   0.088
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    39   0.090
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    39   0.090
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    38   0.091
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    38   0.093
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    38   0.096
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    38   0.096
KLLA0F10835g Chr6 (997512..999782) [2271 bp, 756 aa] {ON} conser...    38   0.098
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               38   0.100
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    38   0.10 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    38   0.11 
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    38   0.11 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    38   0.11 
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    38   0.11 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    38   0.12 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    38   0.12 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    38   0.12 
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    38   0.12 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    38   0.12 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    38   0.12 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    38   0.13 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    38   0.13 
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    38   0.14 
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    38   0.14 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    38   0.14 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    38   0.14 
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    38   0.14 
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    38   0.15 
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       38   0.15 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    38   0.15 
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    38   0.15 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    37   0.15 
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    38   0.16 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    37   0.16 
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    37   0.16 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    37   0.16 
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    37   0.17 
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    37   0.17 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    37   0.17 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    37   0.17 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    37   0.17 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    37   0.18 
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    37   0.18 
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    37   0.18 
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    37   0.18 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    37   0.18 
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    37   0.19 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.19 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    37   0.19 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.19 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    37   0.20 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    37   0.20 
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               37   0.20 
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               37   0.21 
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    37   0.21 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.21 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    37   0.21 
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.21 
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    37   0.22 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    37   0.22 
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    37   0.22 
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    37   0.22 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    37   0.22 
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    37   0.22 
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    37   0.22 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    37   0.23 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.23 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.23 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    37   0.23 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.25 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    37   0.25 
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    37   0.25 
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    37   0.26 
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    37   0.27 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    37   0.27 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    37   0.27 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    37   0.27 
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    37   0.28 
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    37   0.28 
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    37   0.29 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     37   0.30 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    37   0.30 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    37   0.30 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    37   0.31 
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    37   0.31 
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               37   0.31 
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    37   0.32 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.32 
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    37   0.33 
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    37   0.33 
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    37   0.34 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.34 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    37   0.34 
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    37   0.34 
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    37   0.34 
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    37   0.35 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    36   0.35 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    36   0.36 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    36   0.36 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    37   0.36 
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    37   0.36 
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    36   0.37 
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    36   0.37 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    36   0.38 
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    36   0.38 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    36   0.39 
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    36   0.39 
KNAG0K02060 Chr11 (416607..419351) [2745 bp, 914 aa] {ON}              36   0.39 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    36   0.40 
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    36   0.40 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    36   0.41 
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    36   0.41 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    36   0.41 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    36   0.42 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    36   0.42 
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    36   0.42 
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    36   0.43 
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    36   0.43 
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    36   0.43 
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    36   0.44 
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    36   0.44 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    36   0.45 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    36   0.45 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    36   0.46 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    36   0.46 
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    36   0.47 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    36   0.48 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    36   0.48 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    36   0.49 
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    36   0.50 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    36   0.50 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    36   0.50 
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    36   0.51 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    36   0.51 
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    36   0.51 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    36   0.52 
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    36   0.53 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    36   0.54 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    36   0.55 
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    36   0.55 
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    36   0.56 
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    36   0.56 
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    36   0.57 
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    36   0.57 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    35   0.58 
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     36   0.58 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    36   0.58 
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    36   0.60 
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    36   0.60 
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    36   0.60 
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    36   0.61 
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    36   0.63 
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    35   0.65 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    35   0.65 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   0.66 
YPL097W Chr16 (364952..366430) [1479 bp, 492 aa] {ON}  MSY1Mitoc...    35   0.67 
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    35   0.67 
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    35   0.67 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    35   0.68 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    35   0.69 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    35   0.69 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     35   0.69 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    35   0.70 
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    35   0.71 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    35   0.73 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    35   0.73 
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    35   0.73 
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    35   0.74 
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    35   0.74 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   0.74 
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    35   0.75 
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    35   0.75 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    35   0.76 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    35   0.76 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    35   0.77 
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    35   0.77 
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    35   0.77 
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    35   0.77 
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    35   0.79 
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    35   0.82 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    35   0.83 
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    35   0.84 
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    35   0.86 
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    35   0.88 
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 35   0.89 
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    35   0.89 
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    35   0.89 
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    35   0.89 
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    35   0.91 
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    35   0.92 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    35   0.93 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    35   0.96 
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    35   0.97 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    35   0.98 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    35   0.99 
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    35   1.00 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    35   1.0  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    35   1.0  
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    35   1.0  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    35   1.0  
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    35   1.0  
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    35   1.0  
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    35   1.0  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    35   1.1  
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    35   1.1  
AER153W Chr5 (925950..928196) [2247 bp, 748 aa] {ON} Syntenic ho...    35   1.1  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    35   1.1  
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    35   1.1  
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    35   1.1  
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    35   1.1  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    35   1.1  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.1  
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    35   1.2  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    35   1.2  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    35   1.2  
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    35   1.2  
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    35   1.2  
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    35   1.3  
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    35   1.3  
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    35   1.3  
KNAG0M00130 Chr13 complement(15079..17142) [2064 bp, 687 aa] {ON}      35   1.3  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    35   1.3  
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    35   1.3  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    35   1.3  
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    35   1.4  
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    35   1.4  
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    34   1.4  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    35   1.4  
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    34   1.4  
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    35   1.4  
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    32   1.4  
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            35   1.4  
NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {O...    34   1.5  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    34   1.5  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    34   1.5  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    34   1.5  
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    34   1.5  
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    34   1.6  
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     34   1.6  
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      34   1.6  
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    34   1.6  
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    34   1.6  
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    34   1.6  
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    34   1.6  
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    34   1.6  
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    34   1.6  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    34   1.7  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    34   1.7  
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    34   1.7  
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    34   1.7  
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    34   1.8  
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    34   1.8  
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    34   1.8  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    34   1.8  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    34   1.8  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    34   1.8  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    34   1.8  
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    34   1.9  
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    34   1.9  
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    34   1.9  
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    34   1.9  
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    34   2.0  
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    34   2.0  
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    34   2.0  
Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..67...    34   2.0  
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    34   2.0  
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    34   2.0  
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    34   2.1  
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    34   2.1  
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       34   2.2  
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    34   2.2  
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    34   2.2  
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    34   2.2  
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    34   2.3  
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    33   2.3  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    34   2.3  
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    34   2.3  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    33   2.3  
TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON}                 34   2.3  
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    34   2.3  
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    34   2.3  
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    33   2.3  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    34   2.3  
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    34   2.4  
KLTH0D03718g Chr4 complement(362790..364790) [2001 bp, 666 aa] {...    33   2.5  
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    33   2.5  
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    33   2.5  
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    33   2.6  
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    33   2.6  
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    33   2.7  
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    33   2.7  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    33   2.7  
KNAG0B01720 Chr2 complement(314126..315787) [1662 bp, 553 aa] {O...    33   2.7  
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    33   2.7  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    33   2.7  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    33   2.8  
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    33   2.8  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    33   2.9  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    33   2.9  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   2.9  
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    33   2.9  
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    33   3.0  
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    33   3.0  
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    33   3.1  
KLLA0F22880g Chr6 (2123577..2127071) [3495 bp, 1164 aa] {ON} som...    33   3.1  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    33   3.1  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    33   3.1  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    33   3.2  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      33   3.2  
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    33   3.3  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    33   3.3  
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    33   3.3  
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    33   3.4  
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    31   3.4  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    33   3.5  
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    33   3.5  
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    33   3.5  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    33   3.5  
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    33   3.5  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               33   3.6  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    33   3.7  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   3.8  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    33   3.9  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    33   4.2  
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    33   4.2  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    33   4.2  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    33   4.2  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    33   4.3  
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     33   4.5  
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    33   4.6  
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    33   4.6  
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    33   4.7  
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    33   4.7  
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     33   4.7  
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    33   4.7  
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    33   4.8  
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    33   4.8  
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    32   4.9  
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    33   4.9  
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    33   4.9  
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    33   4.9  
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    33   4.9  
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 33   5.0  
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     33   5.0  
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    33   5.0  
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    33   5.0  
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    33   5.1  
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    32   5.2  
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    32   5.3  
Skud_1.37 Chr1 complement(77031..81359) [4329 bp, 1442 aa] {ON} ...    33   5.3  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    32   5.3  
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    33   5.5  
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    32   5.5  
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    32   5.6  
NDAI0I03040 Chr9 (721361..721726) [366 bp, 121 aa] {ON}                31   5.8  
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    32   5.9  
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    32   6.0  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             32   6.1  
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    32   6.1  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    32   6.1  
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    32   6.4  
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               32   6.5  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    32   6.5  
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    32   6.7  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    32   6.7  
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    32   6.8  
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    32   6.9  
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    32   7.3  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    32   7.4  
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    32   7.5  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    32   8.0  
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    32   8.2  
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    32   8.2  
YIR027C Chr9 complement(406260..407642) [1383 bp, 460 aa] {ON}  ...    32   8.9  
Smik_13.373 Chr13 complement(581854..583680) [1827 bp, 608 aa] {...    32   9.6  

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score = 1734 bits (4491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 831/831 (100%), Positives = 831/831 (100%)

Query: 1   MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
           MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS
Sbjct: 1   MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60

Query: 61  RKKSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQ 120
           RKKSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQ
Sbjct: 61  RKKSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQ 120

Query: 121 NALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEAD 180
           NALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEAD
Sbjct: 121 NALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEAD 180

Query: 181 EGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHI 240
           EGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHI
Sbjct: 181 EGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHI 240

Query: 241 PLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLIS 300
           PLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLIS
Sbjct: 241 PLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLIS 300

Query: 301 QTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFSISRDSERLTG 360
           QTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFSISRDSERLTG
Sbjct: 301 QTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFSISRDSERLTG 360

Query: 361 MAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLN 420
           MAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLN
Sbjct: 361 MAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLN 420

Query: 421 EINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDEGPLTDIERE 480
           EINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDEGPLTDIERE
Sbjct: 421 EINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDEGPLTDIERE 480

Query: 481 FLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQ 540
           FLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQ
Sbjct: 481 FLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQ 540

Query: 541 SLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRE 600
           SLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRE
Sbjct: 541 SLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRE 600

Query: 601 SLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLN 660
           SLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLN
Sbjct: 601 SLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLN 660

Query: 661 LLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAA 720
           LLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAA
Sbjct: 661 LLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAA 720

Query: 721 LILKEASPDELHLCMRYSTILMSLCSEMRESEDYTTDSPTPGTTFGQDNDPSPIQPLDTA 780
           LILKEASPDELHLCMRYSTILMSLCSEMRESEDYTTDSPTPGTTFGQDNDPSPIQPLDTA
Sbjct: 721 LILKEASPDELHLCMRYSTILMSLCSEMRESEDYTTDSPTPGTTFGQDNDPSPIQPLDTA 780

Query: 781 IPLPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQGSSYSQNLGNAADTPT 831
           IPLPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQGSSYSQNLGNAADTPT
Sbjct: 781 IPLPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQGSSYSQNLGNAADTPT 831

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/869 (51%), Positives = 582/869 (66%), Gaps = 68/869 (7%)

Query: 6   EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK-- 63
           E   +  TKWRR YKAC++CR +K+KCDMGPLD PH PPC RC+RE K C   +++++  
Sbjct: 9   ESSGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGN 68

Query: 64  --SVFKRQHRTNGL-ELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQ 120
             + FK     NGL  + ++ E    +  +     P+     ++ + +D KW+FEI +M 
Sbjct: 69  TDTEFKLGKIENGLVGVMNKSESEQSLLSQTRAPPPNGSTS-NNLDLVDPKWKFEIGTMY 127

Query: 121 NALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEA-----------S 169
           NALEFLAKAAGSV+KE+     I+   P   +R D    ++  T+              S
Sbjct: 128 NALEFLAKAAGSVSKEE----PIEMKSPQ--NRSDLGVGNMPDTALNGVMSDNIGNLDIS 181

Query: 170 RAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVF 229
               +APL    GS R A PLI+KLSS+RPK   KL ++++IG S  L+E+E  +L+D+F
Sbjct: 182 DESFLAPLTTANGSQRAAAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATRLIDIF 241

Query: 230 FLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHE 289
           FLTM+PFFPHIPLQLQDP+EL RYP+LLC+I+T+SARY+ F ++G  D   +NRNIEVHE
Sbjct: 242 FLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYNPFGELGFYDGEAHNRNIEVHE 301

Query: 290 QLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGD----SKDR 345
           +LWIYCQ+LISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYAN+ +    +K  
Sbjct: 302 RLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPELNDVTKRE 361

Query: 346 SNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHT 405
           ++  +  RD+E  TGMAA+RRSDRMAWML G AVRLAQDM F +TSSKIF ATHI+E HT
Sbjct: 362 THGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIFVATHIAEAHT 421

Query: 406 AMNVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDD 465
           AMN+ Q+S L+ESL+E+N   ++  R + +GNE FYLE IL+ D+SK+RWT FL ++ + 
Sbjct: 422 AMNLNQKSILSESLSEVNREVLE--RLDDIGNENFYLEHILQKDESKERWTNFLQNVSEG 479

Query: 466 YAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRII 525
                 GPLTD+EREFLNDEYVLYY    +     SS  LPFPL+FS  QRAKIELLRI+
Sbjct: 480 RRAKGTGPLTDMEREFLNDEYVLYYVNARNDASSKSSLTLPFPLKFSHPQRAKIELLRIL 539

Query: 526 TVGFEAIY--CTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDL 583
           T+G+E+IY    KDK Q +  +P RNL+LL +IS LIE W+ +Y DLL PA   PC++D+
Sbjct: 540 TIGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATYKDLLIPANATPCSLDM 599

Query: 584 CRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAY 643
            RNKR VH + ++IDRESL C+Y YCQLYIYS ALQ DVK   LK+ EI +SA+YVELAY
Sbjct: 600 ARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDLKMPEIRKSARYVELAY 659

Query: 644 NAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILK 703
            AA+ +L SA R+H L +L+ MPVRWVTRIV++VAF+VKCYL L  + +  NP+A TIL+
Sbjct: 660 RAAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCYLVLTKDGLAANPVAGTILR 719

Query: 704 LTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMRESEDYTTDSPT--- 760
           LTVIP+E+ +  I  AA+ L+EA+PDE+HL MRYS IL  LC+E++     +        
Sbjct: 720 LTVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFLCAEVKMRTQMSERDEEAEE 779

Query: 761 --------------PGTTFGQDNDP----------------SPIQPLDTAIP---LP-ND 786
                         P     Q   P                S + P   + P   LP  D
Sbjct: 780 ERKQRQQLECYHRQPRERRQQHAQPVISQSHSPPSPSVMLNSSMDPYSPSAPPADLPFED 839

Query: 787 VVDWFSTSDEIGLEFVESWAEMIEQRYLQ 815
             D F+ SD+IGL+FV++W EMIE RY+Q
Sbjct: 840 PFDLFAASDDIGLDFVDTWTEMIENRYMQ 868

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/911 (50%), Positives = 595/911 (65%), Gaps = 107/911 (11%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRT- 72
           KWRR+Y+ACLNCR RK+KCD+GP+D PH+PPC RCKRE K C F +S K+   +  + + 
Sbjct: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77

Query: 73  ---NGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEISSMQNALEFLAK 128
              N       + K +    + +    S + +    N ID      E+++MQ+ALEFLAK
Sbjct: 78  IAENTANATASMSKAITSVFQGNTSEGSQQPDFKRENSIDPLPINSELTTMQDALEFLAK 137

Query: 129 AAGSVAKEDNQ-----LHEIKQIDPSQVSRDDS-----SWKDLTPTSFEAS--RAGIMAP 176
           AAGSVAKED++       + ++++    SR D+     S +D T  S  A+      +AP
Sbjct: 138 AAGSVAKEDSRDLVDASTKYEELESQSNSRTDTPISSGSAQDSTRNSNSANIPDEACIAP 197

Query: 177 LEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPF 236
           L    G  R  +PLI+KLSSVRPKP  +L+++E+IG    L+EEE +KL+D+FFLTM+PF
Sbjct: 198 LLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEYIGTLKMLSEEEAVKLIDLFFLTMHPF 257

Query: 237 FPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQ 296
           FPH+PLQLQ+P+ELA+YP+LLC+I+T+S+RYHSF ++ + +   NNRN+E+HE+LWIYCQ
Sbjct: 258 FPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNGESNNRNVEIHERLWIYCQ 317

Query: 297 KLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSN-DFS----- 350
           +LISQT+WAEASTRSIGTVLAFLLFTEWNPRAIHW+WSDYAN+ D  D S  D S     
Sbjct: 318 RLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYANNPDLNDVSKRDLSNVACS 377

Query: 351 --------ISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISE 402
                     +  + LTG++A+RRSDRMAWMLTG AVRLAQDMGF  TSSKIFTATHISE
Sbjct: 378 SSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQDMGFMNTSSKIFTATHISE 437

Query: 403 THTAMNVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDI 462
           THTAMN+ QRS L++SL EINL   +    + V NE +YL +IL++D SK+RW++FL  +
Sbjct: 438 THTAMNMNQRSILSQSLAEINLNGYE----DDVENESYYLGQILKSDGSKERWSKFLKKL 493

Query: 463 RDDYAHHDEGPLTDIEREFLNDEYVLYYT-ADGDSKHRDSSNL------------LPFPL 509
               +    G + DIEREF+NDEYVLYY+  DG   H D   +             P+ L
Sbjct: 494 G---SSSTRGRMNDIEREFVNDEYVLYYSDKDGAPAHADEYTMNDDKNRKKQIEEEPYNL 550

Query: 510 RFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHD 569
           +FS  QRAKIELLRI+++G+E IY  K K  S  N    NL+LL ++SPLIESWY +Y  
Sbjct: 551 KFSFGQRAKIELLRIMSIGYETIYRGKLKLYS--NSQYHNLALLSILSPLIESWYNTYKT 608

Query: 570 LLEPAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDV---KEGQ 626
           +L+P  G  C   +C  K+ +  +  K+DRESLI +YYYCQLYIYS ALQVDV   K+ +
Sbjct: 609 ILKPCSGAACNTAMCSEKKYIFELTEKVDRESLISDYYYCQLYIYSLALQVDVGTPKDKK 668

Query: 627 LKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLT 686
           L+++EIT+ A+YVELAYNAAK +L SA R+H+L +LK MPVRWVTRIV+SVAF+VKCYLT
Sbjct: 669 LRMNEITKCARYVELAYNAAKEILNSAIRVHKLKMLKYMPVRWVTRIVRSVAFVVKCYLT 728

Query: 687 LMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCS 746
           L G+ +  NP ANTIL L+VIP E+I++TI  AA+ L+EASPDELHLC RYSTILM LC+
Sbjct: 729 LTGSGIATNPEANTILTLSVIPTEEIIQTIQRAAITLREASPDELHLCTRYSTILMYLCT 788

Query: 747 EMRESEDYTTDSPTP------------GTTFG--------------QDNDPSPIQPLDTA 780
           EM+         P P             TTF               Q   P P  P   +
Sbjct: 789 EMKLRSRPNPQPPVPRSISEQPEQISVETTFNFCGKNETHEKGQGSQQRGPLP-PPRMNS 847

Query: 781 IP----------------------LPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQGSS 818
           +P                      LP  VVDWFSTSDEIGL+FVE W EMIEQ+++   +
Sbjct: 848 LPETTNFAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISNDN 907

Query: 819 YS--QNLGNAA 827
               +NL N A
Sbjct: 908 NKTFENLYNQA 918

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/872 (48%), Positives = 567/872 (65%), Gaps = 74/872 (8%)

Query: 8   RSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF------LQSR 61
           RS++D KW+RS++AC++CR+RK+KCD+GPL+ PH+PPC RC+REGKTC F      + S 
Sbjct: 20  RSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSA 79

Query: 62  KKSVFK---RQHRTNGLELQDEVEKHVVIT---HEVDVGGPSDRIERHSRNKIDGKWRFE 115
             S       Q    G++    V+ +  +    H   +    +  +R  R K    W+ E
Sbjct: 80  NLSTMNGKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREK----WKLE 135

Query: 116 ISSMQNALEFLAKAAGSVAKEDN--QLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGI 173
           ++SMQN+LEFLAKAA SVA + N     E  ++  +  S +D+S  D      ++     
Sbjct: 136 LASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGAS-NDTSENDTPVQQQDSPNENY 194

Query: 174 MAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTM 233
           + PL     S R A+P ++K  S+RPK    LS++EFIG S  L+EEE  +L+D+FFLTM
Sbjct: 195 LTPLTTPHNSRRSALPQLEKSISIRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFFLTM 254

Query: 234 YPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNM--QNNRNIEVHEQL 291
            PFFPHIPLQLQD +EL RYP+LLC+I+T+S+RYH F +    +    +  RNI VHE+L
Sbjct: 255 NPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVHEKL 314

Query: 292 WIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFSI 351
           WIYCQ+LISQT+WAEASTRSIGT+ AF++FTEWNPRAIHWKWSDYAN+ +  D +   S 
Sbjct: 315 WIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKRESF 374

Query: 352 S----RDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAM 407
           S    +D + LTG+AAIRRSDRMAWMLTG AVRLAQD+G  ETS+K+F ATHISE++TA+
Sbjct: 375 SQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESYTAI 434

Query: 408 NVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYA 467
           N+ Q   L++S NE NL  I     N V NE+ YLE+IL+ND+SK RW   L  + D+  
Sbjct: 435 NMNQGLILSQSFNERNLDGID--NLNGVDNERLYLEQILQNDESKARWNGILK-LLDNEV 491

Query: 468 HHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITV 527
              E  L D+EREFLNDEY LYY AD D   +  +  +  PL+F+  Q+AK+ELLRI+ +
Sbjct: 492 GISEEYLQDVEREFLNDEYTLYY-ADHDEDTQQHTQQI-IPLKFTSTQKAKLELLRILIL 549

Query: 528 GFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNK 587
           G+E IY  K  Q+ +  D   NL++L++++PLIESWY +Y  LLE  EG+  +++  RNK
Sbjct: 550 GYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVLSLNQRRNK 609

Query: 588 REVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAK 647
           R+   + R+I+ E++I +YYYCQLYIYS ALQVDV+E +LKL+EI R A +VE AY AAK
Sbjct: 610 RKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAYIAAK 669

Query: 648 MLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVI 707
            +L SA R+H+LN+LK MPVRWV RIV+SVAFIVKCYLTL  + +  NP ANTIL+L+ I
Sbjct: 670 EILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEANTILRLSAI 729

Query: 708 PAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR--------------ESED 753
             ++ ++TI TAA+ LKEA+PDELHLC RYS ILM LC EM+              E + 
Sbjct: 730 SVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLRDKTNNNNNTGENEEQK 789

Query: 754 YTTDSPTP------GTTFGQDNDPSPIQP----------------------LDTAIPLPN 785
              ++  P       + FG  N PS + P                      +D    L N
Sbjct: 790 ILIENSNPDGVEGVASNFG--NVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSN 847

Query: 786 DVVDWFSTSDEIGLEFVESWAEMIEQRYLQGS 817
           +V DWF+   +IGL+FVE W EMIEQRYLQ  
Sbjct: 848 NVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSG 879

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/908 (45%), Positives = 582/908 (64%), Gaps = 90/908 (9%)

Query: 4   ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
           +SE   N+ TKWRRSY+AC+NCR RKIKCD+GPLD PH+PPC RCKRE + C F  ++++
Sbjct: 8   LSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECIFPVTKRR 67

Query: 64  SVFKRQHRTNGLELQDEVEKHV---VITHEVDVGGP--SDRIERHSRNK-IDGKWRFEIS 117
            V  + +   G EL+  +   +   V    ++ GG   SD  + + R K  D  W+ +IS
Sbjct: 68  DVTAKINNMKGSELERSIISSILPDVDKKSLNGGGSAGSDLKQNNIRKKPTDSNWQSDIS 127

Query: 118 SMQNALEFLAKAAGSVAKEDNQLH----------EIKQIDPSQVSRDDSSWKDLTPTSFE 167
           +MQ ALEFLA A G ++K D +            E +  D S  + D+S     + ++  
Sbjct: 128 TMQTALEFLANAVGVISKSDTRSLLNLNQNNTLIENEDADDSNPNNDNSEDVSRSDSNTP 187

Query: 168 ASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVD 227
            SR  I + L  D+ +S+   PL+  + S+RPKP   LS++E+IG +  LTE+E   L++
Sbjct: 188 KSRNSIFS-LIHDDTASKVISPLMGTIESIRPKPTRNLSDIEYIGPNKLLTEDEARTLIN 246

Query: 228 VFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEV 287
           VFFLTM+P+FP+IPLQL +P+EL RYP+LLC+I+TVS+RY+SF +I + +  + +RNI V
Sbjct: 247 VFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVSSRYNSFNEIFINNEYEKDRNIVV 306

Query: 288 HEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGD----SK 343
           HE+LW YCQ+LIS TIWAEASTRSIGT+LAFLLFTEWNPRAIHW WSDY N+ +    +K
Sbjct: 307 HEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTK 366

Query: 344 DRSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISET 403
           +  N+ S  +  E+ TG  A+R SDRMAWM TG+AVRLAQDM F + + KIF ATHISET
Sbjct: 367 NNENNMSEFK-GEKTTGFEAMRHSDRMAWMFTGSAVRLAQDMHFIDNNYKIFMATHISET 425

Query: 404 HTAMNVGQRSTLTESLNEINLGSIK-FPRNN----------SVGNEQFYLEKILENDDSK 452
             AMNV QRSTL++SL+ INL   +   +NN          + GNEQ+YLE+IL++D SK
Sbjct: 426 FNAMNVNQRSTLSDSLSNINLSITRSHGKNNDDEEGHIFAENFGNEQYYLEQILKHDKSK 485

Query: 453 DRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGD------SKHRDSSNLLP 506
           ++W +FL +I  + +  +   +TD ERE+LNDEY+LYY  +          H  +S  LP
Sbjct: 486 EKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILYYQNNNPETQPTWGNHSVTSTSLP 545

Query: 507 FPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKS 566
           +PL+F+   +AKIE+LRI+++ +E IY  K+K+   FN+  +NL++L + SPLIESWY +
Sbjct: 546 YPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSN 605

Query: 567 YHDLLEPAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQ 626
           +H LL+  E  PC +   ++K  V  + + I++ESLI +YYYCQLYIYS AL+VD+K+  
Sbjct: 606 HHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNN 665

Query: 627 LKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLT 686
           L L EIT+SAKYV +AYNAAK +LTSA R+++L LL+ +PVRWVTRI++SVAFIVKC+L 
Sbjct: 666 LNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFLL 725

Query: 687 LMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCS 746
           L  +    N   N I++L+ IP ++ L+ I T ++ L +ASPDELHLC RYS+IL+ +C 
Sbjct: 726 LTESETSENSEINAIIRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCK 785

Query: 747 EMR----------------ESEDYTTDSPTPGTTFGQDNDPSPIQPL------DTAIPL- 783
           E+R                E+ D    + +       +N   PI+P        T +P+ 
Sbjct: 786 ELRNKTQNLYMNEGVAAKQENADVKVGNKSLENLSSIENSQEPIEPFIMNEHPQTELPIN 845

Query: 784 ----------------------PN------DVVDWFSTSDEIGLEFVESWAEMIEQRYLQ 815
                                 PN      +V+DWFS+S +IGLEFVESW EMIEQ YL+
Sbjct: 846 TTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQMYLR 905

Query: 816 GSSYSQNL 823
            S   QN+
Sbjct: 906 SSDGDQNI 913

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/762 (52%), Positives = 533/762 (69%), Gaps = 33/762 (4%)

Query: 12  DTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS---VFKR 68
           ++KWRRSYKACLNCR RK+KCD+GP D PH PPC RCKRE + C F   RKK    +   
Sbjct: 13  ESKWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKKKDDVISGT 72

Query: 69  QHRTN--GLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEFL 126
              TN      Q++    + +      G       ++   +   KW++ + SMQN LEFL
Sbjct: 73  VSLTNVPSAITQEDDNDRIQLNSGSSKGALFSNSPKNPNTQDQSKWKYGLGSMQNTLEFL 132

Query: 127 AKAAGSVAKEDNQL-------HEIKQIDPSQVSRDDSS----WKDLTPTSFEASRAGIMA 175
           A AAGSV+KE N+        H+  +        DDSS     KD+T TS ++    ++A
Sbjct: 133 ATAAGSVSKESNRRLTTARHSHQYAKETSEDFRVDDSSPSSERKDITDTSEQS----VIA 188

Query: 176 PLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYP 235
           PL  + G+ R  V LI++LS VRPKP  KL+++++IG S+ L+E+E  +L+D +FLTM+P
Sbjct: 189 PLLKECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPSNLLSEQEARELIDAYFLTMHP 248

Query: 236 FFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYC 295
           FFP+IPLQLQDP+EL  YP+LLC+I+T+S+RYH F + G  +   N RNIEVHE LW YC
Sbjct: 249 FFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFGFYNGENNKRNIEVHETLWDYC 308

Query: 296 QKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFSISRDS 355
           Q+LISQT+WAEASTRSIGTVLAF++FTEWNPR IHW+ +DYANS + KD     S  +D 
Sbjct: 309 QRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRTDYANSAE-KDTDVPHS-QKDD 366

Query: 356 ERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTL 415
           + LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF ETS+KIF A+HIS+T  +MN+ QR  L
Sbjct: 367 DGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIETSTKIFVASHISDTFASMNMNQRCAL 426

Query: 416 TESLNEINLGSIKFPRN---------NSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDY 466
           +E+ + +  G+ +   +         + VGNE+FYLE++L+N++S++RWTR L  ++ + 
Sbjct: 427 SETFSVVGFGAGRERASAIDSEQTDVDEVGNEKFYLEQMLQNEESRERWTRVLERLQHNN 486

Query: 467 AHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIIT 526
              + GPLTD+EREFLNDEYVLYY    D   +    L PFPL+FS  QRAKIEL+RII 
Sbjct: 487 DKKN-GPLTDLEREFLNDEYVLYYANRNDEMVQQHLQL-PFPLKFSFHQRAKIELIRIIL 544

Query: 527 VGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRN 586
           + ++ IY  K K++   ND   NL++L ++SPLIE WY +Y +LL+ + G+P ++++ +N
Sbjct: 545 IAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIEGWYATYRNLLKISSGQPYSIEIRKN 604

Query: 587 KREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAA 646
           KR VH +  +I+RES++ +YYYCQLYIYS ALQVDVK  +L+++E T+SAKYVELAY AA
Sbjct: 605 KRAVHELGEEINRESILSDYYYCQLYIYSLALQVDVKGPKLRINEATKSAKYVELAYVAA 664

Query: 647 KMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTV 706
           K +L S+TR+HRL +LK MPVRWV RIV++V+F+VKCYLTL G   V N  A TILKL  
Sbjct: 665 KEILISSTRVHRLKMLKYMPVRWVMRIVRAVSFLVKCYLTLTGGGGVPNSEAQTILKLCC 724

Query: 707 IPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEM 748
           I  ++ + TI  AALILKEASPDELHLC+RYS IL+ LC EM
Sbjct: 725 ISLDETIHTIRLAALILKEASPDELHLCVRYSAILLYLCKEM 766

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 55/98 (56%), Gaps = 10/98 (10%)

Query: 743 SLCSEMRESEDYTTDSPTP--GTTFGQDNDPSPIQPLDTAIP-----LPNDVVDWFSTSD 795
            L + +  +E+  +++P     T+   DN P+ +    T  P     LP++ +DWFS S 
Sbjct: 832 GLTTSLFNTEEMRSETPNQRIPTSAVADNTPNNLDNDGTNNPTNFPSLPDEAIDWFSGSA 891

Query: 796 EIGLEFVESWAEMIEQRYLQ---GSSYSQNLGNAADTP 830
           +IGL+FVE W E++EQR+LQ   G++  + L N  + P
Sbjct: 892 DIGLDFVEPWTELLEQRFLQSGDGNNIFEELYNQVNMP 929

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/885 (46%), Positives = 556/885 (62%), Gaps = 95/885 (10%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL--QSRKKSVFKRQHR 71
           KW+R YKAC NC+LRK+KCDMGPL+ PH+PPC RC+REGKTC FL  + RK  +   +  
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78

Query: 72  TNGLELQ---------DEVEKHVVITHEVDVGGPSDRIERHSRNKID-GKWRFEISSMQN 121
           +    L+           ++    + +EV V  P    +    N I   KW+  ++SMQN
Sbjct: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIP----KTSPSNPISPTKWKIGLTSMQN 134

Query: 122 ALEFLAKAAGSVA--KEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEA 179
           +LEFLAKAAG+V      +     ++++ + V +  S  ++ +  +  +S    +  +  
Sbjct: 135 SLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSLPQEESLMNMTSSLHSDLLNISP 194

Query: 180 DEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPH 239
                 K++PLI KL+ VRP P  KL+++++IG +  L+E + I+L+D+FFLTM+PFFP+
Sbjct: 195 IGKLQHKSLPLIDKLNIVRPTPRRKLTDIDYIGPNRLLSESDAIELIDLFFLTMFPFFPN 254

Query: 240 IPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLK-DNMQNN--RNIEVHEQLWIYCQ 296
           IPLQLQ+P+ELA+YP+LLC+I+T+S+RYHSF       +N QNN  R+I+VHE+LWIYCQ
Sbjct: 255 IPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNGQNNKRRHIDVHEKLWIYCQ 314

Query: 297 KLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRSNDFS------ 350
           +LISQTIWAEASTRSIGT+LAF++FTEWNPRAIHW WSDYA    S    ND S      
Sbjct: 315 RLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYA----SDPALNDISKRNMEP 370

Query: 351 --ISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMN 408
             I R+ E LTG+ AIRRSDRMAWML+G AVRLAQD G   T++K+  ATHIS+THTAMN
Sbjct: 371 QIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTKVAIATHISDTHTAMN 430

Query: 409 VGQRSTLTESLNEINLGSIKFPR-----NNSVGNEQFYLEKILENDDSKDRWTRFLHDIR 463
           + QRS L+ S N      +   R     +  V NE FYL +IL+N +SK+RW +     +
Sbjct: 431 MNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNENFYLTQILQNKESKERWKKISATFQ 490

Query: 464 DDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLR 523
            D      G L+D+E EFLNDEY LY++ + +    DSS   P PL+F+ +QRAK+ELLR
Sbjct: 491 KD-NEETVGQLSDMEYEFLNDEYALYFSKEDN----DSSQRPPLPLKFTFVQRAKLELLR 545

Query: 524 IITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDL 583
           I+T+G+E IY    +Q+ + +D  RNL++L+++SPLI+SWY +Y+ LL+    +P +  +
Sbjct: 546 IVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYSNYNSLLKTDAVRPVSPGM 605

Query: 584 CRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAY 643
            + K+E   + + I  E++I +YYYCQLYI+S ALQVDV + +LKL+EITR A YVE AY
Sbjct: 606 HKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIYVEKAY 665

Query: 644 NAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILK 703
            AAK +L SA R+H+L +LK MPV+WV RIV+SVAFIVKCYLTL   +  +NP A TIL 
Sbjct: 666 VAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYLTLTSGSFSSNPEARTILS 725

Query: 704 LTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR-------ESEDYTT 756
           L+ I  ++ ++TI   A+ILKEA+PDELHL  RYS IL+ LC EM+       +S+ Y +
Sbjct: 726 LSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLCREMKSKHESSQQSKGYDS 785

Query: 757 DSPT------------PGTTFGQD-----------NDPSPIQ------------------ 775
            S +             G    +D            DP   Q                  
Sbjct: 786 KSSSNAPLSDDVITNQSGDKMSEDILLKSHAEVAAKDPRTSQENIELQMNKPNLDGKFAS 845

Query: 776 ----PLDTAIPLPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQG 816
                 D    LP DV +WF+TS  IGLEFVE W EMIEQ YLQ 
Sbjct: 846 DMDFTTDNLNELPGDVANWFTTSGNIGLEFVEPWTEMIEQMYLQS 890

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/924 (45%), Positives = 559/924 (60%), Gaps = 104/924 (11%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
           SE  +++  K RR+Y+AC+NCR RK+KCD+GP+D PH PPC RCKRE K C F  +R ++
Sbjct: 8   SENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSSTRGET 67

Query: 65  ------VFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEIS 117
                 +     +T   + + ++          D+          +  K +G KW+FE+S
Sbjct: 68  NGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWKFELS 127

Query: 118 SMQNALEFLAKAAGSVAKED-NQLHEIKQ---------IDPSQVSRDDSSWKDLTPTSFE 167
           SMQNALEFLA+AAG+VAKE   ++ E K          +D S  S  D   K L+     
Sbjct: 128 SMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSRGDSA 187

Query: 168 ASRA-----GIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEV 222
           AS        + A L A   ++R    LI+++S VRP P  K+ + ++IG  + LT+EE 
Sbjct: 188 ASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLTKEEA 247

Query: 223 IKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNN 282
           I+L++ FFLTM+PFFP+IPLQL DP+ELA YP+L C+I+TVSARYH F  +GL +     
Sbjct: 248 IELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNGENGL 307

Query: 283 RNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDS 342
           R+IEVH++LW+YCQKLISQTIWAEASTRSIGTVLAF++FTEWNPR+IH+KWSDYAN  + 
Sbjct: 308 RHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPEL 367

Query: 343 KD----RSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTAT 398
            +     S +    +D E LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF E SSKIF  T
Sbjct: 368 NNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFIVT 427

Query: 399 HISETHTAMNVGQRSTLTESLNEINLGSIKFPRN------NSVGNEQFYLEKILENDDSK 452
           HISET +AMN+ QRS L ES + +NL   KF  +      N  GNE+FYL++IL ND+ K
Sbjct: 428 HISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPNDEIK 487

Query: 453 DRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFS 512
            RW     D   D + +++  LTD EREFLNDEYVLYY+   D  +   ++  PFPLRFS
Sbjct: 488 KRWKGVFED-SADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPLRFS 546

Query: 513 KIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLE 572
             QRAKIE++RI+++ +E IYC K+K++    D   NLS+L + SPL+E W  +Y ++L 
Sbjct: 547 FAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLV 606

Query: 573 PAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEI 632
           P    P ++   +NK++V   + +I+ ES+I ++ YCQLYI+S ALQVD K  +L ++EI
Sbjct: 607 PLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMNEI 666

Query: 633 TRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAV 692
             SA+YVELAY +AK +L SA R+ R  +LK MPVRWV RI++S+AFIVKCYLTL G+ +
Sbjct: 667 VTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGSEL 726

Query: 693 VNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR--- 749
             NP A  ILKL+ I  ++    +   A+ LKEA+PDELHLC RY+ ILM LC+EM+   
Sbjct: 727 ATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRK 786

Query: 750 -------------------------ESEDYT-------------TDSP--TP-------- 761
                                    E  D T             TDS   TP        
Sbjct: 787 SSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPVDEI 846

Query: 762 GTTFGQDNDPSPIQPLDTAIPLPNDVVDWF---------STSDEI----------GLEFV 802
           G      ND S    +++ +   ND+             S S+E+          GLEFV
Sbjct: 847 GDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGLEFV 906

Query: 803 ESWAEMIEQRYLQ-GSSYSQNLGN 825
           E W E+IEQRY+Q G   + N  N
Sbjct: 907 EPWTELIEQRYMQCGDGDNNNFEN 930

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/916 (45%), Positives = 559/916 (61%), Gaps = 110/916 (12%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73
           K RR+Y+AC++CR RK+KCD+GP+D PH+PPC RCKRE K C F  ++  S     +  N
Sbjct: 17  KRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSSNKGTSNDLPPNSIN 76

Query: 74  GLEL------QDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEISSMQNALEFL 126
            + L      + E++         DV      I      K +G KW+ E+SSMQNALEFL
Sbjct: 77  AISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEGMKWKLELSSMQNALEFL 136

Query: 127 AKAAGSVAKEDNQLHEIKQ-----------IDPSQVSRDDSSWK-----DLTPTSFEASR 170
           A+AAG+VAKE  +   IK+           +D +  S  D   K     D T T +E + 
Sbjct: 137 AQAAGTVAKEGAK-EIIKEKSTTPKPLKSSLDATNKSATDEGLKRLSKSDSTNTLYENTA 195

Query: 171 AGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFF 230
             +   L     ++RK   L++++  VRP P  K+ + ++IG    LT+EE I+L++ FF
Sbjct: 196 DMLNHTL----NTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPDSLLTKEEAIELIEAFF 251

Query: 231 LTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQ 290
           LTM+PFFP+IPLQL DP+ELA YP+L C+I+TVSARYH F  +GL +     R+IEVH++
Sbjct: 252 LTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLGLDNGEDGMRHIEVHDK 311

Query: 291 LWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKD----RS 346
           LW+YCQKLISQTIWAEASTRSIGTVLAF++FTEWNPR+IH+KWSDYAN  +  +     S
Sbjct: 312 LWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDPELNNVNARGS 371

Query: 347 NDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTA 406
            + S  +D E LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF E SSK+F  THISET +A
Sbjct: 372 KNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKVFIVTHISETTSA 431

Query: 407 MNVGQRSTLTESLN--EINLGSIKFPRNNS----VGNEQFYLEKILENDDSKDRWTRFLH 460
           MN+ QRS L ES +   +NLG I+   N S    +GNE+FYL +IL +++SK RW R   
Sbjct: 432 MNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFYLNEILPDEESKLRWKRVFE 491

Query: 461 DIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIE 520
           +  +D+  +++  LTD EREFLNDEYVLYY+   D  +   +++ PFPLRFS  QRAKIE
Sbjct: 492 NSENDH-DNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIPPFPLRFSFAQRAKIE 550

Query: 521 LLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCT 580
           ++RI+++ +E IYC K+K++    D   NLS+L + SPLIE W  +Y +LL P    P +
Sbjct: 551 IIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYRELLVPLSDVPFS 610

Query: 581 VDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVE 640
           +   +NK+++   + +I+ ES+I ++ YCQLYI+S ALQVD K  +L ++EI  SA+YVE
Sbjct: 611 LADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTSRLNMNEIVTSARYVE 670

Query: 641 LAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANT 700
           LAY +AK +L+SA R+ R  +LK MPVRWV RI++S+AFIVKCYLTL G+ +  NP A  
Sbjct: 671 LAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSELATNPDARN 730

Query: 701 ILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR-------ESED 753
           ILKL+ I  ++    I   A+ LKEA+PDELHLC RY+ ILM LC+EM+       E   
Sbjct: 731 ILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSYLERPP 790

Query: 754 YTTDSPTP------GTTFGQDNDPSPI------------------QPLD----------- 778
              D  TP       +  GQD    PI                  +PL            
Sbjct: 791 LLRDGTTPLESNRESSLEGQDLTKKPIFSKRIGYNKTETTFEPSERPLTEEINSNSQNSN 850

Query: 779 ------------------TAIPLPNDVVDWFSTSDE----------IGLEFVESWAEMIE 810
                             T   L N++    S SDE          IGLEFVE W E+IE
Sbjct: 851 DTSSKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASEDIGLEFVEPWTELIE 910

Query: 811 QRYLQ-GSSYSQNLGN 825
           QRY+Q G   + N  N
Sbjct: 911 QRYMQCGDGDNNNFEN 926

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/920 (44%), Positives = 561/920 (60%), Gaps = 114/920 (12%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK------SVFK 67
           K RR+Y+AC+NCR RK+KCD+GP+D PH PPC RCKRE K C F  +R+       S+  
Sbjct: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87

Query: 68  RQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEISSMQNALEFL 126
              ++   + +  V   ++ +   D+       +  +  K +G KW+ E+SSMQN LEFL
Sbjct: 88  ITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLEFL 147

Query: 127 AKAAGSVAKED----------------NQLHEIKQIDPSQ----VSRDDSSWKDLTPTSF 166
           A+AAG+VAKE                 N LH   Q    +    +SR  S+  D T T  
Sbjct: 148 AQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASD-TNTPI 206

Query: 167 EASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLV 226
           E     +   L A+  +S+    LI+++  VRP P  K+ + E+IG ++ LT+EE I+L+
Sbjct: 207 ENLTVALATTLNANRTTSQ----LIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELI 262

Query: 227 DVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIE 286
           + FFLTM+PFFP+IP QL DP+ELA+YP+L C+I+TVSARYH F  +GL +     R++E
Sbjct: 263 EAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVE 322

Query: 287 VHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKD-- 344
           VH++LW+YCQKLISQTIWAEASTRSIGTVLAF++FTEWNPR+IH KWSDYAN  +  +  
Sbjct: 323 VHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVN 382

Query: 345 --RSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISE 402
                  +  RD E LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF E SS+IF  THISE
Sbjct: 383 VRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISE 442

Query: 403 THTAMNVGQRSTLTESLNEINLGSIKFPRNNS------VGNEQFYLEKILENDDSKDRWT 456
           T +AMN+ QRS L ES + +NL   +F  + +      +GNE+FYL++IL ND+SK+RW 
Sbjct: 443 TTSAMNMNQRSVLAESFSVLNLNLGRFDNDGNENNENYLGNERFYLDEILPNDESKERWK 502

Query: 457 RFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQR 516
           + L ++  D + +++  LTD EREFLNDEYVLYY+   D  +   +++ PFPLRFS  QR
Sbjct: 503 KVLENLEAD-SDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPLRFSFAQR 561

Query: 517 AKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEG 576
           AKIE++RI+++ +E IYC K+K++    D   NLS+L + SPL+E W  +Y ++L P   
Sbjct: 562 AKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSD 621

Query: 577 KPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSA 636
            P ++   +NKR+V   + +I+ ES+I ++ YCQLYI+S ALQVD K  +L + EI +SA
Sbjct: 622 VPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMSEIVKSA 681

Query: 637 KYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNP 696
           KYVELAY +AK +L+SA R+ R  +LK MPVRWV RI++S+AFIVKCYLTL G+ +  NP
Sbjct: 682 KYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNP 741

Query: 697 LANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR------- 749
            A  ILKL+ I  ++    I   A+ LKEA+PDELHLC RY+ ILM LC+EM+       
Sbjct: 742 DARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHL 801

Query: 750 -------------ESEDYT-------TDSPTPGTTFGQDNDPSPIQP------------L 777
                        +S D +          PT   T G  N      P            L
Sbjct: 802 ERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGKTSAEETSNNL 861

Query: 778 DTAIPLP---------------------NDVVDWFSTSDEI----------GLEFVESWA 806
           + +  LP                     N+++   S S+E+          GLEFVE W 
Sbjct: 862 NNSTELPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASEDIGLEFVEPWT 921

Query: 807 EMIEQRYLQ-GSSYSQNLGN 825
           E+IEQRY+Q G   + N  N
Sbjct: 922 ELIEQRYMQCGDGDNNNFEN 941

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/786 (50%), Positives = 529/786 (67%), Gaps = 56/786 (7%)

Query: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSR-------KK 63
           K   ++R YKACLNC++RK+KCD+GP D PH PPC RCKRE + C F +++       K+
Sbjct: 13  KKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGFRVAKQ 72

Query: 64  SVFKRQHRTNGLELQDEVEKHV---VITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQ 120
           S+   +  + G  + D +   +    +  E+D     DR++ H+++ I      +  ++Q
Sbjct: 73  SLVSLKEESAGKSMADVITSVIQGQTLKKELDTD--LDRLQTHTKDDI--SINTDPPTLQ 128

Query: 121 NALEFLAKAAGSVAKED--NQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRA-GIMAP- 176
           NA  FLAKAAGSVAKED  +Q+    + D  ++   D+  +  + +S+   +A G M P 
Sbjct: 129 NAFYFLAKAAGSVAKEDLRDQVDAATKYD--EIEPTDAVSRQPSVSSYGNKQATGSMEPS 186

Query: 177 -------------LEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVI 223
                            EG     +PLI+KLSSVRPKP +KL ++E+IG    LTE E  
Sbjct: 187 SIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMKLGDIEYIGPYQLLTEAEAR 246

Query: 224 KLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNR 283
           K +D FFLTM+PF P+IPLQLQD +ELARYPLLLC+I+T+SARYH+  D+GL + + N  
Sbjct: 247 KRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHDLGLNE-IDNTV 305

Query: 284 NIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSK 343
           ++E+HE+LWIYCQ+L+SQT+WAEASTRSIGT+LAFL+FTEWNPRAIHWK SDYAN  D  
Sbjct: 306 HVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRAIHWKGSDYANYPDIS 365

Query: 344 D----RSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATH 399
           D     S+  S  + S+ LTG+AA+RRSDRM+W+LTGNAVRLAQD+   E SSKIF  TH
Sbjct: 366 DLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQDLNVIEFSSKIFVMTH 425

Query: 400 ISETHTAMNVGQRSTLTESLNEINLGSIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFL 459
           I ETHTAMN+ +RS+L+ESL+E+ L   +   +N + NEQF+LE+IL+ND SK+RW RFL
Sbjct: 426 ICETHTAMNLNKRSSLSESLSEVRLNGFE---DNDLDNEQFFLERILQNDKSKERWARFL 482

Query: 460 HDIRDDYAHHDEGPLTDIEREFLNDEYVLY-YTADGDSKHRDSSNLLPFPLRFSKIQRAK 518
             + +      +G LTDIEREFLNDEY+LY Y  +  +   D      F L+FSKIQR K
Sbjct: 483 ERVGE---RSKKGSLTDIEREFLNDEYLLYHYNTENPNTQSDPE----FRLKFSKIQRGK 535

Query: 519 IELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKP 578
           +ELL+I+++G+E +Y  K       +D  + LS+L ++SPLIE WY  Y  LL P  G  
Sbjct: 536 VELLKIVSLGYENVYNGKLSS----HDRHQRLSMLSVLSPLIEGWYNIYKSLLVPCGGAA 591

Query: 579 CTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQ---VDVKEGQLKLHEITRS 635
           C++    NK  V  +  K++ ESLI +YYYCQLYIYS ALQ    D    +L+L+EIT+S
Sbjct: 592 CSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQDTSTSKLRLNEITKS 651

Query: 636 AKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNN 695
           A+YVELAYNAAK +L SA R+H+L +LK MPVRWV RIV+S+ F++KCYLTL GN +  N
Sbjct: 652 ARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFMIKCYLTLTGNGITQN 711

Query: 696 PLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMRESEDYT 755
           P ANTIL ++V+P ++I++TI   A+IL+ A+PDELHLC RYSTILM LC+EM+      
Sbjct: 712 PEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTILMYLCTEMKHRCKPN 771

Query: 756 TDSPTP 761
              P P
Sbjct: 772 MQPPVP 777

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 4/51 (7%)

Query: 783 LPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQ---GSSYSQNLGNAADTP 830
           LP  +VDWF+ ++EIGL+FV  W EM+E++++     SSY +N  N   TP
Sbjct: 894 LPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVDDSSY-ENWFNDFYTP 943

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/915 (45%), Positives = 556/915 (60%), Gaps = 108/915 (11%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           + SE  ++   K RR+Y+AC+NCR RK+KCD+GP+D PHEPPC RCKRE + C F   + 
Sbjct: 6   RFSENTTSALPKRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECLFSSQKV 65

Query: 63  KSVFKRQHRTNGL-ELQDEVEKHV--VITHEVDVG--GPSDRIERHSRNKIDG-KWRFEI 116
                  H  N + + + E+  H   +I+ E+ +   G +D     +  K DG KW+ E+
Sbjct: 66  VKNSTSPHMVNTICQSKGEIPNHSRRLISSEMALSEKGTND----ETLFKSDGVKWKLEL 121

Query: 117 SSMQNALEFLAKAAGSVAKEDNQLHEIK-----------QIDPSQVSRDDSSWKDLTPTS 165
           SSMQNALEFLA+AAG+VAKE  +   IK            +D    S  +   K L+ + 
Sbjct: 122 SSMQNALEFLAQAAGTVAKEGAK-ETIKDRSATPRPSESSLDTPHQSAANKELKTLSISE 180

Query: 166 FEASRAG-----IMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEE 220
            +AS        I   L A   S++K   LIK++S  RP P  ++ + E+IG  + LT+E
Sbjct: 181 CDASATNTPHENITDTLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYIGPDNLLTKE 240

Query: 221 EVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQ 280
           E I+L++ FFLTM+PFFP+IPLQL DP+ELA YP+L CSI+TVSARYH F  +GL +   
Sbjct: 241 EAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLGLDNGEN 300

Query: 281 NNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSG 340
             R+IEVH++LWIYCQKLISQTIWAEASTRSIGTVLAF++FTEWNPR+IH+KWSDYAN  
Sbjct: 301 GIRHIEVHDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYANDP 360

Query: 341 DSKD----RSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFT 396
           +  +     S + S  +D E LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF E SSKIF 
Sbjct: 361 ELNNVGVRESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKIFI 420

Query: 397 ATHISETHTAMNVGQRSTLTESLNEINLGSIKF------PRNNSVGNEQFYLEKILENDD 450
            THISET +AMN+ QR  L ES + +NL   KF         N +GNE+FYL +IL +D+
Sbjct: 421 VTHISETTSAMNMNQRPLLAESFSVLNLNVRKFDDDGNKGNENYLGNEKFYLNEILPDDE 480

Query: 451 SKDRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLR 510
           SK RW +      +D    ++  LTD EREFLNDEYVLYY+   D  +   + + P PLR
Sbjct: 481 SKKRWKKVFK-DSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKDDTNLAQNPMPPSPLR 539

Query: 511 FSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDL 570
           FS  QRAKIE++RI+++ +E IYC K+K++    D   NLS+L + SPLIE W  +Y ++
Sbjct: 540 FSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREV 599

Query: 571 LEPAEGKPCTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLH 630
           L P       +   +NK++V   + +++ E++I ++ YCQLYI+S ALQVD K  +L ++
Sbjct: 600 LVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKTSRLNMN 659

Query: 631 EITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGN 690
           EI  SA+YVELAY +AK +L+SA R+ R  +LK MPVRW  RI++S+AFIVKCYLTL G+
Sbjct: 660 EIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYLTLTGS 719

Query: 691 AVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMRE 750
            +  NP A  ILKL+ I  ++    I   A+ LKEA+PDELHLC RY+ ILM LC+EM+ 
Sbjct: 720 ELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKL 779

Query: 751 SEDYTTDSP---TPGTTFGQDN--------------------------------DPSPIQ 775
            +   T+ P   T GTT  + N                                  SP++
Sbjct: 780 RKKSYTERPPLSTNGTTPLESNCESSPEGVDFTKKPTFPKNIRSNKAECNSESSKKSPME 839

Query: 776 PLD-------------------------TAIPLPNDVVDWFSTSDEI----------GLE 800
            +D                         T   L N++    S S+E+          GL 
Sbjct: 840 EIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPSLSEEVTDWFGASEDIGLG 899

Query: 801 FVESWAEMIEQRYLQ 815
           FVE W E+IEQRY+Q
Sbjct: 900 FVEPWTELIEQRYMQ 914

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/844 (46%), Positives = 534/844 (63%), Gaps = 69/844 (8%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73
           K+RR YKACLNCR RK +CD+GP D P +PPC RCKRE K C FL++ K+   KR   T 
Sbjct: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWT- 74

Query: 74  GLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEFLAKAAGSV 133
            ++   +V        E D   P   ++  +  K +G    E++SM NALEFLAKAAGS 
Sbjct: 75  -VDGNTDVNATARFEAE-DKYIPVATLKDTTSIK-EGSLTPELNSMHNALEFLAKAAGSA 131

Query: 134 AKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSSRKAVP---- 189
           AKED+     +   PS   R D + ++ T    E+       P +   GS R ++     
Sbjct: 132 AKEDS-----RSRIPS-YERQDKTIREKTYHREES-------PNQHASGSKRASLATPGK 178

Query: 190 LIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEE 249
           LI+KLS  +P     L ++E+IGG   LTE+E  +L+D+FFL M+PFFP+IP QL+  +E
Sbjct: 179 LIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLFFLNMHPFFPYIPFQLRCSQE 238

Query: 250 LARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEAST 309
           L RYP+LLC+I+T+SARYH+F +  + +  +++RNIEVH++LWIYCQ+LISQ++WAEAST
Sbjct: 239 LKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVHDRLWIYCQRLISQSVWAEAST 298

Query: 310 RSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRS-NDF---SISRDSERLTGMAAIR 365
           RS+GT+LAFLLFTEWNPRAIHW W+DYAN     D S  D+   +   D+  LTGM A+R
Sbjct: 299 RSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRRDYHSEAKRSDNTSLTGMGAMR 358

Query: 366 RSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLNEINLG 425
           RSDRMAWMLTG AVRLAQDMGF   S KIFTA HI+ET TAMN+ QRS L++SL E++L 
Sbjct: 359 RSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQTAMNMNQRSILSQSLAEVSLN 418

Query: 426 SIKFPRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDE 485
                 +   G     +E+I  N+DSK RW  +    RD       G   D E+EFL DE
Sbjct: 419 G----HDGDSGLSSACIEEIFRNEDSKRRWKSYTQQ-RDSVEGKSVG-FCDNEKEFLIDE 472

Query: 486 YVLYYTADGDSKHRDSSNLLPF---------PLRFSKIQRAKIELLRIITVGFEAIYCTK 536
           Y  ++  D D+ +RD SNL             L F+  QRAK+ELLRI+++G+EAIY  K
Sbjct: 473 YAFFHNEDSDA-YRDLSNLGTHEKSKLSAADKLLFTPRQRAKVELLRIMSIGYEAIY-YK 530

Query: 537 DKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVDLCRNKREVHYVVRK 596
           D + +L  D    L++L +++P+I+ W+ +Y  LL P  G  C      NK   +    K
Sbjct: 531 DTKLTLI-DHKHKLAVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTRDENKNATYDTPSK 589

Query: 597 IDRESLICEYYYCQLYIYSSALQVDV---KEGQLKLHEITRSAKYVELAYNAAKMLLTSA 653
           ID ESLI +Y+YCQLYIYS ALQ++    K+ +  ++E+T+SAKYVELAYNAAK +L SA
Sbjct: 590 IDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSA 649

Query: 654 TRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDIL 713
            R+H+L  LK MPVRW  RI+++VAF+V+CY+TL G+ + ++P A TIL + VI AE+I+
Sbjct: 650 IRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTLTGSGLGSDPRATTILAVCVISAEEII 709

Query: 714 KTIHTAALILKEASPDELHLCMRYSTILMSLCSEM-------------RESEDYTTDSPT 760
           + I  AA+ L+EASPDELHLC R+ST+LM LC+EM             R S  ++  +PT
Sbjct: 710 EMIQKAAITLREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQNSELRRSSSHSLHNPT 769

Query: 761 PGTTFGQDNDPSPIQPLDTAIP----------LPNDVVDWFSTSDEIGLEFVESWAEMIE 810
                            D AIP          LP+++ DWF TSD++GL+FVE WAEM+E
Sbjct: 770 DAPARMPTTPAENYAATDFAIPAFLETPHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLE 829

Query: 811 QRYL 814
           Q+++
Sbjct: 830 QQFI 833

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/867 (45%), Positives = 558/867 (64%), Gaps = 75/867 (8%)

Query: 8   RSNKDT--KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
           +SN+ +  KW+RS++AC  CR RKIKC++GPLD PH+PPC+RCKRE + C F++  +KS 
Sbjct: 4   KSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSRKSR 63

Query: 66  FKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEF 125
                  N  +  D+ +   +   + D  G +++ E  +    D  W  ++SSMQNALE+
Sbjct: 64  SLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNK-EIQNMALEDSAWESDVSSMQNALEY 122

Query: 126 LAKAAGSVAKEDNQLHEIKQID-PSQVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSS 184
           LA AA SV++ +N     K  D  +  S+DD + +++    FE  +  +  P        
Sbjct: 123 LASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFE--KTELKNP-------- 172

Query: 185 RKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQL 244
             A  LI +LS +R KP  KLS++ +IG    LTEEE  +L++VFF  ++PFFP+IPLQL
Sbjct: 173 --ASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQL 230

Query: 245 QDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIW 304
            +PE+L RYP+LLC+++T+SARY++F D+ LK     + NI +HE+LW+YCQ+LIS+TIW
Sbjct: 231 HNPEQLVRYPILLCAVITISARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIW 290

Query: 305 AEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKDRS--NDFSI--SRDSERLTG 360
           AEASTRSIGT+LAFLLFTEWNPRAIHW WSDYAN  ++ + +  N+F    S   E +TG
Sbjct: 291 AEASTRSIGTILAFLLFTEWNPRAIHWNWSDYANDSETINFNELNEFDPINSYKGESITG 350

Query: 361 MAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLN 420
             A+R SDRMAWMLTG+AVRLAQDM F +TS+KIF ATHI+ET+ AMNV  RS+L+ESL+
Sbjct: 351 FEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMNVNLRSSLSESLS 410

Query: 421 EINLGSIKF---------PRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDE 471
            +N+ S K                GNE++YLE+I +N   ++     L +I  +  +   
Sbjct: 411 NVNIHSKKIDPVKIIDGKKSERYFGNEKYYLEQIFKNAKDRESSYDLLENILRERRNAKA 470

Query: 472 GPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIELLRIITVGFEA 531
            P  D ER+FLNDEY+L+Y+   D+   D    L  PL F+ IQRAKIELL+I+++G+E 
Sbjct: 471 FP--DNERDFLNDEYILFYSNPDDATQNDE---LDTPLDFTVIQRAKIELLKIMSIGYET 525

Query: 532 IYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTVD--LCRNKRE 589
           IY  K ++ +  N+  +NL++L++ S LI+SWY +Y++LL P E    T+D  L  +K  
Sbjct: 526 IYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEE----TLDPVLNASKMG 581

Query: 590 VHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKML 649
           +  + + I+ ESLIC+YYYCQLYIYS +LQV+ +E +LKL E+++SAKYV +AY++AK +
Sbjct: 582 LQSMTQIIENESLICDYYYCQLYIYSLSLQVEDEESKLKLKELSQSAKYVSIAYSSAKEI 641

Query: 650 LTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTILKLTVIPA 709
           L SA RL  + +LK +PVRWV RIV++++FIVKCY+T      +N    N++L L+ IP 
Sbjct: 642 LNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVTATDKDSMNYKELNSLLSLSGIPV 701

Query: 710 EDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR---------ESEDYTTDSPT 760
           ++ L+ IHTAA++LKE++PDELHLC RYS IL+ L  E++            D   +  T
Sbjct: 702 DESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQAHGNDSMPERLT 761

Query: 761 PGTTF--------------GQDNDPSPIQ------PLD--TAIP---LPNDVVDWFSTSD 795
             TT               G   + +P+       P+D  T  P    P +VVDWFSTS 
Sbjct: 762 ADTTLENAIRTEFTTTSNSGSQVELTPLSNKLATLPIDRNTTPPYASFPTEVVDWFSTSA 821

Query: 796 EIGLEFVESWAEMIEQRYLQGSSYSQN 822
           +IGLEFVE W EMIEQRY++ S  +QN
Sbjct: 822 DIGLEFVEPWTEMIEQRYIK-SGNTQN 847

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/787 (44%), Positives = 490/787 (62%), Gaps = 51/787 (6%)

Query: 13  TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL-QSRKKSVFKRQHR 71
           T W R +KAC NCR++K++CD GP D PH PPC RCKRE K C F  ++ K+        
Sbjct: 17  THWIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVTGEA 76

Query: 72  TNGLELQDEV--EKHVV----ITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEF 125
           TNG+   D V  +K+ +    +   V  G   +R E  +    +  W+ E++SM N L F
Sbjct: 77  TNGIPTVDTVPVKKNELALPALAVTVSPGLIQNRSEMGNEANPNTGWKLELTSMHNTLAF 136

Query: 126 LAKAAGSVAKEDNQLHEIKQI--DPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEA---- 179
           LA+AAG+V+   N+    K +  D S  S + S     TPT F AS  G+  P       
Sbjct: 137 LAQAAGTVSNTLNKGLMKKTLPSDRSTPSLEISRLGSKTPTGF-ASSLGLGMPSNPTKTL 195

Query: 180 -DEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFP 238
             E  ++  V LI+K  + + K    L +++ IG +  L+E+E    +D FF TM+PFFP
Sbjct: 196 LQEIETQNKVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFIDAFFCTMHPFFP 255

Query: 239 HIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQLWIYCQKL 298
           +IPLQLQDP EL  YP+LLC+I+T+S RYHSF + G  +   N RN EVHE+LW  CQ +
Sbjct: 256 YIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNKRNFEVHEKLWDNCQVM 315

Query: 299 ISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDS--KDRSNDFSISRDSE 356
           +S+TIW EASTRSIGTVLAF+LFTEWNPR IHWK SDYAN  D    + SND     ++E
Sbjct: 316 LSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDDEAVSELSND-----EAE 370

Query: 357 RLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLT 416
            LTG  AIRRSDRMAWMLTG+AVRLAQDMGF ET++K+  ATHIS+   +MN+ Q+  L+
Sbjct: 371 ELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVATHISDAFASMNMNQKPVLS 430

Query: 417 ESLNEINLGSIKFPRN--NSVG-------NEQFYLEKILENDDSKDRWTRFLHDI----- 462
            + N +  G+  +  +  NS G       +EQ +++++LEN +S  RW   L  +     
Sbjct: 431 GNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQMLENTNSHTRWRHILSSLQMEDL 490

Query: 463 ----RDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAK 518
               R++Y++     L+D+EREFLNDE++LYY+ +   +  D+    PFPL+FS  Q+AK
Sbjct: 491 FQRQRNEYSND----LSDLEREFLNDEFILYYSLE---RRSDNQETPPFPLQFSYAQKAK 543

Query: 519 IELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKP 578
           IEL  I+ +G++ IY  + +++   N+   NLS+L ++SPL+E W+  Y +LL      P
Sbjct: 544 IELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGWHNVYKNLLIAPSANP 603

Query: 579 CTVDLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKY 638
            T     +KR ++ + + ID ES+IC+Y Y QLYIYS ALQ D K  +L + EIT++AKY
Sbjct: 604 YTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADFKRAELTVSEITQNAKY 663

Query: 639 VELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTL----MGNAVVN 694
           VE+A+NAAK ++ SA R+H+LNLLK MPVRWV R+V++V+F+VKC L L    +G    +
Sbjct: 664 VEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKCCLILNATSIGGGGSS 723

Query: 695 NPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMRESEDY 754
                TILKL  I  +D   TI  AA+ LKEA+PDELHL MRYS IL+ LC E+   +D 
Sbjct: 724 EAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSAILLYLCRELESEKDS 783

Query: 755 TTDSPTP 761
           +   P P
Sbjct: 784 SKKIPFP 790

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (80%)

Query: 783 LPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQGSS 818
           LP++V +WFS + EIGLEFVE W +MIEQR+LQ  +
Sbjct: 886 LPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGT 921

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/805 (42%), Positives = 498/805 (61%), Gaps = 73/805 (9%)

Query: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK------- 63
           K  +WRRSYKAC+NCRL+K+KCD+GPL+ PH PPC RCKRE + C F +  KK       
Sbjct: 20  KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE 79

Query: 64  --SVFKRQHRTNGLELQDEVEKH----------VVITHEVDVGGPSDRIERHSR----NK 107
             S+   Q   N  E  DE++++          +V T+E          ++H R    ++
Sbjct: 80  NDSIDDNQRVPNSPE--DEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSE 137

Query: 108 IDGKWRFEISSMQNALEFLAKAAGSVAKE---------DNQLHEIKQIDPSQVSRDDSSW 158
                +   ++M+NALEFLA AAG  A+E         +N+    K+++   +S D  + 
Sbjct: 138 RKSNLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFE--KELNDDHISIDSPAT 195

Query: 159 KDLTPTS----FEASRAGIMAP-LEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEFIGG 213
           +  T T      + S   I +  L  +E + +K   LI+ + + RP    KL++ ++IG 
Sbjct: 196 QSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYDYIGK 255

Query: 214 SDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDI 273
           S  ++E E I+L++ FFLTM+PF+P++P QLQDP ELARYP+LLC+I+T+S+R+H F ++
Sbjct: 256 SKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHKFNEL 315

Query: 274 GLKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKW 333
           G  + + + R+I+VHE+LW+YCQK+ISQT+WAEASTRS+GTVLAFLLFTEWNPRAIHWKW
Sbjct: 316 GTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAIHWKW 375

Query: 334 SDYANSGDSKDRSNDFSIS--------RDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDM 385
           +DYAN+     + NDFS S        +  +R TG+ AIRRSDRMAWML G +VR+AQDM
Sbjct: 376 ADYANN----PKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRIAQDM 431

Query: 386 GFNETSSKIFTATHISETHTAMNVGQRSTLTESLNEI-----NLGSIKFPRNNSVGNEQF 440
           GF E SS +F ATH SET  AMNVGQRS+L ESLN+       + S +  +  ++ NE F
Sbjct: 432 GFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLKNEIF 491

Query: 441 YLEKILEND---DSKDRW-TRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDS 496
           Y+E I   +     ++ W ++   +I +     D+  L+D  R FLNDE+ L+Y+   D 
Sbjct: 492 YIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDKVRGFLNDEFALFYSNGNDP 551

Query: 497 KHRDSSN--------LLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTR 548
            + +  N         LP P+  SK Q+A IELLRI +  ++ IY     Q+   N+ + 
Sbjct: 552 TYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRNQNQKLSSNNQSH 611

Query: 549 NLSLLHLISPLIESWYKSYHDLLEPAE-GKPCTVDLCRNKREVHYVVRKIDRESLICEYY 607
           N+SLL + +PL+ +W  ++ DLL+P++  +P  ++   NKR V    + I+ ESLIC+Y 
Sbjct: 612 NISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRNNKRVVKEFNKIIEGESLICDYN 671

Query: 608 YCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPV 667
           YCQLYI+S ALQ+ +    L ++EIT+S+ Y+ LAY +AK  + S  R+  L +LK MPV
Sbjct: 672 YCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKMLKYMPV 731

Query: 668 RWVTRIVKSVAFIVKCYLTLMGNAVVNNPLA--NTILKLTVIPAEDILKTIHTAALILKE 725
           RW+TR++++ AF+VKCYL++ G     N ++  N I KL    A ++L+ I  +A++L  
Sbjct: 732 RWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSAILLGS 791

Query: 726 ASPDELHLCMRYSTILMSLCSEMRE 750
           +SPDELHLC RYS+I+M    EM E
Sbjct: 792 SSPDELHLCSRYSSIIMCFYKEMSE 816

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/31 (67%), Positives = 27/31 (87%)

Query: 785  NDVVDWFSTSDEIGLEFVESWAEMIEQRYLQ 815
            N+ +DWFS S +IGLEFVESW EM+EQRY++
Sbjct: 979  NEFLDWFSASGDIGLEFVESWTEMLEQRYMK 1009

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/938 (40%), Positives = 512/938 (54%), Gaps = 162/938 (17%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73
           KWRR YKACLNCR RK++CD+GP+DKP EPPC RC RE K C F + R+    + +   N
Sbjct: 24  KWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNRRIRVAKN 83

Query: 74  GLELQDEVEKHVVITHEVDVGGPSDRIERHS-------------------RNKIDGK--- 111
                 E +  + + +    G PS    R S                   R + D     
Sbjct: 84  DRAGHAEPDGGICVANAH--GDPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQSSNS 141

Query: 112 ------------WRFEISSMQNALEFLAKAAGSVAKEDNQLHEIKQIDPSQVSRDDSS-- 157
                          E +++ N LEFL KAAGSVAK++ +L        + V +  ++  
Sbjct: 142 DEPEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAKDNGRLLSSS----TAVGKHSAAIC 197

Query: 158 -------WKDLTPTSFEASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLEF 210
                  +  L    + +  +G   P    + ++    P  +  S+  P     L N+E+
Sbjct: 198 ESITLQLYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQEEPESTKYPL----LRNIEY 253

Query: 211 IGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSF 270
           +G ++ LT EEVI+L ++FF+T YPFFPHIPL +QDPEELARYP+LLC ++++SARYH F
Sbjct: 254 VGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPILLCGVLSISARYHKF 313

Query: 271 CDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIH 330
            DIGL +     RNI+VHE LW YCQ++ISQT+W EASTRSIGTVL FL+FTEWNPRAIH
Sbjct: 314 EDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVLVFLIFTEWNPRAIH 373

Query: 331 WKWSDYANSGDSKDR-------------SNDFSISRDSERL--------TGMAAIRRSDR 369
            K +DYAN+ D ++              S   +  R+  R         +G++A+RRS R
Sbjct: 374 RKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERNGPRRFVLADQGSSGLSAMRRSKR 433

Query: 370 MAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLNEINLGSIKF 429
           MAWML GNAVRLAQDM F  TSSKIF ATH SET+ AMN+GQ STL+ SL   N+  I  
Sbjct: 434 MAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTLSHSLMNANI--IGS 491

Query: 430 PRNNSVGNEQFYLEKILENDDSKDRWTRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLY 489
             + ++ N     E       +++R+   L  +   +     G L+ +  EFL DE +LY
Sbjct: 492 ESSTAISNPPMPSE-------TEERYKSVLQRL-GKHVPRGRG-LSQLYNEFLEDERILY 542

Query: 490 YTADG--------DSKHRDSSNLL-------------PFPLRFSKIQRAKIELLRIITVG 528
               G        DS  +  +N+                 +  S  QRAKIELLRI++VG
Sbjct: 543 GLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLERGGQQVFLSFAQRAKIELLRIMSVG 602

Query: 529 FEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPC--TVDLCR- 585
           +E IY    K   +  +    LS+L L+SP IE+WY  Y+ LL PA G P   T D  R 
Sbjct: 603 YETIYSNHAKL--VLREKHHILSVLGLLSPQIENWYTQYNSLLVPAGGAPFNPTADFSRI 660

Query: 586 NKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLK----LHEITRSAKYVEL 641
           N  +   +VR+ID ES+IC+YYYCQLYIYS AL VD ++ +      L  + +SA+YVEL
Sbjct: 661 NPLD---LVRRIDAESIICDYYYCQLYIYSLALTVDFRKPRHPNASWLDRLMKSARYVEL 717

Query: 642 AYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTI 701
           AYNAA+ +L SA R+HR+ +LK MP RWV RIV +VAFIVKCYLT+  +   ++  A+ I
Sbjct: 718 AYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVKCYLTMAAHLTASHE-ASAI 776

Query: 702 LKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMRESEDYTTDSPTP 761
           L L+ IP ++++ TI  AA+ L+EASPD++HLC +YSTILM LCSEM+     T   P P
Sbjct: 777 LTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILMYLCSEMKLRNWPTPTPPLP 836

Query: 762 GTTFGQ-------------------------------DNDPSPI------------QPLD 778
            +  G+                                 DP P+             P D
Sbjct: 837 RSVSGEPIRVPVFECSATPAARIFSPPHHPAESQTTGGTDPPPLPDHTLAAPSSDPAPFD 896

Query: 779 TAIPLPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQG 816
           T   LP +++DW  TSDEIGL+FVE W ++IE+    G
Sbjct: 897 TTSHLPWELIDWLHTSDEIGLDFVEPWTDVIERLMESG 934

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  542 bits (1396), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 340/924 (36%), Positives = 506/924 (54%), Gaps = 131/924 (14%)

Query: 9   SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFK- 67
           S++  K + ++ ACL C+ +KIKCD+GP D+P  PPC  C+R    C F  + K  + K 
Sbjct: 25  SSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC-FFNAPKVKIGKL 83

Query: 68  ------------------------------RQHRT-NGLE------LQDEVEKHVVITHE 90
                                         + HR  NG +      L + V         
Sbjct: 84  GNILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEG 143

Query: 91  VDVGGPSDR-IERHSRNKIDGKWRFEISSMQNALEFLAKAAGSVAKEDNQLHEIKQIDPS 149
           V +  P+   IE   R K D  W+ E++SMQ+ALEFLAKA  +  + D + +E      S
Sbjct: 144 VSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKA--TKLRNDYKNNEPFGSTRS 201

Query: 150 QVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLE 209
             +   S  +DL+      + +       + + S+R + P I+ +    P P     N +
Sbjct: 202 DAASTTSETRDLSEKD-NGNESDSTTNSTSKDTSTRSSYPSIEAIKPEVPTPSNH--NYD 258

Query: 210 FIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHS 269
            +G    +T +E   LV++FF  M+PF+P+IPL LQD +EL +YPLLL  I+ +SARY+ 
Sbjct: 259 LLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNP 318

Query: 270 FCDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAI 329
           F  +G  + ++ NRN+ +H +LW +CQ+L+SQT+W++ASTRSIGT LAFLLFTEWNPRAI
Sbjct: 319 FDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAI 378

Query: 330 HWKWSDYANSGDSKDRSNDFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNE 389
           HW+ SD A+     + S   S   D + L G+A ++RSDRMAWM TG A+RLAQ+M   E
Sbjct: 379 HWEVSDTAHYLSDNNVS---SSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILE 435

Query: 390 TSSKIFTATHISETHTAMNVGQRSTLTESLNEINLGSIKFPRNN-----SVGNEQF--YL 442
            ++KI+TA +I+E   A N+  + TL ESL  I+ G  +F  +N      + NE    ++
Sbjct: 436 NNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQDDIENEDLLKFV 495

Query: 443 EKILENDDSKDRWTRFLHDIRDDYAHHDEGP--LTDIEREFLNDEYVLYYTADGDSKHRD 500
           + + +N +S  +W   +H    D    +E P  + D+E EFLNDEY + Y         +
Sbjct: 496 QLVAQNKESTKKWA--IHKAYSDKLK-EENPDLIIDLETEFLNDEYSINYL-------DE 545

Query: 501 SSNLLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLI 560
           +S+ L  P+ ++  Q+A++ELLRI+T+ ++ IY  K K++    D  +NL +L ++SP++
Sbjct: 546 NSSFLKNPIPYTTYQKAQLELLRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPIL 605

Query: 561 ESWYKSYHDLLEP-AEGKPCTV---DLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSS 616
            +WY +Y+ L++P ++ KP  +   DL + KR  +     I  ES I +YYYCQLY +S 
Sbjct: 606 NAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTAN-----IRGESFISDYYYCQLYTFSL 660

Query: 617 ALQVDVKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKS 676
           ALQV+VKE +L L+E+ +SA++VE AY AAK +L SA R+H++++LK MPVRWV RIV+S
Sbjct: 661 ALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRS 720

Query: 677 VAFIVKCYLTLMGNAVVNNPLANTILKLTVIPAEDILKTIHTAALILKEASPDELHLCMR 736
            +FIVKCY+TL  +++  N  A +ILKL+ I  +D +  I  AA+ILKE++PDELHL  +
Sbjct: 721 ASFIVKCYITLCDHSMATNSEAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASK 780

Query: 737 YSTILMSLCSEMRESEDYTTDSPTPGTTFGQDNDPS-----------------PIQPLDT 779
           +STILM LC E+ E +    D+    T  G +NDPS                  I     
Sbjct: 781 FSTILMFLCKEIDERK---RDNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQ 837

Query: 780 AIPLPNDVVDWFSTS--------------DEIG---------------------LEFVES 804
             P  ND     +T               DEIG                     L+FVE 
Sbjct: 838 EPPSENDSSHDTTTQGTANSTRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEP 897

Query: 805 WAEMIEQRYLQGSSYSQNLGNAAD 828
           W E+IEQ+Y+Q     Q+     D
Sbjct: 898 WTELIEQKYIQNKDGFQDFDQLFD 921

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           Q + V      + +RS  ACL+CR R IKC       P   PC++C      CE+L+  K
Sbjct: 15  QPAYVNKQPQKRQQRSSVACLSCRKRHIKC-------PGGNPCQKCVTSNAICEYLEPSK 67

Query: 63  KSVFKRQHRTN-GLELQDEVE-----KHVVITHEVDVGGP--SDRIERHSRN 106
           K V   ++      +L D+ E     K +++   V V G   SD  ERH  N
Sbjct: 68  KIVVSTKYLQQLQKDLNDKTEENNRLKALLLERPVSVRGKDNSDDDERHINN 119

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 4  ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          I E+ ++K  K +RS  AC  CR R IKC       P   PC +C + G  CE+++  KK
Sbjct: 28 IVELLNDKKKKVKRSSLACTRCRRRHIKC-------PGGNPCSKCLKAGVACEYVEPNKK 80

Query: 64 SV 65
           +
Sbjct: 81 LI 82

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query: 7  VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCE 56
          V +N+ T  R+S+  C  CR RK+KCD+      + P C+RC R G  CE
Sbjct: 2  VGNNEMTTKRKSFNGCWTCRSRKVKCDL------NRPKCQRCDRLGIICE 45

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 10/80 (12%)

Query: 2  DQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSR 61
          D  ++ + +K  K +R   ACL CR R IKC       P+  PC +C +    CE+++  
Sbjct: 14 DTNTQSKIDKTKKQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEYIEPS 66

Query: 62 KKSVFKRQHRTNGLELQDEV 81
          +K V   ++ +N   LQD +
Sbjct: 67 RKIVISMKYLSN---LQDSL 83

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
          Q + V   +  K  RS  ACL+CR R IKC       P   PC++C      CE+L+  K
Sbjct: 15 QAAYVHKQRQRKQPRSAVACLSCRKRHIKC-------PGGNPCQKCITSNAICEYLEPSK 67

Query: 63 KSVFKRQH 70
          K V   ++
Sbjct: 68 KIVVSTKY 75

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNG 74
           +R+  AC++C   K+KC    LD  +  PC+RC + GK C F  S K++  ++Q  +N 
Sbjct: 116 KRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTFDLS-KRTKRRKQRNSNS 173

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
          Q + V   +  + +RS  ACL+CR R IKC       P   PC++C      CE+L+  K
Sbjct: 15 QRAYVNKQRQGRQQRSSIACLSCRKRHIKC-------PGGNPCQKCVASNAICEYLEPSK 67

Query: 63 KSVFKRQH 70
          K V   ++
Sbjct: 68 KIVVSTKY 75

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 7/44 (15%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K R SY  CL CR RK+KCD         P C RCK++GK C +
Sbjct: 8  KQRPSY-VCLECRSRKLKCDKA------RPYCNRCKKDGKVCAY 44

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 12/114 (10%)

Query: 10  NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQ 69
           NK  K R+  KAC+ CR RK+KCD+       +P CK+C      C +       +   +
Sbjct: 2   NKTRKRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIYTNQYNFDLSDAE 55

Query: 70  HRTN--GLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQN 121
              N   ++L +E+ K +   H+     P   I   +   I+  W+F+I    N
Sbjct: 56  LFANQPNIQLLNEIAK-LKEKHQTQAQEPDKDINLQT---INPYWQFKIQVFNN 105

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+G       P CKRC+R G  C
Sbjct: 15 KTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 10 NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCE 56
          N +T   R+Y  C  CR RKIKCD        +P CKRC +    CE
Sbjct: 4  NDETARNRTYSGCWTCRSRKIKCDQ------QKPQCKRCLKANLKCE 44

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CRLRK+KCD+G      +P C+RC++ G  C
Sbjct: 39 KTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 7  VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVF 66
          V   +  +  RS  ACL+CR R IKC       P   PC++C      CE+L+  KK V 
Sbjct: 19 VNKQRQRRQPRSAVACLSCRKRHIKC-------PGGSPCQKCITSNAICEYLEPSKKIVV 71

Query: 67 KRQH 70
            ++
Sbjct: 72 STKY 75

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR+RK+KCD+G      +P C+RC++ G +C
Sbjct: 41 KTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 17/88 (19%)

Query: 1  MDQISEVRSNKD-------TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGK 53
          MD++S+  SN D       +K R    AC+ CR R IKC  G        PC RC +   
Sbjct: 1  MDKVSQNLSNNDKNNTEPSSKRRPKSLACILCRKRHIKCSGGN-------PCARCIKHDL 53

Query: 54 TCEFLQSRKKSVFKRQHRTNGLELQDEV 81
           CE+++  KK V   ++     +LQD +
Sbjct: 54 KCEYIEPSKKIVVSLKYLQ---QLQDSL 78

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
           Anc_8.423
          Length = 948

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 20/101 (19%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
           ++S+  + K     +S   C NC+ R++KCD        +P CK+C     TC +  LQ 
Sbjct: 44  KVSKTSTGKRKFHNKSKNGCDNCKKRRVKCDE------VKPSCKKCTNMQLTCVYSPLQP 97

Query: 61  RKKSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIE 101
           RK        R  G      V KHV  + ++  G P++ I+
Sbjct: 98  RK--------RPKG----PPVLKHVATSEKIMAGSPNNGID 126

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           RR  KAC NCR RKIKCD   +D P +  C  C +  K C F
Sbjct: 157 RRVVKACYNCRRRKIKCD--AID-PSKNKCSNCLKLNKICSF 195

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 10/91 (10%)

Query: 7   VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVF 66
           VRS K ++ R S+  C NCR RKIKCD        +P C RC + G  C +  S + S+ 
Sbjct: 19  VRSKK-SRLRLSF-VCRNCRKRKIKCDKA------QPKCGRCAKLGLECNYDLSEQISLK 70

Query: 67  KRQHRTNGLELQDEVEKHVV--ITHEVDVGG 95
           K   R   +  Q E  +H    + H +++ G
Sbjct: 71  KTPGRPVTIHEQLEELEHKFEDMRHSLNLSG 101

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 11/53 (20%)

Query: 8  RSNKDTKWR-----RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          R + DTK +     +++  C  CR RK+KCD+G      +P C+RC++ G  C
Sbjct: 4  RKSSDTKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +IS    + D K  ++++ C  CRLRKIKCD+       +P C +C+    +C
Sbjct: 4  RISTSSRDADNKRAKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISC 50

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 10 NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          NK TK  R    C  CR+RK+KCD        +P C RC + G  C +   R+K
Sbjct: 3  NKQTKRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIYNPYRQK 50

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 1   MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
           M+ IS++      + RR+ KAC  CR RK KCD      P+   C  C + G  C F+  
Sbjct: 157 MNNISQMPGQLHKEKRRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIFITE 213

Query: 61  RKKSVFKRQHRTNGLEL 77
             K   KR+  + G ++
Sbjct: 214 PTKK--KRKSSSEGTKV 228

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 35/77 (45%), Gaps = 11/77 (14%)

Query: 2   DQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF---- 57
           D   E+   K TK  R   AC  CR +KIKCD   +       C  C+R G+ C F    
Sbjct: 38  DPPMEMHGKKRTKASR---ACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSFERVP 90

Query: 58  LQSRKKSVFKRQHRTNG 74
           L+      + RQHR +G
Sbjct: 91  LKRGPTKGYSRQHRNSG 107

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584
          aa] {ON} 
          Length = 584

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 7  VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK--S 64
           R +   + R S+  C  C+ RKIKCD G      +P C  C R  K+C++LQ ++   S
Sbjct: 2  ARVSGTPRKRYSHNGCKECKRRKIKCDEG------KPVCWHCDRLEKSCQYLQVKEAEYS 55

Query: 65 VFKRQH 70
          V K  H
Sbjct: 56 VRKVTH 61

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 49/109 (44%), Gaps = 17/109 (15%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
           RR  KAC +CR RKIKC  GP++ P +  C  C +    C F  + + S  KRQ   NG 
Sbjct: 97  RRVSKACDHCRKRKIKC--GPIN-PAKNKCDNCIKYSSACTF--THQPSNQKRQD--NGG 149

Query: 76  ELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEIS---SMQN 121
             Q     H      ++V  P   +      K+ GK R   +   SMQN
Sbjct: 150 ASQGTAASH------INVAQPESLVSIAEAQKV-GKPRKNAAGSPSMQN 191

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 6/45 (13%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          K+ +  +++  C  CR RK+KCD+G      +P C+RC + G  C
Sbjct: 12 KEVRRVKTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
           + + S++  K +R+  AC++C   K KC    LD     PC+RC R  K C F  S++  
Sbjct: 50  TRINSSEWEKRKRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFDLSKRTR 109

Query: 65  VFKRQHRTNG 74
             KR+ R+ G
Sbjct: 110 --KRKSRSIG 117

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa]
          {ON} Anc_6.279 YPL248C
          Length = 1033

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC NCRL+K+KC        H P C +C +    C +    K+S   R H TN   L++
Sbjct: 9  QACDNCRLKKLKCSK------HFPKCGQCLKNNWPCIYSPKVKRSPLTRVHLTN---LEN 59

Query: 80 EVEK 83
          ++EK
Sbjct: 60 KLEK 63

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73
           K R+  +AC+ CR R IKC       P   PC++C      C+F +  KK +    + T 
Sbjct: 51  KKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFSEPNKKVIVSINYLT- 102

Query: 74  GLELQDEVE 82
             +L D ++
Sbjct: 103 --KLHDNIK 109

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 7/68 (10%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
          S++  K RR  +AC  CR +K+KCD        + PC  C      C + Q  K+S    
Sbjct: 23 SSQQPKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKRSNSNL 75

Query: 69 QHRTNGLE 76
          QH  N  E
Sbjct: 76 QHLKNSSE 83

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 4   ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
           +S+  + K     +S   C+NC+ R++KCD G      +P CK+C     +C ++ +
Sbjct: 79  VSKTSTGKRKFHNKSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVYISA 129

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 11/49 (22%)

Query: 21 ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF----LQSRKKSV 65
          ACL+CR ++ KC+M       + PC  C+R G  C F    L+S++KSV
Sbjct: 20 ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIFTHEDLRSKRKSV 61

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON}
          Anc_6.279 YPL248C
          Length = 875

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC  CR++K+KC         +P C++C + G  C +    K+S   R H T   E+++
Sbjct: 19 QACDLCRIKKLKC------SKDKPACRKCAKNGWNCTYSPKAKRSPLTRAHLT---EVEN 69

Query: 80 EV 81
          E+
Sbjct: 70 EL 71

>Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON}
          YKL222C (REAL)
          Length = 704

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 21/83 (25%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRC-KREGKTCEF------------LQSRK 62
          ++  K+CL CRLRK+KCD G       P C  C  R  K+C +             + R+
Sbjct: 18 KKPAKSCLFCRLRKLKCDRG------RPSCGSCSSRHQKSCNYEDNSSAKENQLRAKYRR 71

Query: 63 KSVFKRQHRTNGLELQDEVEKHV 85
           S F+   R    EL+ ++EKH 
Sbjct: 72 CSKFEMARRIE--ELESQIEKHA 92

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           S++ + ++ K +R+  AC+ C   K KC     +  +  PC+RC R GK C+F  S++
Sbjct: 69  SKMETTENGKIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCKFDLSKR 126

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 9/73 (12%)

Query: 1   MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL-- 58
           + + S V   K TK + S   C  C+ R++KCD G      +P C +C R  + C+++  
Sbjct: 176 IKKASAVGDPKRTKRKYSRNGCTECKRRRMKCDEG------KPICWQCSRLNRECKYILN 229

Query: 59  -QSRKKSVFKRQH 70
            +++K++  K+Q 
Sbjct: 230 ARNKKRAAAKKQQ 242

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 7  VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++   +K  +++  C  CR RK+KCD   L +PH   C+RC++ G  C
Sbjct: 25 LKNGTKSKRGKTFTGCWTCRSRKVKCD---LRRPH---CQRCEKSGLVC 67

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON}
          Anc_6.279
          Length = 890

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC NCRL+K+KC          P C +C + G  C +    K+S   R H T   + ++
Sbjct: 18 QACDNCRLKKLKCSK------ETPKCSKCLKNGMKCLYSPKVKRSPLTRVHLT---QTEN 68

Query: 80 EVEK 83
          ++EK
Sbjct: 69 KLEK 72

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON}
          Anc_7.512 YLR451W
          Length = 766

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
          RR Y AC+ CR +K KCD          PC RCK++G  C   Q  K++  K++     +
Sbjct: 13 RRKY-ACVECRQQKSKCDYT---TKFPEPCSRCKKKGIICAVKQGFKRT--KKRATAEAI 66

Query: 76 ELQDEVEKHVVITHEVDV 93
          E + E  K+ +    V V
Sbjct: 67 ERKIEQLKNHIADGPVSV 84

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa]
          {ON} similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          +N D K +RS  AC++C   K KC+       +  PC RC +  K C+F
Sbjct: 51 TNADGKVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQF 99

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 9/83 (10%)

Query: 13  TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRT 72
           TK +R  +AC  CRL+KIKCD        +P C  CK+ G  C       +  F R +  
Sbjct: 54  TKVKRFSQACDRCRLKKIKCD------GIKPSCSNCKKIGYHCSTSDKLTRRGFPRGYTE 107

Query: 73  NGLELQDEVEKHVVITHEVDVGG 95
               L++EV K   +   VD  G
Sbjct: 108 ---MLENEVIKLQRLCGMVDENG 127

>TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON}
          Anc_7.512 YLR451W
          Length = 923

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 8  RSNKDTKWR-RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVF 66
          RSN +T    R   AC+ CR +K KCD    D+  E PC RC + G TC  LQ   +  +
Sbjct: 23 RSNSETTTHGRKKVACVECRQQKSKCDA--YDRAPE-PCTRCMKRGLTC-VLQRDFRRTY 78

Query: 67 KR 68
          KR
Sbjct: 79 KR 80

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
          K  R    CLNCR RK KCD G      +P C  C + G+TC + +   ++  K+
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCVYSEDTDENASKK 61

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 6/56 (10%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL 58
           ++S+  + K     +S   C+NC+ R++KCD G      +P CK+C      C +L
Sbjct: 184 KVSKTSTGKRKFHNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCVYL 233

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
          Ashbya gossypii AER141C
          Length = 665

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQ 59
          +R  K C NC+  K+KC+          PC RC R G  C F+Q
Sbjct: 8  KRRTKPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYFIQ 46

>TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON} 
          Length = 873

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
          +R   AC+ CR +K KCD   L+K  E PC +C ++G +C  LQ   +  +KR
Sbjct: 26 KRKKFACVECRQQKSKCD--ALEKAPE-PCTKCSKKGVSC-VLQKDYRRTYKR 74

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 12/103 (11%)

Query: 5   SEVRSNKDTKWRRSY--KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           S VR  K    +R Y    C  C+ R++KCD        +P C +C R  + C ++ + K
Sbjct: 134 STVRDKKGNTVKRKYSRNGCSECKRRRMKCDET------KPTCWQCARLNRECVYVLNPK 187

Query: 63  KSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSR 105
                ++ RT+      E +KH  I  E    GP  R  + S+
Sbjct: 188 ----NKKRRTSNANKIKESKKHNSIHDEDHPHGPYKRQHQSSK 226

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
          + +RS  AC+ CR R +KC       P   PC +C      CE+++  KK +   ++
Sbjct: 40 RQKRSSMACVRCRRRHVKC-------PGGNPCSKCIAANIACEYIEPNKKLIVSMKY 89

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 6/52 (11%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
          S +  K  R  K CL CR RK+KCD         P C RC +    C +  S
Sbjct: 2  SRRGVKKPRPSKVCLTCRRRKVKCDQ------QHPSCMRCIKSSTLCTYTYS 47

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 838

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 7/48 (14%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          RRS  AC+ CR + +KC       P   PC +C      CE+L+  KK
Sbjct: 36 RRSTLACVRCRRKHVKC-------PGGDPCSKCSAARIACEYLEPNKK 76

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 6  EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          E   NK+ K +R+  ACL CR R ++C       P   PC +C      CE+L+  KK +
Sbjct: 42 EGGGNKERK-KRAPLACLRCRKRHVRC-------PGGNPCSKCVSANIACEYLEPSKKLI 93

Query: 66 FKRQH 70
             ++
Sbjct: 94 VSMKY 98

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
          +RS +AC  CRL+KIKCD         P C  CK+ G  C+      +  F R +
Sbjct: 23 KRSSQACDRCRLKKIKCDG------LRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
           Anc_4.344 YML076C
          Length = 936

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 1   MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
           M + +++ + KD K +R   AC+ C   K KC     +  +  PC+RC R+   C+F  S
Sbjct: 33  MREPTKLETKKDGKTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKFDLS 92

Query: 61  RKKSVFKRQHRTNGLELQDEVEK 83
           ++     R+ R  G+   D   K
Sbjct: 93  KR----IRKKRKMGMASIDNSAK 111

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           +++ +++  K +R+  AC++C   K KC     +  +  PC RC + GK C F
Sbjct: 91  TQMETSEGGKLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 9/87 (10%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
           R+++ AC NCR+++ KCDM       E PC  C + G  C  + + K++          L
Sbjct: 11  RKAHLACQNCRIKRRKCDM-------ERPCSNCLKYGIECITVNNDKRTKRTTHEYVEKL 63

Query: 76  ELQ-DEVEKHV-VITHEVDVGGPSDRI 100
           E + D++++ +  +  E   G PS+ +
Sbjct: 64  EAEIDDLKRSIEKMKSETLEGTPSNTL 90

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON}
          Anc_2.547 YKL038W
          Length = 1088

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 8  RSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          RS+ + +  ++ +AC  CR +K+KCD G         C  C+R G+ C F
Sbjct: 49 RSSSNKRRTKASRACDQCRKKKVKCDNG----DDRSVCTNCQRNGEKCTF 94

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+        P C RC+R G  C
Sbjct: 17 KTFTGCWTCRARKVKCDL------TRPSCTRCERSGLKC 49

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 17  RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLE 76
           +S +AC  CR++K+KC         +P C +C + G  C +    K+S   R H T    
Sbjct: 7   KSEQACDICRIKKLKCSR------EKPKCAKCMKNGWECCYSPKAKRSPLTRAHLT---R 57

Query: 77  LQDEVEKHVVITHEVDVGGPSDRIERHSRN 106
           ++D++ K   + + + +G  S      S N
Sbjct: 58  VEDKLSKLENLFNALFIGKESTPTNTRSMN 87

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 16/82 (19%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
           +R+ +AC +CR RKIKCD  P+D P    C  C +    C F  +RK+        +N L
Sbjct: 135 KRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVF-DNRKRKATNANTNSNKL 190

Query: 76  ------------ELQDEVEKHV 85
                       + QD++E H+
Sbjct: 191 LKTMNPKSHESEDDQDDIEDHL 212

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          RSY  C  CR RK+KCD         P C RCK+ G  C
Sbjct: 15 RSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 14/95 (14%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK----- 63
          S   +K RR  +AC  CR +K+KCD        + PC  C      C + Q  K+     
Sbjct: 2  SEPQSKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRGGSCA 54

Query: 64 --SVFKRQHRTNGLELQDEVEKHVVITHEVDVGGP 96
            ++  R+      +LQ  + K+  +  EV  G P
Sbjct: 55 PQTITVRKPAKTAKQLQATISKYRTLFQEVFPGLP 89

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
           {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
           lactis KLLA0A04169g and some similarites with YDR213W
           uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
           involved in sterol uptake zinc finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 754

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 21/108 (19%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           ++S+  + K     +S   C NC+ R++KCD G      +P C++C      C +     
Sbjct: 35  RVSKTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPCCQKCINMKLECVY----- 83

Query: 63  KSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG 110
             + +R+ R NG    + V K+V    E       DR   + RN ++G
Sbjct: 84  TPITQRKKRLNG----ETVVKYVTSNTE------DDRGVTNRRNTVNG 121

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 6  EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          E R+ + +  +RS +AC  CRL+KIKCD         P C  CK+ G  C       +  
Sbjct: 14 EERTIELSSVKRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQCRTSDKLTRRG 67

Query: 66 FKRQH 70
          F R +
Sbjct: 68 FPRGY 72

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLE 76
          R   AC+ CR R +KC       P+  PC RC +    CE+ +  +K V    +  N   
Sbjct: 35 RKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYSEPSRKIVVSLSYLQN--- 84

Query: 77 LQDEV 81
          LQD +
Sbjct: 85 LQDSI 89

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 9/59 (15%)

Query: 7  VRSNKDTK--WRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          ++ +KDTK    R+ +ACLNCR RK+KC         + PC  C+     C +  S  +
Sbjct: 1  MKVSKDTKKPAERAARACLNCRRRKVKCS-------GQSPCANCRNYNCACTYAVSEAQ 52

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 2   DQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSR 61
           +++S V S    K RR  +AC  CR +K+KCD        + PC  C      C + Q  
Sbjct: 52  NKLSNVASVTQKKRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCSYDQPV 104

Query: 62  KKSVFKRQHRTNGL 75
           KK+     H T+G 
Sbjct: 105 KKN--NTNHNTSGF 116

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          K T+  ++Y  C  CR RK+KCD+        P C RC+R    C
Sbjct: 4  KSTRSVKTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 12 DTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          D +  ++ +AC  CR +K +CD         P C  C+R GKTC F
Sbjct: 25 DRRRSKTSRACDQCREKKTRCDF----SDERPICSACQRMGKTCTF 66

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 5   SEVRSNKDTKWRRSY--KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           S V   K    +R Y    C  C+ R++KCD        +P C +C R  + C ++ + K
Sbjct: 128 STVTDKKGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRHCIYVLNPK 181

Query: 63  KSVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGK 111
                ++ RT+  +   E  KH +    +D    SDR  +HS  K++ K
Sbjct: 182 ----NKKRRTSNAQKVKEFGKHSI---NLDNDHFSDRKRQHSSCKVEKK 223

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 39.7 bits (91), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 8/40 (20%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHE-PPCKRCKREGKTC 55
          +S  AC  CR +KIKCD       HE P CK+C R  K C
Sbjct: 28 KSISACKRCRTKKIKCD-------HEFPSCKKCARANKPC 60

>KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa]
          {ON} Anc_6.154 YBR240C
          Length = 444

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 9/63 (14%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF---LQSRKKSVFKRQHRTN 73
          R++  C  CRL+K KCD        +P C  C +    C +   L     ++FK  H+T 
Sbjct: 19 RAFTGCWACRLKKRKCD------EVKPVCSLCSKHNDPCSYDIRLMWLDNNLFKTNHKTG 72

Query: 74 GLE 76
            E
Sbjct: 73 AFE 75

>Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON}
          YBL066C (REAL)
          Length = 1159

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          R   +C +CR  KIKCD    + PH  PC RC++ G  CE 
Sbjct: 48 RPVTSCTHCRQHKIKCDAS-QNFPH--PCSRCQKIGLHCEI 85

>KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121
          Length = 688

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 97/234 (41%), Gaps = 41/234 (17%)

Query: 8   RSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRC--KREGKTCEFLQSRKKSV 65
           R+ K T+  R+ K+C  C   K+KCD G        PC RC        C +        
Sbjct: 49  RTKKITR-VRTIKSCKYCYTHKLKCDKG-------TPCSRCLSMEMANECTY-------- 92

Query: 66  FKRQHRTNGLELQDEVEKHVVITHEVDVGGPS--DRIERHSRNKIDGKWRFEISSMQNAL 123
               +RTNG        +      +V  GG    + I+  +  K    + F  SS+ + +
Sbjct: 93  --GFNRTNG------ATRSAAPLSKVAKGGEKMWNVIDESALYKSKYFYPFFTSSINDRI 144

Query: 124 EFLAKAAGSVAKEDNQL-HEIKQIDPSQVSRDDS-SWKDLTPTSFEASRAGIMAPLEADE 181
              A+A G +A  +N + +EI   D     R  S    +L P+    +RA + +  E   
Sbjct: 145 -LSAEAYGKIALSENFVRNEITNFDRLDTCRLSSEEIFNLFPSGKSVARAQVESFFE--- 200

Query: 182 GSSRKAVPLIKKLSSVRPKPCIKLSNL-EFIGGSDQLTEEEVIKLVDVFFLTMY 234
            +    +P+I K      K  +KL NL +++    Q++  +V+ L  +FF + Y
Sbjct: 201 -NIHPVIPIISK-----QKLLLKLDNLYKYLESDKQVSVLDVLLLAAIFFCSAY 248

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
           +R+  ACL CR R ++C       P   PC +C      CE+L+  KK +   ++
Sbjct: 55  KRAPLACLRCRRRHVRC-------PGGTPCAKCAVANIACEYLEPSKKLIVSMKY 102

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 12 DTKWRRSYK-ACLNCRLRKIKCDMGPLDKPHEPP--CKRCKREGKTCEFLQSRK--KSVF 66
          D++ R+  K ACL CR RKIKCD      P   P  C  C R    C F+ S +  + VF
Sbjct: 16 DSRKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASNRGGRRVF 75

Query: 67 KRQHR 71
           +  R
Sbjct: 76 DKSKR 80

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 21 ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          ACL CR + IKC       P   PC +C     TCE+L   KK
Sbjct: 27 ACLRCRQKHIKC-------PGGNPCAKCVISSATCEYLAPTKK 62

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
          RR  KAC  CR  K KCD        E PC RC +E K C +  S
Sbjct: 16 RRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCTYSNS 53

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON}
          similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 809

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 10 NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          N   K +R+  AC NC   K KC    ++  +  PC+RC +  +TC+F
Sbjct: 52 NDGGKPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKF 99

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 21  ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
           AC+ CR R +KC       P   PC +C      CE+L+  KK +   ++
Sbjct: 75  ACVRCRRRHVKC-------PGGQPCAKCASANIACEYLEPNKKLIVSMKY 117

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 922

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
          ++S+  + K    ++S   C NC+ R++KCD G      +P CK+C      C +     
Sbjct: 29 RVSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEG------KPGCKKCSNLNLVCVYSTVVD 82

Query: 63 KSVFKRQHRTNG 74
            V K+     G
Sbjct: 83 NKVAKKTTSRKG 94

>Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON}
          YBL066C (REAL)
          Length = 1155

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          R   +C +CR  KIKCD    + PH  PC RC++ G  CE 
Sbjct: 53 RPVTSCTHCRQHKIKCDAS-QNFPH--PCSRCEKIGLHCEI 90

>YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}
          SEF1Putative transcription factor, has homolog in
          Kluyveromyces lactis
          Length = 1148

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          R   +C +CR  KIKCD    + PH  PC RC++ G  CE 
Sbjct: 52 RPVTSCTHCRQHKIKCDAS-QNFPH--PCSRCEKIGLHCEI 89

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON}
          Anc_7.512 YLR451W
          Length = 869

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 9  SNKDTK-WRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFK 67
          S++ TK +RR   AC+ CR +K +CD     +    PC +CK++G TC  L+   +  +K
Sbjct: 34 SDEGTKVYRRKKFACVECRQQKSRCDAS---EKAPGPCTKCKQKGVTC-VLKKDFRRTYK 89

Query: 68 R 68
          R
Sbjct: 90 R 90

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 6  EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          E    K  K  R    CL CR RKIKCD         P C +C  +G TC +   R+ + 
Sbjct: 9  EYSVGKVQKRNRLSFVCLECRRRKIKCD------KQRPCCIQCAEQGLTCVYDIERQPAP 62

Query: 66 FKRQHRTNGLE-LQDEVE 82
           K    +  +E LQ E+E
Sbjct: 63 RKSSKVSETIELLQRELE 80

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 15/89 (16%)

Query: 1  MDQISEVR--SNKDTKWRRSY----KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKT 54
          MD ++ ++   ++DTK ++      KAC NCR RKIKC  G +      PC  C+     
Sbjct: 17 MDGMNNLKLSPSQDTKIKKPAAKVSKACDNCRKRKIKC-TGKM------PCPTCEAYQCP 69

Query: 55 CEFL--QSRKKSVFKRQHRTNGLELQDEV 81
          C +   + RKK   KR  R+ G +  D++
Sbjct: 70 CIYSAPKPRKKRTSKRHIRSGGSDYHDDI 98

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 22/92 (23%)

Query: 13  TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCE-------------FLQ 59
           ++  RS +AC  CRL+KIKCD        +P C  CK+ G  C+             + +
Sbjct: 20  SRQERSSQACDRCRLKKIKCDG------LKPNCTSCKKVGFHCQTSDKLTRRGFPRGYTE 73

Query: 60  SRKKSVFKRQHRTNGLELQDEVEKHVVITHEV 91
             +K V K Q R N   L DE    V+ T  V
Sbjct: 74  MLEKEVVKLQRRLN---LVDEQGVTVIDTAPV 102

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          + K  K +R+   C+ C+ +K++C+         P C RC+R GK C +
Sbjct: 22 AGKSQKSKRTVSVCIPCKSQKLRCNKA------RPICSRCQRLGKHCHY 64

>Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON}
          YBL066C (REAL)
          Length = 1150

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          R   +C +CR  KIKCD    + PH  PC RC++ G  CE 
Sbjct: 56 RPVTSCTHCRQHKIKCDAS-QNFPH--PCSRCEKIGLHCEI 93

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-----LQSRKKSVFK 67
          RRS KAC +CR RKI+CD      P    C  C +    C F     LQ++KK +++
Sbjct: 35 RRSTKACDHCRKRKIRCDEV---NPVTNKCSNCVKFKVECTFKFHEELQTKKKRMYE 88

>KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} similar
          to uniprot|P53749 Saccharomyces cerevisiae YNR063W
          Hypothetical ORF
          Length = 612

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 45/108 (41%), Gaps = 29/108 (26%)

Query: 4  ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREG--KTCEFLQSR 61
          ++  RS K    RR   AC+ C+L+K+KCD          PC RC + G    C +   R
Sbjct: 1  MTAARSGKRKVGRR---ACMLCKLKKLKCD-------GNYPCGRCAKSGVPSECGYEADR 50

Query: 62 KK----------------SVFKRQHRTNGLELQDEVEKHVVITHEVDV 93
          +K                S F  QH + G   ++E   H +  H+++ 
Sbjct: 51 RKCRAYGSDGTKAYVFKSSPFSSQHPSEG-SFKNEATVHHLSEHKIET 97

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON}
          similar to uniprot|P32862 Saccharomyces cerevisiae
          YKL038w RGT1
          Length = 1287

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 10 NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQ-SRKKSVFKR 68
          N D K     +AC  CR +KIKCD           C  C+R G+ C+F +   K+   K 
Sbjct: 4  NNDKKRTNVSRACDQCRRKKIKCDR----NQERNICTSCQRNGERCKFERVPLKRGPSKG 59

Query: 69 QHRTNGLELQ 78
           H+ +  EL+
Sbjct: 60 AHKASDPELK 69

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
           I+E    +  K  +++  C  CR RK+KCD+        P C RC++ G  C
Sbjct: 9  HITERSYVQKGKRAKTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+        P C+RC++ G  C
Sbjct: 9  KTFTGCWTCRSRKVKCDL------RRPGCERCEKGGLIC 41

>KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON}
          conserved hypothetical protein
          Length = 771

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          ++  K C++C+L K+KC+          PCKRC + G  C+F++  ++
Sbjct: 6  KKRTKPCISCKLSKVKCEYT-----EALPCKRCLKLGIHCQFVRDVRR 48

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 6  EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          E+R N+     R  KAC  C+ RK+KCD          PC  C + G+ C+++    +  
Sbjct: 5  EIRRNR----LRVRKACEICKRRKVKCD-------GSQPCANCVKHGQECKYISGTVRRR 53

Query: 66 FKR 68
          ++R
Sbjct: 54 YRR 56

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
           YMR280C
          Length = 1237

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 17  RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLE 76
           R+ +AC  CRL+KIKCD+        P C  C   G  C+      ++ F R + T  LE
Sbjct: 171 RASQACDRCRLKKIKCDL------KRPQCSSCASVGFECKLSDKLTRNSFPRGY-TESLE 223

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 12/75 (16%)

Query: 9   SNKDTKWRRSY--KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVF 66
           S K+ K  RS    AC+ CR R  KC       P   PC +C     TCE+++  KK V 
Sbjct: 61  SKKEKKANRSRLPVACVACRRRHSKC-------PGGNPCSKCIAANLTCEYIEPSKKVVV 113

Query: 67  KRQHRTNGLELQDEV 81
              +    L+LQ+++
Sbjct: 114 SMTYL---LQLQEDM 125

>TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]
           {ON} Anc_4.344 YML076C
          Length = 1435

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 15  WRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           ++RS  AC+ C   K KC     +  +  PCKRC +  + C+F
Sbjct: 336 FKRSTFACVRCHSLKQKCLPSDFNDIYRKPCKRCLKTNRLCKF 378

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K  ++ +AC  CR +KIKCD     K  +  C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDEKGVCSNCQRNGDRCSF 78

>Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {ON}
           YML076C (REAL)
          Length = 946

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-LQSRKK 63
           +++ + ++ K +R+  AC+ C   K KC     +  +  PC+RC +  K C+F L  R +
Sbjct: 58  TKLETTENGKIKRNSFACVCCHSLKQKCVPSDANDIYRKPCQRCLKHKKVCKFDLAKRTR 117

Query: 64  SVFKRQHRTNGLE--LQDEVEK 83
              +R   +  LE  +QD  +K
Sbjct: 118 KRKQRSRSSTSLESPIQDVSKK 139

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 13 TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
          T  +R  KAC  CR  K KCD        E PC+RC  E K C +  S
Sbjct: 2  TTKKRVSKACDTCRKSKTKCD-------GERPCQRCLSENKICTYSNS 42

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 834

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 24/121 (19%)

Query: 2   DQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSR 61
           D++S   S +  + +RS  AC+ CR R  KC         E PC  C      CE+++  
Sbjct: 35  DEMSSRTSKR--RIKRSGLACVRCRRRHAKCS-------GEKPCSTCVAANIACEYMEPN 85

Query: 62  KKSVFKRQH-----------RTNGLELQDEVEKHVVITHEVDVGGPSDRIE--RHSRNKI 108
           KK V   ++           +   ++LQ  V+   +   +    GPS+R    +  +N +
Sbjct: 86  KKLVVSMKYLQKLQSDLAEMKRENIKLQASVKN--IAPQDAAEAGPSNRPSDVKFHKNTV 143

Query: 109 D 109
           D
Sbjct: 144 D 144

>ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 807

 Score = 38.5 bits (88), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 57/131 (43%), Gaps = 25/131 (19%)

Query: 13  TKWRRSYKA--CLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF---LQSRKKSVFK 67
           TK RR+  +  C +CR  K KCD        +P C RC + G  C +    Q++ KS   
Sbjct: 28  TKGRRNKLSFVCQSCRRSKTKCD------KVKPSCTRCVKNGSVCVYDVETQTKPKS--- 78

Query: 68  RQHRTNGLELQDEVE-------KHVVITHEVDVGGPSDRIERHSRNK---IDGKWRFEIS 117
           R   +   +LQ E+E        H +     D GG    I+ H       ++G+ + EI 
Sbjct: 79  RSKDSRIQQLQREIEYWKSKARGHTLHGRTADAGGTDPVIDFHHAFPMMIVEGQCKHEIR 138

Query: 118 SMQNALEFLAK 128
              +AL ++ K
Sbjct: 139 P-SSALSYMGK 148

>TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447
           bp, 1148 aa] {ON} Anc_5.577 YML034W
          Length = 1148

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 13  TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
           TK  +  +ACL CR  KI CD        +P C  C ++ KTC
Sbjct: 299 TKLNKKPRACLTCRKSKIGCDRT------KPDCNNCTKKNKTC 335

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
           +++ + +  K +R+  AC+ C   K KC+   ++  +  PC+RC +  K C+F  S++  
Sbjct: 59  TKLETTEKGKTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSKRTR 118

Query: 65  VFKRQHRT 72
             K + R+
Sbjct: 119 KRKPRSRS 126

>TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.264
           YDR034C
          Length = 724

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 9   SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
           SN + K + S   C  C+ R+IKCD        +P C +C R  + C ++ + K    K 
Sbjct: 110 SNGNVKRKYSRNGCTECKRRRIKCD------ETKPTCWQCARLNRECIYVLNLKNKKRKN 163

Query: 69  QHRTNGLELQDEVEKHVVITHEVDVGGPSDRIE 101
           +      + Q + EK   I   ++     D+++
Sbjct: 164 KEAPASRQKQKQTEKVAAIKQRINTPTEKDQLD 196

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 36.2 bits (82), Expect = 0.088,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          +AC  CR+R++KCD        + PC RC +    C +LQ  +K
Sbjct: 39 QACDCCRVRRVKCD-------GKGPCGRCLQRDLNCTYLQPLRK 75

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
          (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K  +  R    CL CR RK+KCD         P C RCK+   TC +
Sbjct: 4  KSPRVNRPRLVCLECRNRKLKCDKA------RPKCTRCKQNLLTCSY 44

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 37/68 (54%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
           +++ + ++ K +R+  AC+ C   K KC+    +  +  PC+RC +  K C+F  S++  
Sbjct: 58  TKLETTENGKIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLCKFDLSKRTR 117

Query: 65  VFKRQHRT 72
             K + R+
Sbjct: 118 KRKPRSRS 125

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 38.1 bits (87), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 7/52 (13%)

Query: 5  SEVRSNKDTKWR-RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          S+ ++NK++  R +++  C  CR RKIKCD+       +P C++C      C
Sbjct: 8  SQAKNNKNSYKRIKTFTGCWTCRSRKIKCDLT------KPSCRKCTNSRIEC 53

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
          conserved hypothetical protein
          Length = 728

 Score = 38.1 bits (87), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          RS   C  CRL+++KCD         P C RCKR   TC
Sbjct: 38 RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTC 70

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
          (REAL)
          Length = 878

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC  CRL+K+KC         +P C +C +    C +    K+S   R H T   E++ 
Sbjct: 9  QACDICRLKKLKC------SKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLT---EVES 59

Query: 80 EVEK 83
           +EK
Sbjct: 60 RLEK 63

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
          RR Y AC+ CR +K KCD    DK    PC +C R+G  C  L+   +  +KR
Sbjct: 14 RRKY-ACVECRQQKSKCDAN--DKAPN-PCSKCARKGVPC-ILKKDFRRTYKR 61

>KLLA0F10835g Chr6 (997512..999782) [2271 bp, 756 aa] {ON}
          conserved hypothetical protein
          Length = 756

 Score = 38.1 bits (87), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          S K  K R S K CL C+   +KCD G      +P C +C +   +C +
Sbjct: 11 SGKKRKTRYSRKGCLQCKRSHLKCDEG------QPKCGKCVKRNISCTY 53

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 38.1 bits (87), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQ 69
          ++  + C++C+ +K+KC           PC+RC + G  C F  ++K+S   +Q
Sbjct: 7  KKRTRPCVSCKRQKLKCQYK-----ESLPCERCIKHGMACYFPTTQKQSATAKQ 55

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K  ++ +AC  CR +KIKCD     K     C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDERGVCTNCQRNGDRCSF 78

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K  ++ +AC  CR +KIKCD     K     C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDERGVCSNCQRNGDRCSF 78

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
           Anc_4.344 YML076C
          Length = 894

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           +++  N+  K +R+  AC+ C   K KC    ++  +  PC+RC R  + C+F  S++
Sbjct: 45  TKMEVNEVGKLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKFDLSKR 102

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 13/90 (14%)

Query: 17  RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLE 76
           R  KAC  C+ RK+KCD          PC  C +  K C +     K+  +R+ R     
Sbjct: 41  RVQKACEICKRRKVKCD-------GNRPCLNCSKHKKECRY---DFKATNRRKKRRQATS 90

Query: 77  LQDEVEKHVVITHEVDVGGPSDRIERHSRN 106
           L   V+K  +   E DV    D + + + N
Sbjct: 91  LIQNVDKEYI---ETDVALSKDLLSKSNAN 117

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 12/61 (19%)

Query: 1  MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
          M++   VR NK      + KACLNCR +K KCD         P C +C+     C +L  
Sbjct: 1  MNKKKAVRRNK------AIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVYLGE 48

Query: 61 R 61
          +
Sbjct: 49 K 49

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 9/78 (11%)

Query: 6   EVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
           E+   K  ++R S+  C  CR  K KCD        +P C RC + G TC +    K+  
Sbjct: 38  ELAQRKKKRYRLSF-VCQECRKSKTKCD------KEKPSCSRCLKIGITCIY-DVAKQEP 89

Query: 66  FKRQHRTNGLE-LQDEVE 82
            KR +++  L+ LQ E+E
Sbjct: 90  PKRPNKSATLKRLQKELE 107

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          ++K+ +  R    CL CR +K+KCD         P C RC++  K C +
Sbjct: 2  NDKNYRKARPSFVCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVY 44

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 9   SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           S+   K  ++ +AC  CR +KIKCD        +  C  C+R G+ C F
Sbjct: 62  SSSQKKRTKASRACDQCRKKKIKCDFS----EEKTLCSNCQRNGEKCTF 106

>KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {ON}
           conserved hypothetical protein
          Length = 701

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 63/161 (39%), Gaps = 20/161 (12%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFK--RQHR 71
           K  RS   C  CRLR+ KCD         P C  C +    C + +  +  + K  R+  
Sbjct: 25  KRNRSRAGCFTCRLRRKKCDEV------HPKCGTCTKHVLKCIWPRKGQGRLTKEMREKM 78

Query: 72  TNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEFLAKAAG 131
              ++L DE    V IT      GP+ R  R SR +      + I     AL        
Sbjct: 79  KREVDLYDESSLLVPITSPPVSEGPASR--RGSRTQAQHFVNYAIDHASKAL-------- 128

Query: 132 SVAKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAG 172
            +   D  +++  QI  SQ S +D   +DL  +  E+   G
Sbjct: 129 VLHSTDLPMNDASQIFNSQSSGEDE--EDLEASETESHTEG 167

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
          ++S+  + K     +S   C NC+ R++KCD G      +P CK+C      C +  +Q 
Sbjct: 26 KVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQP 79

Query: 61 RKK 63
          R++
Sbjct: 80 RRR 82

>CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451w LEU3 transcription factor
          Length = 940

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 21  ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
           AC+ CR +K KCD    DK  E PC RC+++G  C  L+   +  +KR
Sbjct: 57  ACVECRQQKSKCDAH--DKAPE-PCTRCQKKGVPC-VLKKDFRRTYKR 100

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 7   VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-----LQSR 61
           + S+K+ K R S KAC +CR RKI+CD   +D P    C  C +    C F     +  +
Sbjct: 119 IASSKNLKKRVS-KACDHCRKRKIRCD--EVD-PQTNKCSNCVKFQSACTFKHRDEILRK 174

Query: 62  KKSVFKRQHRTNGLELQDEVEKHVV 86
           K+ +  +Q+     + Q     HV+
Sbjct: 175 KRKLETKQNSDKSPQAQSNGSNHVI 199

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K  ++ +AC  CR +KIKCD     K  +  C  C+R G  C F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDEKGLCSNCQRNGDRCSF 78

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL 58
           ++S+    K     +S   C NC+ R++KCD G      +P C++C      C +L
Sbjct: 87  KVSKTSKGKRKFHNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCVYL 136

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa]
          {ON} YLR228C (REAL)
          Length = 813

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
          ++S+  + K     +S   C NC+ R++KCD G      +P CK+C      C +  +Q 
Sbjct: 24 RVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLECVYSPIQP 77

Query: 61 RKK 63
          R++
Sbjct: 78 RRR 80

>Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa]
          {ON} similar to Ashbya gossypii ACR209W + ACR208C
          Length = 856

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 14 KWRRSYKACLNCRLRKIKCD---MGPLDKPHEPPCKRCKREGKTCEFLQS----RKKSVF 66
          K + + +ACL CR RKI+CD    G + +  +  C  C   G  C F++S    R+    
Sbjct: 10 KRKVAKRACLACRKRKIRCDGETRGTVVEDGQRVCSNCANHGLKCIFVRSQRGGRRMPRK 69

Query: 67 KRQHRTN 73
          K QH T+
Sbjct: 70 KLQHATS 76

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
          ++S+  + K     +S   C NC+ R++KCD G      +P CK+C      C +  +Q 
Sbjct: 25 KVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQP 78

Query: 61 RKK 63
          R++
Sbjct: 79 RRR 81

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
          (PUT3) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
          FULL
          Length = 822

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
          +RS  AC+ CR R  KC         + PC  C+     CE+L+  KK V   ++
Sbjct: 43 KRSGLACVRCRRRHAKCS-------GDNPCTTCRAANIACEYLEPNKKLVVSMKY 90

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 13/116 (11%)

Query: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
           +D+ + +  +AC  CRL+KIKCD         P C  C + G  C   +  K+  F + +
Sbjct: 34  QDSIFIKRKQACDRCRLKKIKCD------DRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

Query: 71  RTNGLELQ----DEVEKHVVITHEVDVGGPSD--RIERHSRNKIDGKWRFEISSMQ 120
            T  LE +    +++ K   I  ++    P D  +I + + +  + K  FE +S Q
Sbjct: 88  -TEQLEQEVARLEKLLKDNGINDDIVTIAPRDENKIPKVNHDNFNEKSNFEETSNQ 142

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+        P C RC + G  C
Sbjct: 16 KTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
          regulatory element binding protein, induces
          transcription of sterol biosynthetic genes and of
          DAN/TIR gene products; Ecm22p homolog; relocates from
          intracellular membranes to perinuclear foci on sterol
          depletion
          Length = 913

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          ++S   + K     +S   C NC+ R++KCD G      +P C++C      C++
Sbjct: 32 KVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACRKCTNMKLECQY 80

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 9  SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          SN   K  RS +AC NCR RKIKC           PC  C+  G  C F
Sbjct: 5  SNGKIKKLRSSRACSNCRRRKIKCS-------GIQPCPNCEIYGCLCVF 46

>KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON}
           conserved hypothetical protein
          Length = 597

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 9/113 (7%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
           +RS   CL CR RK KCD        +P C  CKR    C +  S      K   + + +
Sbjct: 5   KRSSTGCLICRRRKKKCD------EVKPTCTACKRNFLECIWPNSSNTKDGKVGKKISQV 58

Query: 76  ELQDEVEK--HVVITHEVDVGGPSD-RIERHSRNKIDGKWRFEISSMQNALEF 125
           E +D      H+ + H +     SD R+E + + + D  + ++   +Q   +F
Sbjct: 59  ESEDTKFNITHLKLKHRIKYTRTSDLRMEVYVKRRSDELYLYDGKKLQKITKF 111

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
           (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 52/117 (44%), Gaps = 27/117 (23%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
           +R  KAC +CR RKIKC  GP++ P    C+ C +   +C F          R H     
Sbjct: 23  KRVPKACDHCRKRKIKC--GPVN-PITGTCENCNKFNTSCTF----------RHH----- 64

Query: 76  ELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEFL-AKAAG 131
              DE+ +H   T   D+   SD   +    K   +   E SSM+  LE L ++ AG
Sbjct: 65  ---DEISRHRKFT---DLKRASDNEPK--VKKAAAELSPETSSMEQKLEKLESQLAG 113

>Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]
          {ON} YDL170W (UGA3) - zinc-finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 161] FULL
          Length = 643

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 12 DTKWRRSYK--ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQ 69
          +T  +R+++   C+ C++RK +C        H+P C  C+R G TC +L  +       Q
Sbjct: 15 NTVGKRTHRKTGCIPCKIRKKRC------SEHKPTCTDCERLGFTCVYLPEKSTREEANQ 68

Query: 70 HR 71
          +R
Sbjct: 69 YR 70

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa]
          {ON} YLR228C (REAL)
          Length = 812

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
          ++S+  + K     +S   C NC+ R++KCD G      +P CK+C      C +  +Q 
Sbjct: 25 RVSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVYSPIQP 78

Query: 61 RKK 63
          R++
Sbjct: 79 RRR 81

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
          weakly similar to uniprot|P25611 Saccharomyces
          cerevisiae YCR106W RDS1 Regulator of drug sensitivity
          transcriptional regulator
          Length = 934

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 6/55 (10%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          K  K  R    C  CR RKIKCD         P C RC   G  C +L S  +S 
Sbjct: 8  KIQKRNRPSFVCQECRRRKIKCD------KKRPRCSRCVDTGLPCTYLASGSRSA 56

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON}
          Anc_4.344 YML076C
          Length = 903

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
          K +R+  AC+ C   K KC     +  +  PC RC R+ K C+F  S++
Sbjct: 51 KNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFDLSKR 99

>KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON}
           uniprot|P87164 Kluyveromyces lactis SEF1 Suppressor
           protein SEF1
          Length = 1119

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 17  RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-LQSRKKSVFKRQHRTNGL 75
           R   +C +CR  KIKC+     +    PC RC+R G  CE   Q R K   + Q   N +
Sbjct: 113 RPVTSCTHCRQHKIKCNAS---EKFPAPCSRCERMGLHCEIDPQFRPKKGSQLQSLRNDV 169

Query: 76  -ELQDEVE 82
            EL+ ++E
Sbjct: 170 DELKVKIE 177

>Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON}
          (64772..66079) [1308 nt, 436 aa]
          Length = 435

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 6/46 (13%)

Query: 12 DTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          D ++ R++  C  CR +K KCD        +P C  C R G  C +
Sbjct: 5  DNRYSRNFTGCWACRFKKRKCD------ELKPSCSLCVRHGDCCSY 44

>Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar to
          Ashbya gossypii ABR174W
          Length = 884

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 7  VRSNKDT-KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          VRS+ D  K +R   AC+ CR +K KCD    D+  E PC RC ++   C  LQ   +  
Sbjct: 23 VRSSSDERKQKRKKFACVECRQQKSKCDAH--DRAPE-PCTRCFKKNVPC-VLQRDFRRT 78

Query: 66 FKR 68
          +KR
Sbjct: 79 YKR 81

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 10/85 (11%)

Query: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQH 70
           K  K + S   C  C+ R++KCD G      +P C +C R  + C ++   K     R+ 
Sbjct: 138 KTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYIIRTK----NRKR 187

Query: 71  RTNGLELQDEVEKHVVITHEVDVGG 95
           R    E   E  +   +  E +  G
Sbjct: 188 RPKSTEASKESAQADALVRESNAPG 212

>Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar to
          Ashbya gossypii AFR171W
          Length = 637

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 9/80 (11%)

Query: 1  MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
          M     +R +   + + S   C  C+ RK+KCD        +P C +C   GK C +L +
Sbjct: 11 MSADGAIRKSLVKRSKYSKNGCSECKRRKVKCDEA------KPACWQCSHLGKRCVYLMN 64

Query: 61 RKKSVFKRQHRTNGLELQDE 80
            K  FK     N L  +D+
Sbjct: 65 TAKIRFK---EINVLSFKDK 81

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRT 72
          K RR  +AC  CR +K+KCD        + PC  C      C + Q  K+S+   QH T
Sbjct: 31 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRSL---QHLT 79

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
          YJL206C (REAL)
          Length = 772

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQ-SRKKSVFKRQ 69
          R+++AC+ CR RK++C         + PC+ C+     C++ +  R  SVF R+
Sbjct: 53 RAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKYDRPPRNSSVFDRE 99

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa]
          {ON} Anc_1.128 YJL206C
          Length = 658

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 10/66 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS---RKKSVFKRQHRTN 73
          R +KAC+ CR +K +CD        + PC  C R    CE+  +   R  S+      +N
Sbjct: 27 RVFKACIACRKKKRRCD-------GKSPCSHCARTSIICEYTNTARPRSHSIAFANDVSN 79

Query: 74 GLELQD 79
           + L D
Sbjct: 80 DIHLID 85

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF----LQSRKKSVFKRQHR 71
           +++ +AC  CR RKIKCD    DK     C  C R G  C+F    L+      F R + 
Sbjct: 69  KKATRACDQCRKRKIKCDYDN-DKNV---CSSCNRNGDRCQFNRVQLKRGPSKGFNRNNS 124

Query: 72  T 72
           T
Sbjct: 125 T 125

>CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly
          similar to uniprot|Q06639 Saccharomyces cerevisiae
          YDR303c RSC3 or uniprot|P38781 Saccharomyces cerevisiae
          YHR056c
          Length = 834

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 13 TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKT 54
          TK  +   AC  CR RKI CD G      +P C  C ++GKT
Sbjct: 7  TKKVKKPPACQQCRRRKIGCDRG------KPICGNCLKQGKT 42

>Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}
          YBR297W (REAL)
          Length = 463

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          +AC  CR+R++KCD        + PC RC +    C +LQ  KK
Sbjct: 6  QACDCCRVRRVKCD-------GDKPCNRCLQHDLKCTYLQPLKK 42

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
          {ON} weakly similar to uniprot|P46954 Saccharomyces
          cerevisiae YJL089W SIP4 Possibly involved in Snf1p
          regulated transcriptional activation shows homology to
          DNA binding domain of Gal4p has a leucine zipper motif
          and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 7/45 (15%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          K+ K R+S +AC  CRL+KIKCD        +P C +C +   TC
Sbjct: 28 KNKKMRQS-QACDRCRLKKIKCD------GMKPTCSQCTKVNFTC 65

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa]
          {ON} 
          Length = 980

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 13 TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
           K  RS +AC NCR RKIKC           PC  C+     C F   ++K++
Sbjct: 9  VKKTRSSRACENCRARKIKC-------SGNQPCSNCEIYNCPCAFTPIKRKNL 54

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD   L +PH   C+RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCD---LRRPH---CQRCEKSNLPC 48

>CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} similar
           to uniprot|P34228 Saccharomyces cerevisiae YBL066c SEF1
          Length = 1098

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 17  RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           R   +C +CR  KIKCD     +    PC RC + G  CE 
Sbjct: 82  RPVTSCTHCRQHKIKCDAS---QNFPAPCTRCAKNGFHCEI 119

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQ 69
           +R  KAC +CR RKIKCD   +D P    C  C +    C F + R   +  R+
Sbjct: 100 KRVSKACDHCRKRKIKCD--KVD-PSTGKCSNCLKYNANCTFKRGRDNVLNNRR 150

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K  + +R    C  CR +K++C+         P C RC+R G+TC +
Sbjct: 4  KSIRGQRPTHVCAACRTQKLRCNR------ERPSCSRCQRIGRTCVY 44

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          +R+  AC NC  +K KC    +   +  PC RC++  K C F
Sbjct: 54 KRNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 12 DTKWRRSYKACLNCRLRKIKCD---MGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
          D K + + +ACL CR +KIKCD      L       C  C   G  C F+ S +
Sbjct: 9  DPKRKVARRACLTCREKKIKCDGEVRASLGGSDPGICSNCAASGSKCVFVASMR 62

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 9/72 (12%)

Query: 10 NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQ 69
          N D   R+   AC +CR R+ KCDM       E PC  C +    C F Q   ++  KR 
Sbjct: 32 NNDNVPRKRKLACQSCRRRRRKCDM-------EKPCSNCIKFQTDCVFAQQDLRN--KRY 82

Query: 70 HRTNGLELQDEV 81
            T    LQ ++
Sbjct: 83 STTYVEALQSQI 94

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          ++S   + K     +S   C NC+ R++KCD G      +P CK+C      C +
Sbjct: 32 KVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECVY 80

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
           +++ + +  K +R+  AC+ C   K KC+    +  +  PC+RC +  K C+F  S++  
Sbjct: 58  TKLETTEKGKIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKFDLSKRTR 117

Query: 65  VFKRQHRT 72
             K + R+
Sbjct: 118 KRKPRSRS 125

>ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {ON}
           similar to uniprot|P08638 Saccharomyces cerevisiae
           YLR451W LEU3 Zinc-finger transcription factor that
           regulates genes involved in branched chain amino acid
           biosynthesis and ammonia assimilation positively
           regulated by alpha-isopropylmalate an intermediate in
           leucine biosynthesis
          Length = 860

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 66/310 (21%), Positives = 123/310 (39%), Gaps = 54/310 (17%)

Query: 21  ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQDE 80
           AC+ CR +K KCD    D+  E PC +C+++G  C         V K+  R         
Sbjct: 45  ACVECRQQKSKCDAH--DRAPE-PCTKCQKKGVPC---------VLKKDFR--------- 83

Query: 81  VEKHVVITHEVDVGGPSDRIERHSRNK-IDGKWRFEISSMQN--ALEFLAKAAGSVAKED 137
                             R  + +RN+ I+ +++    ++ N  + E L K    + +E 
Sbjct: 84  ------------------RTYKRARNEAIEKRFKELTRTLTNLSSEEILKK----IEQEQ 121

Query: 138 NQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSSRKAVPLIKKLSSV 197
             L + +     +V R   S   +TPTS  A  +    PL +D     + +  +K+++  
Sbjct: 122 QALLDGQNFTKDKVKRLKQSGITVTPTSTAADGSQRANPLGSDWIYEFEHMQNVKEMTPE 181

Query: 198 RPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLL 257
           + K   K        G   ++ E++ +L   F    +PF P I +  +  E + R    L
Sbjct: 182 QLKCTPK------TLGDIYMSSEDIAELFQEFAKRYHPFLPVIDIT-KGAERIYRLSPCL 234

Query: 258 CSIVTVSARYHSFCDIGLKDNMQNN-RNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVL 316
             ++ ++     F    L   + +  ++I     +    +   S +     +  S+ +V 
Sbjct: 235 FWVMILTGLRRKFGATELMTKLSSMVKSILAEITISPIIRYTPSDSDEPVLNVASVYSVQ 294

Query: 317 AFLLFTEWNP 326
           AFLL+T W P
Sbjct: 295 AFLLYTFWPP 304

>SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} similar
           to uniprot|P34228 Saccharomyces cerevisiae YBL066C SEF1
           Suppressor of Essential Function putative transcription
           factor
          Length = 1043

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%)

Query: 10  NKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           N  +   R   +C +CR  KIKC+     +    PC RC R G  CE 
Sbjct: 70  NGGSTGHRPVTSCTHCRQHKIKCNAS---ENFPAPCSRCDRMGLHCEI 114

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+        P C RC+R    C
Sbjct: 7  KTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
           YGR288W (REAL)
          Length = 473

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 13/96 (13%)

Query: 20  KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL-ELQ 78
           +AC  CR+R++KCD        + PC  C +   +C +LQ  K    KR  ++  L  L+
Sbjct: 11  QACDCCRVRRVKCD-------SKRPCSSCLQNNLSCTYLQPSK----KRGPKSIRLRSLK 59

Query: 79  DEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRF 114
              E  +V    V   GP+ R E+  R  I+   R 
Sbjct: 60  KIAEVQMVSMTNVITTGPAMR-EKVPRKLIEQCLRL 94

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa]
          {ON} Anc_6.279 YPL248C
          Length = 834

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 13/66 (19%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC  CR++K++C         +P C +C +   TC +    K+S   R H T       
Sbjct: 3  QACDICRVKKLRC------SKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAHLT------- 49

Query: 80 EVEKHV 85
          EVEK +
Sbjct: 50 EVEKKL 55

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 10/63 (15%)

Query: 2  DQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSR 61
          DQ  ++  NK    RR  +AC  CR +K+KCD        + PC  C      C + Q  
Sbjct: 3  DQQQQILQNK---RRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPT 52

Query: 62 KKS 64
          K+S
Sbjct: 53 KRS 55

>KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 727

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 7/35 (20%)

Query: 21 ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          AC NCR R+ KCD+       E PC RC+  G  C
Sbjct: 40 ACANCRRRRKKCDL-------EYPCGRCQELGLGC 67

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 13/95 (13%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL---- 58
           ++S   + K     +S   C NC+ R++KCD G      +P CK+C      C +     
Sbjct: 32  KVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLYTPIHL 85

Query: 59  -QSRKKSVFKRQHRT--NGLELQDEVEKHVVITHE 90
            + R  +V K   R     +E +  V+   V+  E
Sbjct: 86  RKGRGATVVKYVTRKADGSVEPESSVDLPTVVKKE 120

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL 58
           K  K + S   CL C+ R++KCD G      +P C +C R  + C ++
Sbjct: 144 KIVKRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVYI 185

>TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {ON}
           Anc_4.344 YML076C
          Length = 806

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHE---PPCKRCKREGKTCEF 57
           +++ +N   + +R+  AC++C   K KC   P D PH+    PC+RC R  K C+F
Sbjct: 59  TQLETNDGGQIKRNSFACVSCHSLKQKC--VPSD-PHDIYRKPCERCLRNFKLCKF 111

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 12/93 (12%)

Query: 3   QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRK 62
           ++S+  + K     +S   C NC+ R++KCD G      +P C++C +   +C +  ++ 
Sbjct: 70  KVSKTATGKRKFHNKSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPAKP 123

Query: 63  KSVFKR------QHRTNGLELQDEVEKHVVITH 89
           +    R      ++ T G + +D+ +   VI +
Sbjct: 124 RKKKDRDVETVIKYVTRGNDEKDDGDVDTVIKY 156

>Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON}
          YDR034C (LYS14) - transcription factor involved in
          lysine biosynthesis [contig 358] FULL
          Length = 598

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 6/41 (14%)

Query: 13 TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGK 53
          TK +RS   C+NC+  KIKCD        +P C +C ++G+
Sbjct: 5  TKNQRSRGGCINCKKSKIKCD------EKKPMCGQCAKKGR 39

>Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [contig
          219] FULL
          Length = 669

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 16 RRSYKACLNCRLRKIKCD-MGPLDKPHEPPCKRCKREGKTCEFLQSR 61
          R+  K C NC+  K+KC+ +  L      PC+RC R    C +L  R
Sbjct: 7  RKRTKPCSNCKKNKVKCEYLSSL------PCQRCARHSLKCYYLDGR 47

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
          GAL4DNA-binding transcription factor required for the
          activation of the GAL genes in response to galactose;
          repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC  CRL+K+KC         +P C +C +    C +    K+S   R H T   E++ 
Sbjct: 9  QACDICRLKKLKCSK------EKPKCAKCLKNNWECRYSPKTKRSPLTRAHLT---EVES 59

Query: 80 EVEK 83
           +E+
Sbjct: 60 RLER 63

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           K +R+  AC NC  +K KC    +   +  PC RC +  K C+F
Sbjct: 104 KPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKF 147

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSV 65
          R  + C+ C+ RK++CD         P C RCKR    C +    + SV
Sbjct: 10 RPSRVCVQCKKRKLRCDR------QRPTCTRCKRSSTICTYDHDSELSV 52

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 13/78 (16%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCE-------FLQSRKKSVF 66
          K RR    C  CR +K+KCD        +P C +CK  G  C+       +L+  K   F
Sbjct: 6  KKRRLNNGCWTCRTKKVKCD------SKKPFCDKCKDSGLHCDGYEVRLTWLEGTKFDKF 59

Query: 67 KRQHRTNGLELQDEVEKH 84
            Q  +   +  DE  +H
Sbjct: 60 GEQITSKSSDKNDEDIRH 77

>Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480
          aa] {ON} ANNOTATED BY YGOB - possible frameshift into
          ORF downstream
          Length = 480

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          ++  ++C+ CR  K KCD     +PH  PC  C R+G +CE 
Sbjct: 15 KKPLRSCIRCRKNKTKCD-SLHTRPH--PCTSCARKGVSCEL 53

>KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa]
           {ON} similar to uniprot|P34228 Saccharomyces cerevisiae
           YBL066C SEF1 Suppressor of Essential Function putative
           transcription factor
          Length = 1054

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           S+ ++   +   R   +C +CR  KIKC+          PC RC+R G  CE 
Sbjct: 83  SDSKAAAGSTGHRPVTSCTHCRQHKIKCNA---SDNFPAPCSRCERMGLRCEI 132

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 44/117 (37%), Gaps = 39/117 (33%)

Query: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK---------- 63
           K RR  +AC  CR +K+KCD        + PC  C      C + Q  K+          
Sbjct: 10  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSMS 62

Query: 64  ----------------------SVFKRQHRTNGLELQDEVEKHVVITHEVDVGGPSD 98
                                 S   R++ T   +LQ +++++  + +E+  G PSD
Sbjct: 63  ATNISSQNMLSTLNIQSGSAASSAGTRKYNTKSSKLQHQIDRYRQLFNEMLPGMPSD 119

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
          YPL248C (REAL)
          Length = 895

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 9/64 (14%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
          +AC  CRL+K+KC         +P C +C +    C +    K+S   R H T   E++ 
Sbjct: 9  QACDICRLKKLKCSK------EKPKCSKCLKNNWECCYSPKTKRSPLTRVHLT---EVES 59

Query: 80 EVEK 83
           +EK
Sbjct: 60 RLEK 63

>NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON}
          Anc_6.154
          Length = 475

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          R++  C  CRL+K +CD        +P C  C R G TC +
Sbjct: 19 RTFTGCWACRLKKRRCD------ELKPTCSLCVRHGDTCSY 53

>TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa]
          {ON} 
          Length = 777

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K++   R  + C +CR++K+KCD         P CKRC +  + C +
Sbjct: 4  KNSNKSRISRVCNSCRIQKLKCDR------ERPSCKRCLKNKRPCYY 44

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
          (REAL)
          Length = 913

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRC 48
          ++S   + K     +S   C NC+ R++KCD G      +P CK+C
Sbjct: 32 KVSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKC 71

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
          {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
          cluster protein) [contig 358] FULL
          Length = 552

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 7/41 (17%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          R  KACL CR RK KCD G        PC  C   G  C++
Sbjct: 15 RVRKACLPCRQRKRKCDSG-------FPCGMCTSYGYNCQY 48

>ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} similar
           to uniprot|P34228 Saccharomyces cerevisiae YBL066C SEF1
           Suppressor of Essential Function putative transcription
           factor
          Length = 1239

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 3/51 (5%)

Query: 7   VRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
              N+ +   R   +C +CR  KIKC+          PC RC+R G  C+ 
Sbjct: 82  TNGNQSSTGHRPVTSCTHCRQHKIKCNA---SDNFPAPCLRCERMGLNCQI 129

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 7/44 (15%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          + RRS+  C+ C+ +K++CD         P C RC+R G+ C +
Sbjct: 24 RQRRSH-VCITCKNQKLRCDR------ERPSCSRCRRIGRDCVY 60

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+        P C+RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 5   SEVRSNKDT---KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           S ++SN  T   + RR  +AC  CR RKIKCD   +       C  C + G  C F
Sbjct: 103 SAIKSNVSTTKVQKRRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTF 156

>Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON}
           (244116..247298) [3183 nt, 1061 aa]
          Length = 1060

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           + ++ +      R   +C +CR  KIKC+          PC RC R G  CE 
Sbjct: 64  TRIKDHTQNTGHRPVTSCTHCRQHKIKCNAS---DNFPDPCSRCDRMGLNCEI 113

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 9/88 (10%)

Query: 20  KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGLELQD 79
           +AC  CR++K+KC         +P C +C +    C +    ++S   R H T   +++D
Sbjct: 11  QACDLCRVKKLKCSK------EKPKCAKCLKNNWECCYSPKTRRSPLTRAHLT---KVED 61

Query: 80  EVEKHVVITHEVDVGGPSDRIERHSRNK 107
            + K   + +E+      D   ++S NK
Sbjct: 62  RLTKLEFLFNELFTKREMDGDAKYSVNK 89

>TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1169

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 9   SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           S + T   R   +C +CR  KI+C+     +    PC RC+R G  CE 
Sbjct: 82  SQQMTTGHRPVTSCTHCRQHKIRCNAS---ENFPAPCSRCERMGLHCEI 127

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 7/81 (8%)

Query: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-LQSRKKSVFKRQ 69
           K +K + S   C  C+ R++KCD G      +P C +C R  + C + L  + K    R 
Sbjct: 153 KISKRKYSRNGCTECKKRRMKCDEG------KPSCWQCTRLNRECVYILNPKNKKRKPRV 206

Query: 70  HRTNGLELQDEVEKHVVITHE 90
            R  G   +    K     H+
Sbjct: 207 GRNAGNSTKHSAAKQKTAKHK 227

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa]
          {ON} YDR213W (UPC2) - zinc finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 249] FULL
          Length = 788

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
          ++S+  + K    ++S   C NC+ R++KCD    DKP    C++C      C +  + S
Sbjct: 31 KVSKTSTGKRKFHKKSKNGCDNCKRRRVKCDE---DKPS---CQKCLNMKLECVYTPVTS 84

Query: 61 RKKSVFKRQHRT 72
          RK+      H T
Sbjct: 85 RKRKSSSGAHPT 96

>Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON}
          YLR451W (LEU3) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          124] FULL
          Length = 882

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
          + RR   AC+ CR +K KCD    +K  E PC RC ++   C  LQ   +  +KR
Sbjct: 23 RGRRKKLACVECRQQKSKCDAH--EKAPE-PCTRCAKKNVAC-VLQKDFRRTYKR 73

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 85/222 (38%), Gaps = 45/222 (20%)

Query: 9   SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
           S+   K RR  +AC  CR +K+KCD        + PC  C      C + Q  K+     
Sbjct: 2   SDLQNKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR----- 49

Query: 69  QHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDGKWRFEISSMQNALEFLAK 128
                 +           +T    V  PS R++ H              ++++A   L+K
Sbjct: 50  ------VATASASTAAAALTPPYGVSQPS-RVKPH-------------KALRDAKLQLSK 89

Query: 129 AAGSVAKEDNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAG----IMAPLEADEGSS 184
                 +   Q+  I+Q+D   V+   ++++    ++ E   A     +  P+ +  G+ 
Sbjct: 90  YKMLFGRLFPQMPPIEQVD---VASFANAFQGFVASNEEFQNATKNSHVTVPVSSASGAG 146

Query: 185 RKAVPLIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLV 226
             A       +S  P+  + +  +E I GS Q  E   IK++
Sbjct: 147 SPAT------ASATPEGSVGVDAIEGIDGSIQSHEGREIKII 182

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
          Putative protein of unknown function; similar to
          transcriptional regulators from the Zn[2]-Cys[6]
          binuclear cluster protein family; mRNA is weakly cell
          cycle regulated, peaking in S phase; induced rapidly
          upon MMS treatment
          Length = 758

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQ-SRKKSVFKRQ 69
          R+++AC+ CR RK++C  G +      PC+ C+     C++ +  R  SVF R+
Sbjct: 42 RAHRACIACRKRKVRCS-GNI------PCRLCQTNSYECKYDRPPRNSSVFDRE 88

>Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON}
          YKL222C - Hypothetical ORF [contig 17] FULL
          Length = 735

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKT-CEFLQ 59
          K R+S K CL CR RK+KCD       + P C  C   G T C +++
Sbjct: 28 KRRKSIKQCLFCRKRKLKCD------KNRPVCGTCASRGLTECVYVE 68

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
          Anc_8.423 YLR228C
          Length = 810

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF--LQS 60
          ++S   + K     +S   C NC+ R++KCD G      +P C++C      C +  +Q 
Sbjct: 31 RVSRTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACQKCLNMKLDCVYTPVQP 84

Query: 61 RKK 63
          +KK
Sbjct: 85 KKK 87

>TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {ON} 
          Length = 767

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 37/96 (38%), Gaps = 37/96 (38%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF---------------LQS 60
           R S   C+NC+   IKCD        +P C  C ++ K C +                Q 
Sbjct: 13  RYSKHGCINCKTSHIKCD------EEKPQCSNCAKKSKACTYENNFIIGPIQPKSKKRQC 66

Query: 61  RKKSV----------------FKRQHRTNGLELQDE 80
            KK++                F++QH  N +EL+D+
Sbjct: 67  LKKNLSNIDIDKNVKDSSSKKFRKQHYKNTIELEDK 102

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 2   DQISEVRSNKDTKWRRSYK---ACLNCRLRKIKCDM--GPLDKPHEPPCKRCKREGKTCE 56
           D +S   S   T+ RR  K   AC  CR +KIKCD   G    P +  C  C++ G+ C 
Sbjct: 94  DSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQ-SCTGCRKIGEKCS 152

Query: 57  F 57
           F
Sbjct: 153 F 153

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          ++ +AC  CR +K +CD         P C  C+R  KTC F
Sbjct: 34 KTSRACDQCRGKKTRCDFSD----ENPVCTSCQRMSKTCTF 70

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +++  C  CR RK+KCD+        P C+RC++    C
Sbjct: 16 KTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 11 KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          K+ K +R+ +AC  CR  K +C + P+  P+E  C RC+     C F
Sbjct: 22 KEFKGKRAVRACDTCRRLKTRCILSPI--PNEFYCLRCESLKIHCSF 66

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 6/41 (14%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCE 56
           RR  +AC  CRL+KIKCD G +     P C  C++    C+
Sbjct: 95  RRHSQACDRCRLKKIKCD-GLI-----PHCTNCRKINFNCQ 129

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 6/52 (11%)

Query: 4  ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          IS     K     +++  C  CR RK+KCD+        P C+RC++    C
Sbjct: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; No
          homolog in Saccharomyces cerevisiae
          Length = 612

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 6/67 (8%)

Query: 1  MDQISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQS 60
          MD     R     + + S   C  C+ RK+KCD        +P C +C   GK C ++ +
Sbjct: 1  MDVPEAGRKGVARRSKYSKNGCSECKRRKVKCD------ETKPACWQCSHLGKRCVYMVN 54

Query: 61 RKKSVFK 67
            K  FK
Sbjct: 55 NSKIRFK 61

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73
           +R  +AC +CR RKIKCD  P++ P    C  C +    C F   R +   +++ R N
Sbjct: 112 KRVARACDHCRRRKIKCD--PVN-PQTNKCSNCTKYDANCTF---RVRDDVEKRKRAN 163

>KNAG0K02060 Chr11 (416607..419351) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 12/88 (13%)

Query: 16  RRSYKACLNCRLRKIKC---DMGPLDKPHEPPCKRCKREGKTCEF---LQSRKKSVFKRQ 69
           +RS +AC  CR +KI+C   + GP D+     C  C + G  C F   ++  +K +  R 
Sbjct: 107 KRSNRACDACRKKKIRCVASETGP-DR-----CVHCLKHGLFCTFEFHIELERKKLLHRH 160

Query: 70  HRTNGLELQDEVEKHVVITHEVDVGGPS 97
            R       D  + H     ++  GGPS
Sbjct: 161 KRRKFRNRADVTQLHPERNIDLHEGGPS 188

>YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative
          maltose-responsive transcription factor
          Length = 470

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          ++C  CR+R++KCD          PC RC++    C +LQ  +K
Sbjct: 6  QSCDCCRVRRVKCD-------RNRPCDRCRQRNLRCTYLQPLRK 42

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 20 KACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK 63
          +AC  CR+R++KCD        + PC RC +    C +LQ  +K
Sbjct: 11 QACDCCRVRRVKCD-------GKKPCNRCLQHDLKCTYLQPLRK 47

>NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}
          Anc_7.512
          Length = 906

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 5/59 (8%)

Query: 11 KDTKWRRSYK-ACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKR 68
          +DT  +R  K AC+ CR +K KCD    +K  + PC +C+++G  C  L+   +  +KR
Sbjct: 34 QDTNHKRKRKFACVECRQQKSKCDA--YEKAPD-PCTKCQKKGVPC-VLKKDFRRTYKR 88

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa]
          {ON} YLR014C (REAL)
          Length = 903

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +S  AC  CRL+KIKCD         P CKRC +    C
Sbjct: 28 KSRTACKRCRLKKIKCDQ------EFPSCKRCAKLQVPC 60

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 7/43 (16%)

Query: 13 TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +K+R S +AC  CRL+KIKCD        +P C  CK+    C
Sbjct: 8  SKFRVS-QACDRCRLKKIKCD------GQKPRCSNCKKINFNC 43

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 9/67 (13%)

Query: 9   SNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-----LQSRKK 63
           S K++K R S KAC +CR RKI+CD   +D P    C  C +    C F     +  +K+
Sbjct: 124 SGKNSKKRVS-KACDHCRKRKIRCD--EVD-PQTDKCSNCVKFQSVCTFKHRDEILQKKR 179

Query: 64  SVFKRQH 70
            +  +QH
Sbjct: 180 KLEIKQH 186

>KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]
          {ON} weakly similar to uniprot|P26370 Saccharomyces
          cerevisiae YDL170W
          Length = 681

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 16 RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTNGL 75
          R S K CL C++RK +C          P CK C R    C F      ++ K Q R   +
Sbjct: 14 RHSKKGCLTCKVRKKRC------SEDRPICKDCARLSLDCVF----PDNLTKDQIRAYKV 63

Query: 76 ELQDEVEK 83
           LQ E++K
Sbjct: 64 WLQTELKK 71

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 3  QISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFL--QS 60
          ++S+  + K     +S   C NC+ R++KCD G      +P C++C      C F   Q 
Sbjct: 15 RVSKNSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPPQP 68

Query: 61 RKK 63
          R+K
Sbjct: 69 RRK 71

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 13/72 (18%)

Query: 1  MDQISEVRSNKDT------KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKT 54
          MD  S VR   D       + R++  AC NCR RKIKC         + PC  C+     
Sbjct: 1  MDGSSSVRKWADGVQKPAHRRRKTVLACTNCRRRKIKCT-------GKWPCSNCEAYSCV 53

Query: 55 CEFLQSRKKSVF 66
          CE++    +  F
Sbjct: 54 CEYVDKAAQVKF 65

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 23/104 (22%)

Query: 13  TKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCE-------------FLQ 59
           +K  R  +AC  CRL+KIKCD        +P C  C + G  C+             + +
Sbjct: 20  SKHARMSQACDRCRLKKIKCDGI------KPTCTPCTKIGFHCQTSDKLSRRGFPRGYTE 73

Query: 60  SRKKSVFKRQHRT--NGLELQDEVEKHVVITHEVDVGGPSDRIE 101
             +K V + Q R    G +  D  E  V ++ +  +G  +D  E
Sbjct: 74  MLEKEVVRLQQRLVRAGYDPGDSTE--VSVSQQAAIGATADNSE 115

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 46/108 (42%), Gaps = 11/108 (10%)

Query: 5   SEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
           S   S   T   R  +AC  CRL+K KCD G +     P C +C   G  C+      + 
Sbjct: 43  SNTGSRGSTPTYRVAQACDRCRLKKTKCD-GKI-----PQCSQCALVGFECKISDRLNRK 96

Query: 65  VFKRQHRTNGLELQDEVE---KHVVITHEVDVGGP--SDRIERHSRNK 107
            F R +     E   E+E   K ++     D+G    SD +E+ S +K
Sbjct: 97  SFPRGYTETLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPSK 144

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
          RDR1Transcriptional repressor involved in the control
          of multidrug resistance; negatively regulates
          expression of the PDR5 gene; member of the Gal4p family
          of zinc cluster proteins
          Length = 546

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKS 64
          K +R  KAC+ CR RK KC+        + PC+ C   G  C ++  R  S
Sbjct: 12 KRQRVRKACVPCRERKRKCN-------GKSPCEMCVAYGYVCHYIDGRVPS 55

>Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa]
           {ON} YBL066C (SEF1) - putative transcription factor
           [contig 33] FULL
          Length = 1046

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 17  RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
           R   +C +CR  KIKC+    +     PC RC+R G  CE 
Sbjct: 95  RPVTSCTHCRQHKIKCNA---NDNFPAPCSRCERMGLHCEI 132

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 25/91 (27%)

Query: 16  RRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF-----LQSRK-------- 62
           +R   AC +CR RKIKC  GP++   E  C  C +    C F     +Q+RK        
Sbjct: 142 KRVSMACDHCRKRKIKC--GPINTV-ENKCSHCIKYNAECTFQHRDAMQARKRNNLDPQN 198

Query: 63  ---------KSVFKRQHRTNGLELQDEVEKH 84
                    K+ F+ +   N +EL+D ++++
Sbjct: 199 DDYGESAATKTPFQYEVSPNAVELEDGLQQN 229

>Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON}
          (125242..127926) [2685 nt, 895 aa]
          Length = 894

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 4  ISEVRSNKDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          +S+  + K     +S   C NC+ R++KCD        +P CK+C      C +
Sbjct: 33 VSKTSTGKRKFHNKSKNGCENCKRRRVKCDEA------KPACKKCSNMKLDCNY 80

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 8/50 (16%)

Query: 9  SNKDTKWR-RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEF 57
          SN+++K R R  KAC  C+ RK+KCD          PC  C +  K C +
Sbjct: 18 SNENSKTRLRVQKACELCKKRKVKCDGN-------KPCLNCSKHQKECRY 60

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 14 KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKKSVFKRQHRTN 73
          K +R   +C+ C  RKIKCD        +P C+ C + G  C +  + + S   + + + 
Sbjct: 38 KRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWECLYFLNARVSRGGKHNIST 91

Query: 74 GLE 76
          G E
Sbjct: 92 GTE 94

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
          PPR1Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain, positively
          regulates transcription of URA1, URA3, URA4, and URA10,
          which are involved in de novo pyrimidine biosynthesis,
          in response to pyrimidine starvation; activity may be
          modulated by interaction with Tup1p
          Length = 904

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 17 RSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTC 55
          +S  AC  CRL+KIKCD         P CKRC +    C
Sbjct: 29 KSRTACKRCRLKKIKCDQ------EFPSCKRCAKLEVPC 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,162,481
Number of extensions: 4078177
Number of successful extensions: 13118
Number of sequences better than 10.0: 547
Number of HSP's gapped: 13201
Number of HSP's successfully gapped: 564
Length of query: 831
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 713
Effective length of database: 39,950,811
Effective search space: 28484928243
Effective search space used: 28484928243
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)