Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A038805.524ON1696115246510.0
ZYRO0D12496g5.524ON23855478004e-85
SAKL0G04862g5.524ON24445366191e-63
Smik_4.6955.524ON15554905534e-56
Suva_2.5975.524ON17974925294e-53
ADR200C5.524ON23385045108e-51
YDR420W (HKR1)5.524ON18024915043e-50
Ecym_40605.524ON22015364687e-46
Kwal_47.186505.524ON21595214642e-45
KLLA0A01826g5.524ON14644724523e-44
KAFR0E033205.524ON11904224183e-40
KLTH0G03696g5.524ON20855604122e-39
KNAG0C032605.524ON15304243801e-35
TPHA0L003605.524ON11615373753e-35
CAGL0F03003g5.524ON11852113744e-35
Skud_4.6945.524ON15042183656e-34
Kpol_363.145.524ON7612312964e-26
SAKL0H23188g4.150ON12622142984e-26
Kwal_47.177034.150ON15683052968e-26
Skud_7.2994.150ON11693352904e-25
NCAS0A052304.150ON7853792858e-25
ZYRO0G11242g4.150ON14872082878e-25
KAFR0F034704.150ON9493182841e-24
KLTH0E08844g4.150ON15202192752e-23
YGR014W (MSB2)4.150ON13062092734e-23
Kpol_1062.374.150ON9733202698e-23
Ecym_73494.150ON11292992635e-22
Smik_7.3024.150ON11892092573e-21
AGR019C4.150ON11052212554e-21
TPHA0K013904.150ON8262102536e-21
TDEL0D030104.150ON11232132538e-21
CAGL0F08833g4.150ON9363522529e-21
TBLA0G012104.150ON18253492511e-20
KNAG0D035904.150ON9942202492e-20
KLLA0C17985g4.150ON9082092474e-20
NDAI0K025804.150ON9852132422e-19
Suva_7.2964.150ON11352092403e-19
TBLA0G009505.524ON22531231633e-10
Ecym_20143.12ON33970801.3
KAFR0G026806.23ON383134772.5
Kpol_163.1singletonON26675763.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03880
         (1696 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....  1796   0.0  
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   312   4e-85
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   243   1e-63
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   217   4e-56
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   208   4e-53
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   201   8e-51
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   198   3e-50
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   184   7e-46
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   183   2e-45
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   178   3e-44
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   165   3e-40
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   163   2e-39
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   150   1e-35
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   149   3e-35
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   148   4e-35
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   145   6e-34
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   118   4e-26
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...   119   4e-26
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...   118   8e-26
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...   116   4e-25
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...   114   8e-25
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...   115   8e-25
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...   114   1e-24
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...   110   2e-23
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...   109   4e-23
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...   108   8e-23
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...   105   5e-22
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...   103   3e-21
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...   102   4e-21
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...   102   6e-21
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...   102   8e-21
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...   101   9e-21
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....   101   1e-20
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...   100   2e-20
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...   100   4e-20
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    98   2e-19
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    97   3e-19
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    67   3e-10
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    35   1.3  
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23      34   2.5  
Kpol_163.1 s163 (208..1008) [801 bp, 266 aa] {ON} (208..1008) [8...    34   3.2  

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score = 1796 bits (4651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 930/1152 (80%), Positives = 930/1152 (80%)

Query: 545  AGEGEQTFSKSSSEPGFDQSTSTPTTTVVIDVSGFRPXXXXXXXXXXXXXXXXXXXXXXN 604
            AGEGEQTFSKSSSEPGFDQSTSTPTTTVVIDVSGFRP                      N
Sbjct: 545  AGEGEQTFSKSSSEPGFDQSTSTPTTTVVIDVSGFRPLTFFFSSSESSLEVSHTSSSTFN 604

Query: 605  EPDTASTMPSNSYGEGXXXXXXXXXXXXXAPDWDPSSSTMATPPLSNSQSTSDDFEQSTT 664
            EPDTASTMPSNSYGEG             APDWDPSSSTMATPPLSNSQSTSDDFEQSTT
Sbjct: 605  EPDTASTMPSNSYGEGTSTSLTSDTSESSAPDWDPSSSTMATPPLSNSQSTSDDFEQSTT 664

Query: 665  EYSGPSSTTSTPEVPIITLTSSSEPVYXXXXXXXXXXXXXXXXXXDATRDSSSVLQTNSA 724
            EYSGPSSTTSTPEVPIITLTSSSEPVY                  DATRDSSSVLQTNSA
Sbjct: 665  EYSGPSSTTSTPEVPIITLTSSSEPVYTLSTTTPSSSSILTPITTDATRDSSSVLQTNSA 724

Query: 725  NTITNPIXXXXXXXXXXXXXXXXAPHYTDTSSSQTTGSIFEVTLAXXXXXXXXXQDSPTF 784
            NTITNPI                APHYTDTSSSQTTGSIFEVTLA         QDSPTF
Sbjct: 725  NTITNPISSLSSFGQSSQEYSGSAPHYTDTSSSQTTGSIFEVTLATSTISSITSQDSPTF 784

Query: 785  DLXXXXXXXXXXXXXXXGNVGGEIATSITSVDTSNIDIGQXXXXXXXXXXLTTASQFQVS 844
            DL               GNVGGEIATSITSVDTSNIDIGQ          LTTASQFQVS
Sbjct: 785  DLSYITSQSSISSTSTSGNVGGEIATSITSVDTSNIDIGQSSYESPSQSSLTTASQFQVS 844

Query: 845  QDGTSSAMETGSVLNGQPESTGAQSFTSDIASATSLTESSYDSIATEEPTSSSNLETIDS 904
            QDGTSSAMETGSVLNGQPESTGAQSFTSDIASATSLTESSYDSIATEEPTSSSNLETIDS
Sbjct: 845  QDGTSSAMETGSVLNGQPESTGAQSFTSDIASATSLTESSYDSIATEEPTSSSNLETIDS 904

Query: 905  SSKTATATYDSDSLSNSIASQQASGSSDFQTNIGTTSSPXXXXXXXXXXXXXXXXMVSEQ 964
            SSKTATATYDSDSLSNSIASQQASGSSDFQTNIGTTSSP                MVSEQ
Sbjct: 905  SSKTATATYDSDSLSNSIASQQASGSSDFQTNIGTTSSPFDTATSTFLTSSLSDSMVSEQ 964

Query: 965  PTVSNNPQDTHSIXXXXXXXXXXXXXXXXXXXXXXNDTGSESLSLSATTRSSVDLISGTE 1024
            PTVSNNPQDTHSI                      NDTGSESLSLSATTRSSVDLISGTE
Sbjct: 965  PTVSNNPQDTHSISQTETLEPSSTSSGTSTDDTQPNDTGSESLSLSATTRSSVDLISGTE 1024

Query: 1025 SDGSLRMTLTTRPAXXXXXXXXXXXXXXXXXXXRSSSVGGRTTFWLPSSIQVQSDPTRSG 1084
            SDGSLRMTLTTRPA                   RSSSVGGRTTFWLPSSIQVQSDPTRSG
Sbjct: 1025 SDGSLRMTLTTRPAQSTGSLLTTGQTTAANTGARSSSVGGRTTFWLPSSIQVQSDPTRSG 1084

Query: 1085 TSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPF 1144
            TSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPF
Sbjct: 1085 TSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPF 1144

Query: 1145 VLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGISKRSDSEFPFNA 1204
            VLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGISKRSDSEFPFNA
Sbjct: 1145 VLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGISKRSDSEFPFNA 1204

Query: 1205 SAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAAL 1264
            SAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAAL
Sbjct: 1205 SAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAAL 1264

Query: 1265 IDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXXXXXXXXXXXXXGSLGTATNSGLSSAVKK 1324
            IDPSIPLTGLIDGSTGSLNGG                      GSLGTATNSGLSSAVKK
Sbjct: 1265 IDPSIPLTGLIDGSTGSLNGGNPSTQSHSPSSPYKSQSSDDNSGSLGTATNSGLSSAVKK 1324

Query: 1325 RLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHS 1384
            RLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHS
Sbjct: 1325 RLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHS 1384

Query: 1385 AETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYY 1444
            AETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYY
Sbjct: 1385 AETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYY 1444

Query: 1445 AGPLQSTSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVV 1504
            AGPLQSTSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVV
Sbjct: 1445 AGPLQSTSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVV 1504

Query: 1505 SDPSPNEEEHEITSSNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGMG 1564
            SDPSPNEEEHEITSSNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGMG
Sbjct: 1505 SDPSPNEEEHEITSSNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGMG 1564

Query: 1565 QEGNPDFLSSTEQNWHISSPDESENFPGRSVFGFYGSDDSNNIVQSLPAENCIDEXXXXX 1624
            QEGNPDFLSSTEQNWHISSPDESENFPGRSVFGFYGSDDSNNIVQSLPAENCIDE     
Sbjct: 1565 QEGNPDFLSSTEQNWHISSPDESENFPGRSVFGFYGSDDSNNIVQSLPAENCIDEYLYVS 1624

Query: 1625 XXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXMYKRRSKLMTQQQRTENGMLHMSR 1684
                         R                      MYKRRSKLMTQQQRTENGMLHMSR
Sbjct: 1625 GDDDSLLDSPLGVRIEEIDDDAVDVHVDDLDELDEEMYKRRSKLMTQQQRTENGMLHMSR 1684

Query: 1685 VMKAKAQGTRRI 1696
            VMKAKAQGTRRI
Sbjct: 1685 VMKAKAQGTRRI 1696

 Score =  456 bits (1174), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 266/479 (55%), Positives = 266/479 (55%)

Query: 1   MKYHQLVRLVLIIFAITSSVRALPSSNALEEKTGSTEQNRETTNSFSGDAYTIQSPSHTS 60
           MKYHQLVRLVLIIFAITSSVRALPSSNALEEKTGSTEQNRETTNSFSGDAYTIQSPSHTS
Sbjct: 1   MKYHQLVRLVLIIFAITSSVRALPSSNALEEKTGSTEQNRETTNSFSGDAYTIQSPSHTS 60

Query: 61  NLQTGTSDRSSSNKIDSRSGTTSVIANSADKSSSAPGDANDQKVGXXXXXXXXXXXXXDI 120
           NLQTGTSDRSSSNKIDSRSGTTSVIANSADKSSSAPGDANDQKVG             DI
Sbjct: 61  NLQTGTSDRSSSNKIDSRSGTTSVIANSADKSSSAPGDANDQKVGSESESSPTTSTQSDI 120

Query: 121 PTTSQLWSEAXXXXXXXXXXXXXXQQKXXXXXXXXXXXXXXXXXXXXXXXDRAVXXXXXX 180
           PTTSQLWSEA              QQK                       DRAV      
Sbjct: 121 PTTSQLWSEASKSSSVKPEVISSSQQKTETTSLSIPSSTSSIGTSLSSASDRAVGSTNSG 180

Query: 181 XXXXXYDKKTSSQTVYTISSDTETKLSNTPXXXXXXXXXXXXXXDKNSGISAGLXXXXXX 240
                YDKKTSSQTVYTISSDTETKLSNTP              DKNSGISAGL      
Sbjct: 181 GSSNTYDKKTSSQTVYTISSDTETKLSNTPTTIQSSSTRSGISSDKNSGISAGLTSDSSV 240

Query: 241 XXXXXXXXXXXXXXXXXXKSQDINTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPALI 300
                             KSQDINTI                             KPALI
Sbjct: 241 KASSSTSSTSDQLALQTSKSQDINTISSSSGAPTSSPASSFTALSDTTSTTFSDSKPALI 300

Query: 301 TGQSSSLSTDTPPLAXXXXXXXXXXXXXADDTDRNEGTSSKITTNSETSPALNTQNVVTI 360
           TGQSSSLSTDTPPLA             ADDTDRNEGTSSKITTNSETSPALNTQNVVTI
Sbjct: 301 TGQSSSLSTDTPPLASSISNTQSSQNNIADDTDRNEGTSSKITTNSETSPALNTQNVVTI 360

Query: 361 IPTESKSTLTINDXXXXXXXXXXXXXXXXXDELXXXXXXXXXXXXXXXXXXXGFSWDNPF 420
           IPTESKSTLTIND                 DEL                   GFSWDNPF
Sbjct: 361 IPTESKSTLTINDTPLTSSSQSTRPTSSITDELTSLTSTPASTASSDSTTASGFSWDNPF 420

Query: 421 ANELFVNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADQATTSTGHQLTWD 479
           ANELFVNP                                    ADQATTSTGHQLTWD
Sbjct: 421 ANELFVNPSTTSDATQSTASNSDTLVGSTSSSSAISVTPTSPTSADQATTSTGHQLTWD 479

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  312 bits (800), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 205/547 (37%), Positives = 300/547 (54%), Gaps = 63/547 (11%)

Query: 1067 TFWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            T WLP SI +QS P+ S   SF+P VTATLP  IAP T V  P N+S IT+GFK+ ++Y+
Sbjct: 1646 TNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYD 1705

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFN-NTTTLMPAQFH 1185
            FLV++  ++AQIF FLP VL +PF  +   D     +GT    S  +   TTTL P   +
Sbjct: 1706 FLVNNPLSSAQIFTFLPDVLIYPFNYDQNID-----KGTHTNESSHYKRKTTTLQP---Y 1757

Query: 1186 QETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSD 1245
            ++ +   +K+   +   + + V VIQIMPM+ +D++YL ++A LYFP+ YV++L+  + +
Sbjct: 1758 RDVMVRTNKKHKVQM-ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKN 1816

Query: 1246 DTSQLFNNPDPTLDALAALIDPSIPLTGLIDG----STGSLNGGXXXXXXXXXXXXXXXX 1301
              S L+NN +PTL ALA LIDPSIPLTG++D     + G    G                
Sbjct: 1817 SNSMLYNNTNPTLFALADLIDPSIPLTGMVDDNGDVNNGGSGSGSSGEGNHASQSPHSFQ 1876

Query: 1302 XXXXXXGSLGTA-TNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKR 1360
                  G+L TA + S ++  + KRL I+L C  FG LLWIL F+F+++ +        R
Sbjct: 1877 NGNEDNGNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKI--------R 1928

Query: 1361 AYQRDAAQEEKQHY----NFADITSVHSAETEPANDKSDDVP---QEKDVASASQS---- 1409
              Q     EE + Y       D+  + S   E     S   P   QEK   + SQ+    
Sbjct: 1929 KVQ---PPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETV 1985

Query: 1410 -RYSLP------------------EDLMITGENTVYSVSQGLQYFVAEDGSFYYAGPLQS 1450
             R + P                  +DL++TGENTVYS   GL+YFV EDG F+YAG  Q 
Sbjct: 1986 DRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQ- 2044

Query: 1451 TSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVVSDPS-- 1508
             S+E+ TTK +  +I+D + Y+Y+  +E S+  +E    D+ SL++DEEGNFV+ +    
Sbjct: 2045 ISDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDEIY 2104

Query: 1509 PNEEEHEITSS---NSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGMGQ 1565
             N +E+  + S   NS T+E YNNN+LYKMTR+ +S  ++   +L  D +G     G G 
Sbjct: 2105 DNLQENSRSGSGNKNSDTVESYNNNHLYKMTRSSDSEGVTKDAFLSSD-EGSPEIYGYGT 2163

Query: 1566 EGNPDFL 1572
            E   +++
Sbjct: 2164 EAGDEYM 2170

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  243 bits (619), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 173/536 (32%), Positives = 253/536 (47%), Gaps = 73/536 (13%)

Query: 1069 WLPSSIQVQS-DPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEF 1127
            WLP S+ V+S D +   +++ D   T+TLPQ I PPTAVP P   S IT+GFK+ LNY F
Sbjct: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533

Query: 1128 LVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRG----TLL------------VSSF 1171
            L+S   ++AQIF FLP VL +PF         Y+R+     TLL              S 
Sbjct: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTCSL 1593

Query: 1172 EFNNTTTLMPAQ------------------FHQETV----TGISKRSDSEFPFNASAVDV 1209
             F N   +                       H+ +V    + ++  SDS    + S + V
Sbjct: 1594 SFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSS-NIDYSQIVV 1652

Query: 1210 IQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSI 1269
             QI+P++    NY+ S+A +YFP   +  LQ +V +  S+L+ NP+ +L ALA+LIDPS+
Sbjct: 1653 KQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPSV 1712

Query: 1270 PLTGLIDGSTGSLNGGXXXXXXXXXXXXXXXXXXX---------------XXXGSLGTAT 1314
            PLTGL+D    S+                                        GSL    
Sbjct: 1713 PLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSGGSGESQGGANGDGSALGSLDDGA 1772

Query: 1315 NSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEE---- 1370
               +S A+ KRL+IYL    F T+LWI+ +++  K LYG  VI KR    D         
Sbjct: 1773 YGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPGA 1832

Query: 1371 --KQHYN--FADITS-VHSAETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTV 1425
                HYN  ++D  +  +  E       S D   + D  +  Q  Y L +DL++TG+NTV
Sbjct: 1833 FYNHHYNSHYSDPNNPFYDPERSLREKCSFDERYDYDYDTEEQDGY-LYDDLVVTGDNTV 1891

Query: 1426 YSVSQGLQYFVAEDGSFYYAGPLQSTSEENETTKGDSADIEDINDYLYSADQERSI---- 1481
            YS S+GL YF+ E+G++YYAG +     ENE    +  D   +    +  +   SI    
Sbjct: 1892 YSTSRGLSYFIDENGNYYYAG-MDFIVNENE-QANEFVDHNQLQSMEHIYEGHDSIAGGA 1949

Query: 1482 VTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEE--HEITSSNSATIELYNNNNLYKM 1535
            + +E+ + DI ++ +DEEGN  + D   N      ++    + T+E YNNN  YKM
Sbjct: 1950 LIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVESYNNNQYYKM 2005

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  217 bits (553), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 246/490 (50%), Gaps = 37/490 (7%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLP++I VQS  T + T+ F+P +T +LP LI P      P N + ITVGF   LNY FL
Sbjct: 968  WLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFL 1027

Query: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTK-DFSYKRRGTLLVSSFEFNNTTTLMPAQFHQE 1187
            V +  ++AQIF+FLP VL +PF +  +  + S     + ++S     +TTTL P      
Sbjct: 1028 VQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSL 1087

Query: 1188 TVTGISKRS----------DSEFP-FNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYV 1236
            ++    K+           D  FP  NAS++ V QI+PM+   + Y+ ++A +YFP+  V
Sbjct: 1088 SIVRKKKKGDKEKPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAV 1147

Query: 1237 SELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI---DGSTGSLNGGXXXXXXXX 1293
            S LQ ++ D  S L+NNP   L  LA LID SIPL  L     G+ G ++          
Sbjct: 1148 SYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDS 1207

Query: 1294 XXXXXXXXXXXXXXGSLGTATNSGLSSA----VKKRLVIYLTCLVFGTLLWILVFMFLYK 1349
                          G+L   TNS   SA       R +++L  L  G LLW+L   F++ 
Sbjct: 1208 SKENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGALLWLLFAFFVFH 1267

Query: 1350 HLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDKSDDVPQEKDVASASQS 1409
            +    R I  + Y +D  ++   +    D T++  + +       + +  EK   S ++S
Sbjct: 1268 Y----RNILLKRYPKDCIEKSLGNERKFDSTALSRSSS------GNQIFNEKPSGSENES 1317

Query: 1410 RYSLPED-LMITGENTVYSVSQGLQYFVAEDGSFYYAGPLQSTSEENETTKGDSADIEDI 1468
             +S+ +D  +ITGENTVYS + GL Y + +DG  +Y     + ++  ET + + + I+ I
Sbjct: 1318 VHSVTDDHYIITGENTVYSTTHGLHYTINDDGDLFYKE--ATLNDLEETAEREDSGIDSI 1375

Query: 1469 -NDYLYSADQE--RSIVTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEEHEITSSNSATIE 1525
              D +Y   QE   + + +E+S   I  + +DE GN  + D   ++EE       +  IE
Sbjct: 1376 LRDCVYDEHQESTEAYLNDEESISSI--VDVDENGNIRLYDSYSDDEEPNSFYLPNEVIE 1433

Query: 1526 LYNNNNLYKM 1535
             YNNNN+YK+
Sbjct: 1434 EYNNNNVYKI 1443

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  208 bits (529), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 164/492 (33%), Positives = 252/492 (51%), Gaps = 37/492 (7%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLP++I V+   + + T+SF+P++TA+LP +IAP  AV  P N + IT+GF   LNY FL
Sbjct: 1205 WLPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNYVFL 1264

Query: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTKD---FSYKRRGTLLVSSFEF-NNTTTLMPAQF 1184
            V +  ++AQIF+FLP VL +PF +  ++     +Y+   +  V S++  ++TTTL P   
Sbjct: 1265 VQNPLSSAQIFNFLPLVLKYPFSDTTSQQEESSTYEMGSSSFVLSYQSGSSTTTLSPESV 1324

Query: 1185 HQETVT----------GISKRSDSEFP-FNASAVDVIQIMPMIIKDRNYLTSIAVLYFPS 1233
                +            +   ++ + P    S++ V QI+PMI   R+Y+ ++A +YFP+
Sbjct: 1325 SSIPIVRKKKKKGGKNSVMSTANLDLPSIGNSSIVVKQIVPMIDSSRSYVIAVAEVYFPT 1384

Query: 1234 AYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGL-IDGSTG--SLNGGXXXXX 1290
              +S LQ ++ D  S L+NNP  +L  LA LID S+PL GL + GS    S+        
Sbjct: 1385 EAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGLTLYGSNNGCSICDSSSSSV 1444

Query: 1291 XXXXXXXXXXXXXXXXXGSLGTATNS---GLSSAVKKRLVIYLTCLVFGTLLWILVFMFL 1347
                             G+L   TNS    +   + KR +IYLTCL  G LLW+L+ +F 
Sbjct: 1445 SEVSNTNSTKNGGTNKYGALDDFTNSLTDHMPWRITKRFIIYLTCLTAGVLLWLLLALFA 1504

Query: 1348 YKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDKSDDVPQEKDVASAS 1407
            ++H     V+  R   R +   EK   N   +  V  + +  ++D  +    EK   + S
Sbjct: 1505 FRH---RNVLLGR---RPSNCIEKTPNNERGLEGVGVSTSRSSSDNHNY--NEKKPNTES 1556

Query: 1408 QSRYSLPEDLMI-TGENTVYSVSQGLQYFVAEDGSFYYAGPLQSTSE---ENETTKGDSA 1463
            +S YS+ +D  I TGENTVYS + GL Y V EDG  +Y   + +  +   ENE +  DS 
Sbjct: 1557 ESFYSMEDDQYIPTGENTVYSATHGLHYTVDEDGDLFYRKSMPNDIDEINENEDSGIDSI 1616

Query: 1464 DIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEEHEITSSNSAT 1523
              E + D     D     + +E+S   I  L +DE GN  + D    ++E          
Sbjct: 1617 LRECVYD--RHQDTTEVYLNDEESMSSI--LDVDENGNIRLYDSYSEDDEPNCPHLQEEV 1672

Query: 1524 IELYNNNNLYKM 1535
            IE YNN+++YKM
Sbjct: 1673 IEDYNNSHVYKM 1684

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  201 bits (510), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 154/504 (30%), Positives = 234/504 (46%), Gaps = 74/504 (14%)

Query: 1069 WLPSSIQVQSDPTR--SGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            WLP++I  +S      +  S+     T  LP  I P + V   +    I++GF K LNY 
Sbjct: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFE---------ENGTKDFSYKRRGTLLVSSFEFNNTT 1177
            F+ S + ++AQIF FLP VL++PFE          + T+    +R   +   S    +TT
Sbjct: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617

Query: 1178 TLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVS 1237
            TL  + F    V  + K + S+ P + S V V Q+ P + ++R Y+ ++A +YFPS  V 
Sbjct: 1618 TL--SSFTHSQVIAVQKET-SDVP-DLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVP 1673

Query: 1238 ELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLT--------------GLIDGSTGSLN 1283
            +LQ ++ D  S L+NNPD  L   A+LIDP+I +               G   GS G   
Sbjct: 1674 KLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSP 1733

Query: 1284 GGXXXXXXXXXXXXXXXXXXXXXXGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILV 1343
             G                      GSL  + +  ++  + KRL+I+LT L FG  LW LV
Sbjct: 1734 SGYANHGD----------------GSLDNSKSPKITFKITKRLLIFLTVLTFGVFLWRLV 1777

Query: 1344 FMFLYKHLY------GGRVIAKRAYQRDAAQEEKQHYN--FADITSVHSAETEPANDKSD 1395
            F++L++ LY         V+ ++             +N   +D+      E +P  +K D
Sbjct: 1778 FLYLFRRLYRINKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSDLKPSALYEGDP--EKQD 1835

Query: 1396 DVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYYAG--PLQSTSE 1453
                  D +S S   Y+  +D+++TGENTVYS+SQG+ Y + E+G++YYAG  P     E
Sbjct: 1836 GT--ATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYHIDEEGNYYYAGIDPFTDAFE 1893

Query: 1454 ENETTKGDSADIEDINDYLYSADQERSIVTN--EQSSCDIGSLQIDEEGNFVVSDPSPNE 1511
            +               D LY   +  S+  N  +  S DI    ID +GN  + D   + 
Sbjct: 1894 QEA-------------DCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFDH 1940

Query: 1512 EEHEITSSNSATIELYNNNNLYKM 1535
               +     + TIE YNNN  YKM
Sbjct: 1941 TSLDQVPKATETIEKYNNNQYYKM 1964

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  198 bits (504), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 150/491 (30%), Positives = 241/491 (49%), Gaps = 45/491 (9%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLP++I V+S  T   T+SF+P++T +LP  I P  AV  P N + IT+GF   LNY FL
Sbjct: 1210 WLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYVFL 1269

Query: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTK-DFSYKRRGTLLVSSFEFNNTTTLMPAQF--- 1184
            V +  ++AQIF+FLP VL +PF    ++ D S     T ++S    ++TTTL P      
Sbjct: 1270 VQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSYRSGSSTTTLSPKSISSL 1329

Query: 1185 ------HQETVTGISKRSDSEFP--FNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYV 1236
                    +     +K ++   P   + S++ V +I+PM+   + Y+ S+A +YFP+  V
Sbjct: 1330 SVVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSVAEVYFPTEAV 1389

Query: 1237 SELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXX 1296
            + LQ ++ D+ S L++NP   L +LA LID  IPL GL     GS +GG           
Sbjct: 1390 TYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTL--YGSGDGGYVPSLTSSSVL 1447

Query: 1297 XXXXXXXXXXXGS---------LGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFL 1347
                       G+         + + T+S  +     +++I+L  L  G LLW+ V  F 
Sbjct: 1448 DSSKGNSQNIDGTYKYGALDDFINSFTDSASAGKYAVKIIIFLIVLTIGVLLWLFVAFFA 1507

Query: 1348 YKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDKSDDVPQEKDVASAS 1407
            ++H    R I  + + R+     K   N  ++ S   + +   N   ++ P E +    +
Sbjct: 1508 FRH----RNILLKRHPRNCIG--KSLNNERELESTELSRSSSGNQVYNEKPPESE----N 1557

Query: 1408 QSRYSLPED-LMITGENTVYSVSQGLQYFVAEDGSFYY--AGPLQSTSEENETTKGDSAD 1464
            +S YS  +D  ++TGENTVY+    L Y + +DG   Y  A PL    + ++T   D + 
Sbjct: 1558 ESVYSAVDDHYIVTGENTVYNTIHRLHYTINDDGDLLYRDAIPL----DFDQTNGDDGSG 1613

Query: 1465 IEDI-NDYLYSADQE--RSIVTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEEHEITSSNS 1521
            I+ I  D +Y  +Q+   + + +E+S   I  L +DE G+  + D   + EE        
Sbjct: 1614 IDSIVRDCVYDKNQDATEAFLNDEESISGI--LDVDENGDIRLYDSYSDNEESNSFHLPD 1671

Query: 1522 ATIELYNNNNL 1532
              IE YN N+L
Sbjct: 1672 EVIENYNKNHL 1682

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  184 bits (468), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 175/536 (32%), Positives = 257/536 (47%), Gaps = 72/536 (13%)

Query: 1067 TFWLPSSI---QVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNL 1123
            T WLP++I    +Q+ P  S T     A T TLP+ I P T V  P+N   IT+GF + L
Sbjct: 1325 TGWLPTTIVTASMQTSPKESTT--VGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGL 1382

Query: 1124 NYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKR------------RGTLLVSSF 1171
            NY FLVS+   +AQIF FLP +L++P+ EN  K+    R            RG+  VS  
Sbjct: 1383 NYAFLVSNPVASAQIFSFLPHLLNYPYIEN--KEALLLRHINESNNNILGNRGS--VSGS 1438

Query: 1172 EFNNTTTLMPAQFHQETVTGISKRSDSEF----PFNASAVDVIQIMPMIIKDRNYLTSIA 1227
             FN    L     H  +   + +R ++E         S + V QI+P +++  +Y  S+A
Sbjct: 1439 YFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVA 1498

Query: 1228 VLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGXX 1287
             +YFPS  V+ L+ MV+D  S+L+ NP  TL+ LA+L+DP IP+  +  GS+ S +    
Sbjct: 1499 EVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSSPSFS-NTD 1557

Query: 1288 XXXXXXXXXXXXXXXXXXXXGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFL 1347
                                G+L    +  +S A +KR++I+     FG LLWIL+F+FL
Sbjct: 1558 PDHSGDTSGSSNNNSSDHKGGTLDLGAHRHMSPATRKRILIFSLAFSFGVLLWILIFLFL 1617

Query: 1348 YKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDKSD---DVPQEKDVA 1404
             K LY    I  +   R     EK   N   I+  H      ++ K+D   D   E++  
Sbjct: 1618 LKRLYKVSKIRSKIVLR-----EKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPERNFN 1672

Query: 1405 SASQSRY----SLP-----EDLMITGENTVYSVSQGLQYFVAEDGSFYYA--GPLQSTSE 1453
            S S +      S+P     +D+++TGENTVYS+SQG+ Y + E+G++YYA   P      
Sbjct: 1673 SQSTNSSSNHDSVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPF----- 1727

Query: 1454 ENETTKGDSADIEDINDYLYSADQERSIVTNEQS--SCDIGSLQIDEEGNFVVSDPSPNE 1511
                    S   E   D +Y      +I  NE    S  I    ID+EGN  +S+    E
Sbjct: 1728 --------SNSFEPEADIMYQESGGETININEAQYMSSGIDLEDIDQEGNIEISE---LE 1776

Query: 1512 EEH-EITS---SNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGM 1563
              H E+ S    +   IE YN N  Y M+  V   E S+P+    ++ G  S+ GM
Sbjct: 1777 FHHPELLSHLQKDDGIIEHYNKNQYYNMSTIV--TESSNPQC---NTVGLSSEPGM 1827

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  183 bits (464), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 164/521 (31%), Positives = 241/521 (46%), Gaps = 63/521 (12%)

Query: 1060 SSVGGRTTF-WLPSSIQVQSDPTRS--GTSSFDPAVTATLPQLIAPPTAVPVPENASKIT 1116
            S  G RT+  WLP+ + V +  T S    SSFD A TATLPQ I P T V +P N S+IT
Sbjct: 1294 SVAGSRTSSDWLPT-LLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANYSQIT 1352

Query: 1117 VGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPF-----------EENGTKDFS-YKRRG 1164
            +GF+K LNY FL+ +   +AQIF FLP VL +PF           E    + F  + R G
Sbjct: 1353 IGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDG 1412

Query: 1165 TLLVSSF-----EFNNTTTLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKD 1219
             L  ++      +  N  T    +  Q     +  R+ + F  N S V V  I+P+II  
Sbjct: 1413 HLENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGA-FSANFSEVVVSSIIPLIISG 1471

Query: 1220 RNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI---- 1275
             +Y+ S+A++YFP++ V+ LQ M+ +  S L++NPD T ++LA LIDP IP+TGL+    
Sbjct: 1472 NDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGLVDSDG 1531

Query: 1276 --------DGSTGSLNGGXXXXXXXXXXXXXXXXXXXXXXGSLGTATNSGLSSAVKKRLV 1327
                     GS  S +GG                      G+LG      +S +V K+L+
Sbjct: 1532 SSGSGDGSGGSGSSGDGGDSGSSSSGSGSSTNASTDDRNLGTLGGFDFFHMSFSVAKKLI 1591

Query: 1328 IYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAET 1387
            I+L   +    LW+L+ +  +       V +K   ++D   ++K         SV     
Sbjct: 1592 IFLPVFLVSIALWVLLGLLFFGG----LVGSKNKNKQDPLPDKKW--------SVDEKAL 1639

Query: 1388 EPANDKSDDVPQEKDVASA-------SQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDG 1440
            +   D   DV  EK   SA       +   +   EDL+  G    +S S GL Y V  DG
Sbjct: 1640 QSYFDPHPDV--EKYPGSAWSSTSDSNSDDFRSEEDLLAVGNGLFFSRSTGLTYQVGPDG 1697

Query: 1441 SFYYAGPLQSTSEENE-----TTKGDS-ADIEDINDYLYSADQERSIVTNEQSSCDIGSL 1494
            +FYYAG       +N+     T  GD   ++  +       +     +   Q   D+  +
Sbjct: 1698 NFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAVTTLFKEGEVNNEALHLSQVGQDLDEI 1757

Query: 1495 QIDEEGNFVVSDPSPNEEEHEITSSNSATIELYNNNNLYKM 1535
             +DE+GN  V  P  + E+     +N+ TIE YNN   YKM
Sbjct: 1758 IVDEDGN--VELPLADLEQLSFEENNTDTIESYNNQQYYKM 1796

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  178 bits (452), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 148/472 (31%), Positives = 228/472 (48%), Gaps = 72/472 (15%)

Query: 1069 WLPSSIQVQ--SDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            WLP+++ ++  +    S  +S D   T+TLPQ I P + VP+P+  + ITVGFK+ LNY 
Sbjct: 722  WLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYP 781

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            FL+++   +AQIF+FLP VL  PF+   T      RR   +   F+    T L+      
Sbjct: 782  FLIANPLASAQIFNFLPKVLVRPFQLTTTGAAPVYRRSWNI---FKKGINTHLL------ 832

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                       S  P     V V  I+P++I++ +Y+ SIA +YFP+  V  LQ +V D 
Sbjct: 833  ----------SSSLP-TYDDVQVKSIVPLVIQNVSYIVSIAEVYFPTESVHTLQELVLDS 881

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLI---------DGSTGSLNGGXXXXXXXXXXXX 1297
            +S L++NP   L  LA+LI+P+IPLTGL             +G  + G            
Sbjct: 882  SSILYSNPVSYLADLASLINPAIPLTGLTYSGSSGSSSGNGSGGDSDGNGNGSGEGTGGN 941

Query: 1298 XXXXXXXXXXGSLGTATNSGLSSAVKKR-LVIYLTCLV-----FGTLLWILVFMFLYKHL 1351
                       +L  + ++GL+S       VI   C+V     F   L  L+ +FL K+L
Sbjct: 942  GAEKDNSSNNAALWGSLDAGLTSGFPNHDTVIRFVCMVTVLTAFILCLVGLILVFL-KNL 1000

Query: 1352 YGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDK------------SDDVPQ 1399
            Y     A+R +  +         N+ +I + +S     + D             SD    
Sbjct: 1001 YKRTNCAQRMHLTEK--------NWPEIPTFYSHHMNGSTDSPMRNMFYSGSQFSDSDTT 1052

Query: 1400 EKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYYAGPLQ--STSEENET 1457
            E+D    S S   + +DL+ITGENTVYS+SQG+ Y+V EDG+F++AG  +   TSE  + 
Sbjct: 1053 EED----SHSAEYIDDDLIITGENTVYSISQGITYYVDEDGNFFFAGVGKDVHTSEPEKL 1108

Query: 1458 T-----KGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVV 1504
                  K ++  +E I  Y    D +   +T+E    D+G L++DE+GN  +
Sbjct: 1109 EKIIHDKTETVTVEPILPYYNEKDDD---LTDETEPFDMGELEVDEDGNIAL 1157

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  165 bits (418), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 130/422 (30%), Positives = 194/422 (45%), Gaps = 53/422 (12%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLP+S+   SD + S  SS +P +TATLP  IA PT    P N + +T+GFKK LNY FL
Sbjct: 592  WLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNYIFL 651

Query: 1129 VSSSTTAAQIFHFLPFVLSFPF---EENGTKD---------FSYKRRGTLLVSSFEFNNT 1176
            + +   +AQIF FLP  LS+PF   + N + +           Y+  G  ++++ E   +
Sbjct: 652  IDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTTHE---S 708

Query: 1177 TTLMPAQFHQETVTGISK--------------------RSDSEFP-FNASAVDVIQIMPM 1215
            TT+   QF ++ +   S                     R  S  P FN+S V V  I+PM
Sbjct: 709  TTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHILPM 768

Query: 1216 IIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            I   R+Y+ S+A +YFP+  +  LQ  ++   S L++NP      L  LIDP I LT L 
Sbjct: 769  ISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLF 828

Query: 1276 DGST---------GSLNGGXXXXXXXXXXXXXXXXXXXXXXGS--LGTATNSGLSSAVKK 1324
              +          GSL+                        GS  L +   S  SS +K 
Sbjct: 829  QQNGMNNQGNNQDGSLSSN-DSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKIKD 887

Query: 1325 RLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHS 1384
            RL I+ T  +F    WI +F+  +KH +  R+  K+A +          +N  D+ ++ +
Sbjct: 888  RLAIFTTVFLFVVFFWIWLFLVAFKH-WNKRIENKKAKKLLNKTLPTARFNRVDLVTLST 946

Query: 1385 AETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYY 1444
            A    +   S   P EK   S+ ++ +      + + E  VY  S G+QY V  DG+FYY
Sbjct: 947  AS---SMSSSSISPNEKQTYSSLENPFK-DGTTVNSKEGVVYDQSNGMQYTVDYDGNFYY 1002

Query: 1445 AG 1446
             G
Sbjct: 1003 FG 1004

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  163 bits (412), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 166/560 (29%), Positives = 249/560 (44%), Gaps = 82/560 (14%)

Query: 1069 WLPSSIQVQSDPTRSGT-SSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEF 1127
            WLPS+I   S    + T SSFD   TATLPQ I PPT V +P N S+IT+GFK++LNY F
Sbjct: 1228 WLPSNIVTASYTGSAHTQSSFDADATATLPQAIMPPTPVTMPPNYSQITIGFKESLNYPF 1287

Query: 1128 LVSSSTTAAQIFHFLPFVLSFPFEENG----TKDFSYKR-----RGTLLVSSF-----EF 1173
            L+ +   +AQIF FLP +L +PF        +   S KR      G LL+ +      + 
Sbjct: 1288 LIENPLASAQIFGFLPEILRYPFSVRASRSNSSTSSVKRDLVGDSGNLLLDNSTLILDKL 1347

Query: 1174 NNTTTLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPS 1233
            N  T++M +     +V+     S + F  N S V V  I+P+I+   +Y+TS+AV+YFP+
Sbjct: 1348 NWKTSIMNSLSSNVSVS--RNGSHNAFRANFSGVAVSSIVPLIVSGNDYITSVAVVYFPT 1405

Query: 1234 AYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXX 1293
              V  LQ M+ +  S+++ NPD +L  +A LID  IP+TG+I         G        
Sbjct: 1406 EAVEVLQKMIINGASRIYKNPDQSLRDMALLIDSKIPITGIISSDGSGQGSGSSGGSGSS 1465

Query: 1294 XXXXXXXXXXXXX-----------XGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWIL 1342
                                     G+L    N  +     KRLVI+L   +    +WI 
Sbjct: 1466 SGSDGTGSSGSSSESDYEDVKNDNSGTLDGYKNFQVKFFTTKRLVIFLPVFIVAVTMWIS 1525

Query: 1343 VFMFLYKHLYGGRVIAKRA--YQRDAAQEEKQHYNFADITSVHSAETEPANDKSDDVPQE 1400
            + +  +  L+    +   A   ++    ++K   N+  IT            +S D+  E
Sbjct: 1526 LGLLFFGSLFRKGSLQGMAGNLEKKWNTDQKTLDNYFGITEFI------GKRQSADL--E 1577

Query: 1401 KDVASA-----SQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYYAG-------PL 1448
            K++A +     S S     +DL+  G    +S S GL Y V  +G+F+YAG       PL
Sbjct: 1578 KNLAGSFHNDESSSDAFDDDDLLAVGNGMFFSKSTGLTYHVDREGNFFYAGTANKAVLPL 1637

Query: 1449 QSTS-----EENETTKGDSADIEDINDYLYSADQERSIVTNEQSS---CDIGSLQ----- 1495
            +S S       N    G+S    + N+   + ++       +++    C  G  +     
Sbjct: 1638 KSKSTSKLEASNMVPNGESDPKNEANEANEAKEEGEENEERKENEEKPCSNGEFRDDAEV 1697

Query: 1496 ----IDEEGN--FVVSDPSPNEEEHEITSSNSATIELYNNNNLYKMTRTV-NSNEISSPR 1548
                +DE+GN    VSD     E   +   NS TIE YNN   YKM + + N N      
Sbjct: 1698 EEFDVDEDGNVELSVSD----LERLSLDEHNSDTIESYNNQQYYKMKQLLQNLN------ 1747

Query: 1549 YLDQDSQGEISDAGMGQEGN 1568
              + D +G  S    G  GN
Sbjct: 1748 --NDDIEGAFSTENEGAAGN 1765

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  150 bits (380), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/424 (26%), Positives = 190/424 (44%), Gaps = 79/424 (18%)

Query: 1067 TFWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            T WLP++I + S+   + T+  +   TA+LP  IAP   +  P +   IT+GF   LNY 
Sbjct: 886  TVWLPTNIIIASNADSTHTARAES--TASLPAAIAPAEELQSPPDFELITIGFLSGLNYA 943

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            FLV +  ++AQ+F FLP VL FP E+   K  + + + + +        TT + P + ++
Sbjct: 944  FLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDIT-------TTLVAPLRKNR 996

Query: 1187 ETVTGISKRS------------------------DSEFPFNASAVDVIQIMPMIIKDRNY 1222
            +TVT +++ +                        D E  F    + V QI+P++I+  +Y
Sbjct: 997  KTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKN--IRVKQIIPLVIEGNDY 1054

Query: 1223 LTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI--DGSTG 1280
            +TS+A +YFP+ Y+  L +++SD  S L++NP      LA+LID +IPLT L   DG + 
Sbjct: 1055 ITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKNDGQSN 1114

Query: 1281 SLNGGXXXXXXXXXX-----XXXXXXXXXXXXGSLGTATNSGLSSAVKKRLVIYLTCLVF 1335
            +                                 L     S ++  ++ R++++L  L  
Sbjct: 1115 TSTDSSSDVNSNESTGDDAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTT 1174

Query: 1336 GTLLWILVFMFLYKHLYGGRVIA----KRA----YQRDAAQEEKQH-----YNFADITSV 1382
            G  LWI  F+ +++     R +     K+     YQ++  +E KQ       ++ DI   
Sbjct: 1175 GVFLWISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQNPYRENKQFSAESSESYIDI--- 1231

Query: 1383 HSAETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSF 1442
                TE  +D S   P                      GEN +   +QG+QY V  +G++
Sbjct: 1232 -HYTTEKYSDYSASSPP--------------------IGENIIVDSAQGIQYKVDNEGNY 1270

Query: 1443 YYAG 1446
            YY G
Sbjct: 1271 YYNG 1274

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  149 bits (375), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 141/537 (26%), Positives = 236/537 (43%), Gaps = 82/537 (15%)

Query: 1065 RTTFWLPSSIQVQSDPTRSGTSSFDPAV---TATLPQLIAPPTAVPVPENASKITVGFKK 1121
            R+  WLPS I +QSD T     S +P+    T+ LP +I  PTA+ +P N + ITV FK+
Sbjct: 512  RSFDWLPSEIAIQSDST---AESMEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAFKR 568

Query: 1122 NLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNT----- 1176
             LNY FLV++  ++AQIF+FLP ++  PF    ++  +     + L + +  N+      
Sbjct: 569  ELNYAFLVNNFYSSAQIFNFLPIIIKHPFTALVSESCNDDSVCSPLFTEYILNSYASSAA 628

Query: 1177 ---------------------------------TTLMPAQFHQETVTGISKRSDSEFPFN 1203
                                             T + P  F     + I   +  +   N
Sbjct: 629  SSMSTSSVNNVDFQSGGKHSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDLSKN 688

Query: 1204 ASA--------VDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLFNNPD 1255
            AS         + V +I+P I+++  Y+ SIA +Y P+  V  LQ ++ +  S  +N+  
Sbjct: 689  ASLQKQEISMDITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSES 748

Query: 1256 PTLDALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXXXXXXX---------XXXXX 1306
             +L  LA LIDP+IPLTG++D +   ++GG                              
Sbjct: 749  SSLKTLAFLIDPNIPLTGMLDSNGNLISGGLSSSNGNIQNSSTKHSHGSGISDISSQTLK 808

Query: 1307 XGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKRAYQRDA 1366
             G+L ++   GLS+ +KKRL I++ C   G +L+I + +F    +Y  ++  K   + D 
Sbjct: 809  LGTLDSSAYKGLSTNLKKRLSIFIVCFTVGAVLYIQLSLFGLNFMY-KKLSMKADPESDK 867

Query: 1367 AQEEKQHYNFADITSVHSAETEPANDKSDDVPQEKDVASASQSRYSLPEDLMITGENTVY 1426
            +   + H     IT   ++  E  + KS   P         +S     + + + G+  VY
Sbjct: 868  SSLPQYH-----ITRDSTSNIEGRSSKSFSTPSNPFSDKYQKSSSDSSKSITLPGK-AVY 921

Query: 1427 SVSQGLQYFVAEDGSFYYAGP--LQSTSEENETTKGDSADIEDI--NDYLYSADQERS-I 1481
            + SQ + Y V E G+FYY     +Q  +     T   S   +D+  N Y+Y ++   S  
Sbjct: 922  NRSQDMTYLVDEQGNFYYTNLDNVQGRTVHIMRTPEGSIYSKDVSYNKYVYDSNNSTSNT 981

Query: 1482 VTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEEHEITSSNSATIE---LYNNNNLYKM 1535
              ++Q   +  +   D E  +      P+   +E+  S++  IE    +NNN LYKM
Sbjct: 982  YLDDQYHENTVNKGDDLEITY------PDFLLNEVKESHTNIIENVKRFNNNGLYKM 1032

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  148 bits (374), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 119/211 (56%), Gaps = 25/211 (11%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLPS I  QSD   + +SSF+P  T +LPQ IAPP       N + +T+G K+ LNY+FL
Sbjct: 717  WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFL 776

Query: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQET 1188
            + +  ++AQIF+FLP VL++PF      DF         ++S   +N    +        
Sbjct: 777  IDNPLSSAQIFNFLPSVLTYPFSSYAPNDFP--------INSLIDDNALAFL-------- 820

Query: 1189 VTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTS 1248
                    DS   FNAS + V  I+P++I    +  S+  +YFP+  +  L +++ D  S
Sbjct: 821  --------DSNL-FNASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNS 871

Query: 1249 QLFNNPDPTLDALAALIDPSIPLTGLIDGST 1279
             L++NP+ +L ALA LIDPSIPLTGLI GS+
Sbjct: 872  SLYSNPNDSLSALARLIDPSIPLTGLISGSS 902

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  145 bits (365), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 124/218 (56%), Gaps = 12/218 (5%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLP++I V+   T S T+ F+P++T +LP LI P  AV  P N + ITVGF   LNYEFL
Sbjct: 918  WLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEFL 977

Query: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFN-NTTTLMPAQFHQE 1187
            V +  ++AQIF+FLP VL +PF     +  S  +  +  V S++   +TTTL P      
Sbjct: 978  VQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGTSTTTLSPKSVSSL 1037

Query: 1188 TVTGIS----KR------SDSEFP-FNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYV 1236
            ++        KR      +D   P    S++ V QI+PM+   + Y+ ++A +YFP+  +
Sbjct: 1038 SIVKKKKKGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAI 1097

Query: 1237 SELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGL 1274
            S LQ ++ D +S ++NNP   L  LA LID  IPL GL
Sbjct: 1098 SYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGL 1135

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  118 bits (296), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 124/231 (53%), Gaps = 28/231 (12%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128
            WLP++I VQS  T    S      T+ LP  IAP TAV  P ++  I++GFK  LNY FL
Sbjct: 520  WLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAP-TAVTQPADSILISIGFKIELNYPFL 578

Query: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTK---DFSYKRRGTLLVSSFEFNNTTTLMPAQFH 1185
            +  S  +AQIF+FLP +L++PFE++ +    D S   +    V S E+ + +++    F 
Sbjct: 579  IKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSI----FS 634

Query: 1186 QETVTG-----ISKRSDSE---------------FPFNASAVDVIQIMPMIIKDRNYLTS 1225
             ET        +   SD E               +  + S++ V QI+P++I    Y+TS
Sbjct: 635  YETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITS 694

Query: 1226 IAVLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLID 1276
            +A   FP   V ELQ+ +++ TS ++ NPDP L  +AALID +IP+   ID
Sbjct: 695  LAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTID 745

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score =  119 bits (298), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 110/214 (51%), Gaps = 57/214 (26%)

Query: 1069 WLPSSIQVQSDPTRSGTSS-------FDPAVTATLPQLIAPPTAVPVPENASKITVGFKK 1121
            WLP+++ V+S  T +G ++            T TLPQ IA  T V  P+  + IT+GFKK
Sbjct: 902  WLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFKK 961

Query: 1122 NLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMP 1181
            +LNY F+VS   ++AQ+F +LP VL++PF                   ++ F++      
Sbjct: 962  SLNYPFVVSHPVSSAQLFSYLPNVLNYPF-------------------NYTFSD------ 996

Query: 1182 AQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQS 1241
                                     V V Q++P+    R+YL ++A +YFPS  V  LQ 
Sbjct: 997  -------------------------VQVYQLVPLKSSSRDYLITVAKVYFPSEQVEVLQK 1031

Query: 1242 MVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            ++S+  + L+ N +PT  +LA+LIDP+IPLTG+I
Sbjct: 1032 LISNTAANLYFNSNPTEKSLASLIDPTIPLTGII 1065

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score =  118 bits (296), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 134/305 (43%), Gaps = 68/305 (22%)

Query: 1069 WLPSSIQVQSDPTRSG--TSSFDPA----VTATLPQLIAPPTAVPVPENASKITVGFKKN 1122
            WLP+++   +  T S   T S DP      T TLPQ I  PT V  PE  + ITVGFKK 
Sbjct: 1224 WLPTAMITANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTLITVGFKKA 1283

Query: 1123 LNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPA 1182
            LNY F+V +  T+AQIF FLP  L+ PF+                     F N T     
Sbjct: 1284 LNYPFVVGNPVTSAQIFAFLPDTLNSPFDN-------------------AFTNIT----- 1319

Query: 1183 QFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSM 1242
                                      V ++ P+ +  R+YL ++A +YFPSA V  LQ +
Sbjct: 1320 --------------------------VARLGPLKVSSRDYLLTVAEVYFPSAQVENLQKL 1353

Query: 1243 VSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI--DGSTGSLNGGXXXXXXXXXXXXX-- 1298
            + +D S+ +     + + +A+L+D +IPLTGL+  DGST S  G                
Sbjct: 1354 IQNDASKFYFVNGTSRNVVASLVDATIPLTGLLQDDGSTTSETGSESGSPSNTGSSSNEG 1413

Query: 1299 XXXXXXXXXGSLGT--------ATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKH 1350
                     G+LGT        + +    S  K +L+  +  +V G L+++ + + +++ 
Sbjct: 1414 TDSSEQSSHGNLGTLGSSQYSSSASGFFKSGGKGKLIGLVVGVVCGALVYVAIMVIVFRF 1473

Query: 1351 LYGGR 1355
            +   R
Sbjct: 1474 VVKKR 1478

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score =  116 bits (290), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 146/335 (43%), Gaps = 77/335 (22%)

Query: 1068 FWLPSSIQVQSDPTRSGTSS-FDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            +W+P+ +  Q+  T S  SS      T TLPQ +A  T +P  E  S ITVGFKK LNYE
Sbjct: 822  WWIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNYE 881

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F+VS   ++AQIF +LP  L+ PF+                     F N           
Sbjct: 882  FVVSEPKSSAQIFGYLPAALNTPFKN-------------------VFTN----------- 911

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                                + V+QI+P+     NYL S+A +YFP+A V EL +++ + 
Sbjct: 912  --------------------ITVLQIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNT 951

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXXXXXXXXXXXX 1306
            +S  + +   T  ++AA++DPSIPLTGL+  S  + +G                      
Sbjct: 952  SSTFYTDGTGTAKSMAAMVDPSIPLTGLLRNSNSNSSGSSDGSSSSDSNSGSSNSGSTSN 1011

Query: 1307 --------------XGSL--GTATNSGLSSA--VKKRLVIYLTCLVFGTLLWILVFMFLY 1348
                           G+L   + +NS +S +   KK+++  +  L+ G  L+IL  +F +
Sbjct: 1012 SGDSSSSSADSYQDAGTLEYSSKSNSNVSGSGKSKKKIIGLVVGLIVGGCLYILFMIFAF 1071

Query: 1349 KHLYGGRVIAKRAYQRDAAQE--------EKQHYN 1375
            +++   R+ +++  +              EK H N
Sbjct: 1072 RYIARRRIKSQQIIKNPETSSVSSSEFGWEKHHNN 1106

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score =  114 bits (285), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 101/379 (26%), Positives = 155/379 (40%), Gaps = 95/379 (25%)

Query: 1068 FWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEF 1127
            +W+P+ + + +    +G++    A T TLPQ+I   T+VP PE  + IT+GFK+ LNYEF
Sbjct: 451  WWIPTQL-ITASTQVTGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYEF 509

Query: 1128 LVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQE 1187
            +VSS  ++AQIF FLP+VL+ PF++                    ++N T          
Sbjct: 510  IVSSPKSSAQIFSFLPYVLNTPFDD-------------------IYDNIT---------- 540

Query: 1188 TVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDT 1247
                                 V +++P+  KD  Y  ++A + FP + ++ L   + D  
Sbjct: 541  ---------------------VSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTN 579

Query: 1248 SQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXXX---------X 1298
            S L+   D  L +LA LIDPSIPLTGL+  +  +                          
Sbjct: 580  SSLYTKNDDALRSLALLIDPSIPLTGLVTSANSADTSSSSSSTDSSSSSSKGNSDHKSGS 639

Query: 1299 XXXXXXXXXGSLGTATNSGLSSA-------VKKRLVIYLTCLVFGTLLWILVFMFLYKHL 1351
                       +GT   SG SS+        KK LV  + C V G +L+I +  F+    
Sbjct: 640  TSEDDDSSSEDMGTLEYSGKSSSNPTGSIKNKKTLVPLVVCTVGGGILYICLMTFIV--- 696

Query: 1352 YGGRVIAKRAYQRDAAQE--------------EKQHYNFADITSV--------HSAETEP 1389
               R   +R  +R  A +              EK+  N   IT+         HS     
Sbjct: 697  ---RFFVRRHRERQVAIKFPDDSSSSSSEFNNEKKDTNRQSITASMKINMWMDHSESNNE 753

Query: 1390 ANDKSDDVPQEKDVASASQ 1408
                S DVP +K +   S+
Sbjct: 754  GGLYSSDVPAKKSMIKISK 772

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score =  115 bits (287), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 107/208 (51%), Gaps = 51/208 (24%)

Query: 1068 FWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEF 1127
            +W+P+ I  Q  P  + +S+   A TATLPQ IA  T    P+  S +T+GFK  LNY F
Sbjct: 1158 WWVPTKIITQPAPNTTASSTSSQA-TATLPQAIAAATQQVRPKGYSLLTIGFKSALNYNF 1216

Query: 1128 LVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQE 1187
            L+SS  ++AQIF FLP +L+ PF+                    +FNN            
Sbjct: 1217 LISSPLSSAQIFAFLPSILNDPFQN-------------------QFNN------------ 1245

Query: 1188 TVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDT 1247
                               V + QI+P+  +  +YL ++A +YFP+ ++S+L S+++++ 
Sbjct: 1246 -------------------VSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNA 1286

Query: 1248 SQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            S L+ +   +   LA LIDP+IPLTGL+
Sbjct: 1287 SSLYTDAHGSAKYLAELIDPTIPLTGLV 1314

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score =  114 bits (284), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 135/318 (42%), Gaps = 72/318 (22%)

Query: 1068 FWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEF 1127
            +W+ S +   S+   + T +     T +LPQ IA PT V  P++ S IT+GFKK LNYEF
Sbjct: 590  WWVASDLMTASEEASTTTRASATTATGSLPQAIAAPTEVTAPDDYSLITIGFKKALNYEF 649

Query: 1128 LVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQE 1187
            +V++  ++AQ+F +LP  L+ PF  +                   F N            
Sbjct: 650  VVNTPESSAQLFSYLPIALNTPFNNS-------------------FTN------------ 678

Query: 1188 TVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDT 1247
                               + V QI+P++    NY  ++A +YFP   ++ LQ M+ D++
Sbjct: 679  -------------------ISVYQIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNS 719

Query: 1248 SQLFNNPDPTLDALAALIDPSIPLTGLI------------DGSTGSLNGGXXXXXXXXXX 1295
            S LF         L +LIDPSIPL GL+              S  + N G          
Sbjct: 720  SALFTENVGAPKTLVSLIDPSIPLVGLLSSTTSNSSTSATGSSASTTNSGQVNSGSNSDS 779

Query: 1296 XXXXXXXXXXXX--GSLGTATNSGLSSAVK----KRLVIYLTCLVFGTLLWILVFMFLYK 1349
                          GSL  +  S  ++A K    ++L+I + C+V G LL    F+ L  
Sbjct: 780  DSSSGKGSVSSNDIGSLDYSEKSTSAAAGKTTSNRKLIILIVCVVIGGLL----FITLTA 835

Query: 1350 HLYGGRVIAKRAYQRDAA 1367
            ++   R+   +  +R AA
Sbjct: 836  YILHVRITVFKDQKRKAA 853

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score =  110 bits (275), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 110/219 (50%), Gaps = 56/219 (25%)

Query: 1062 VGGRTTFWLPSSIQVQS---DPTRSGT--SSFDPAVTATLPQLIAPPTAVPVPENASKIT 1116
            V   T+ WLP+++   S   + T+SG+  S+     T TLPQ I  PT V  PE  + IT
Sbjct: 1172 VPTSTSNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLIT 1231

Query: 1117 VGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNT 1176
            +GFK+ LNY F+V+++ T+AQIF +LP  L+FPF++    D +  R G L VS       
Sbjct: 1232 IGFKQALNYPFVVTNAVTSAQIFAYLPETLNFPFDD-AFSDITVARLGPLKVS------- 1283

Query: 1177 TTLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYV 1236
                                                      +R+YL +IA +YFPSA V
Sbjct: 1284 ------------------------------------------NRDYLLTIAEVYFPSAQV 1301

Query: 1237 SELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
              LQ+++ +D S+ +   + T + LAA +D +IPLTGL+
Sbjct: 1302 ENLQTLIQNDESKFYAK-NATKNLLAAFVDATIPLTGLV 1339

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score =  109 bits (273), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 104/209 (49%), Gaps = 51/209 (24%)

Query: 1068 FWLPSSIQVQS-DPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            +W+P+ +  Q+ +   + +S+     T TLP  IA  T VP PE  + IT+GFKK LNYE
Sbjct: 960  WWIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYE 1019

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F+VS   ++AQIF +LP  L+ PF+                     F N T         
Sbjct: 1020 FVVSEPKSSAQIFGYLPEALNTPFKN-------------------VFTNIT--------- 1051

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                                  V+QI+P+     NYL S+A +YFP+A + EL +++++ 
Sbjct: 1052 ----------------------VLQIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNS 1089

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            +S  + +   T  ++AA++D SIPLTGL+
Sbjct: 1090 SSAFYTDGMGTAKSMAAMVDSSIPLTGLL 1118

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score =  108 bits (269), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 140/320 (43%), Gaps = 59/320 (18%)

Query: 1068 FWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEF 1127
            +W+P+S+  +SD T S  ++   + T ++P  IA  T    PE  S +T+GFK+ LNY+F
Sbjct: 642  WWVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQF 701

Query: 1128 LVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQE 1187
            ++SSS T AQIF FLP  L  PFEE                                   
Sbjct: 702  VLSSSVTVAQIFAFLPGGLIAPFEE----------------------------------- 726

Query: 1188 TVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDT 1247
                             + V V ++ P+   + NY  ++A +YFP++ + EL + V+D  
Sbjct: 727  ---------------QLANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSE 771

Query: 1248 SQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXXXXXXXXXXXXX 1307
            S L+ N   T + L +LIDP IP+TGL++  + S +                        
Sbjct: 772  SALYVNASGTEEELVSLIDPRIPITGLLNSLSSSSSSSSSSSSNDESSSDGNSSSNSNNY 831

Query: 1308 GSLGT-ATNSG--LSSAVKKRLVIYLTCLVFGTLLWI-----LVFMFLYKHLYGGRVIAK 1359
            G+L + + N G   +S  K +L I++  +V    L+I     LV  F+ +H     ++  
Sbjct: 832  GTLDSYSKNVGNTTTSKGKAKLTIFIIGIVAAGSLYIAVMILLVRFFIIRHRRKADIL-N 890

Query: 1360 RAYQRDAAQEEKQHYNFADI 1379
             +     +  E  H N+ D+
Sbjct: 891  DSDSSSISSSENGHVNYKDL 910

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score =  105 bits (263), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 136/299 (45%), Gaps = 70/299 (23%)

Query: 1066 TTFWLPSSIQVQSD----PTRS-------GTSSFDPAVTATLPQLIAPPTAVPVPE-NAS 1113
            T+ WLP++I  +SD    PT +        T+S       TLP+ I+      +PE N +
Sbjct: 773  TSTWLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGK-IPEGNYT 831

Query: 1114 KITVGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEF 1173
             ITVGFK+ LNY F+VS+  ++AQIF FLP VL++P+                       
Sbjct: 832  LITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPYG---------------------- 869

Query: 1174 NNTTTLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPS 1233
                                        F  + V V +++P+    R+YL ++A ++FP+
Sbjct: 870  ----------------------------FRCANVSVWRLLPLKSGSRDYLVTVAAVFFPT 901

Query: 1234 AYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI-----DGSTGSLNGGXXX 1288
             ++ EL  +V+D+TS L+++ D T   +A+LIDP IPLTG+I     D ++G  +     
Sbjct: 902  EHLDELARLVADNTSSLYSSYDETGKTMASLIDPMIPLTGIINSISSDPASGESSATGTN 961

Query: 1289 XXXXXXXXXXXXXXXXXXXGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFL 1347
                               G LG A +  L S+   +L I  T +V G++  +  ++ L
Sbjct: 962  TPKSGSVPVGFAGTLANGGGRLGNAGSKSLDSSPMSKLKI--TGIVVGSVCGVATYIAL 1018

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score =  103 bits (257), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 102/209 (48%), Gaps = 51/209 (24%)

Query: 1068 FWLPSSIQVQSDPTRSGTSSFDPAV-TATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            +W+P+ +  Q+    S  SS      T TLP  IA  T +P  E  S ITVGFK+ LNYE
Sbjct: 841  WWIPTELITQAPEAASTASSTASGTQTMTLPHAIAAATQIPASEGYSLITVGFKRALNYE 900

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F+VS   ++AQIF +LP  L+ PF+                     F N           
Sbjct: 901  FVVSEPKSSAQIFGYLPEALNTPFKN-------------------VFTN----------- 930

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                                + V+QI+P+     +YL S+A +YFP+A + EL +++++ 
Sbjct: 931  --------------------ISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNT 970

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            +S  + +   T  ++AA++DPSIPLTGL+
Sbjct: 971  SSTFYTSGTGTAKSMAAMVDPSIPLTGLL 999

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score =  102 bits (255), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 99/221 (44%), Gaps = 70/221 (31%)

Query: 1069 WLPSSI---------------QVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENAS 1113
            WLP+ I                 QS P  + T +       TLPQ+IA P  V   ++ +
Sbjct: 757  WLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQ-----TLPQVIAAPDRVTPKKDYT 811

Query: 1114 KITVGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEF 1173
             IT+GFKK LNY F+  +    AQIF +LP +L++PF                    FE+
Sbjct: 812  LITIGFKKQLNYPFIAMNPFANAQIFDYLPGILNYPFN-------------------FEY 852

Query: 1174 NNTTTLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPS 1233
             +                               + VIQ++P+    ++Y+ +IA +YFPS
Sbjct: 853  AD-------------------------------ISVIQLVPLKANSKDYIATIAQVYFPS 881

Query: 1234 AYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGL 1274
              V EL  +V D  S+L+++ D  +   A+LIDP +PLTGL
Sbjct: 882  EKVDELAKLVVDTNSELYSSYDANMKVFASLIDPQLPLTGL 922

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 102/210 (48%), Gaps = 50/210 (23%)

Query: 1068 FWLPSSIQVQSDPTRSGTSSFDPAVTATL-PQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            +W+P+ I  +SD T++  SS     T  + P+ IA PT +PVP   + IT+GFK+ LNY+
Sbjct: 487  WWVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNYD 546

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F++ +  ++AQIF FLP  L  PF                                QF  
Sbjct: 547  FVLDNPVSSAQIFAFLPEALDLPF--------------------------------QFA- 573

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                            N S+V +++++P  + + NY   +A +YFPS  + EL S++ D 
Sbjct: 574  ----------------NDSSVSILKLVPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDS 617

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLID 1276
             S L+     +  AL  LID +IPLTGL++
Sbjct: 618  DSPLYTLNTGSRLALVNLIDQNIPLTGLVN 647

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score =  102 bits (253), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 104/213 (48%), Gaps = 54/213 (25%)

Query: 1068 FWLPSSIQVQ-SDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            +W+P+ I  Q S  T SGT       TATLPQ IA  T V  P+  + IT+GFK+ LNY 
Sbjct: 795  WWVPTQIVTQTSQTTSSGTVG---QATATLPQAIAAATQVARPDGYTLITLGFKRALNYN 851

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F+VS+  ++AQIF FLP +L  PFE       SY+                         
Sbjct: 852  FVVSNPISSAQIFAFLPEMLRTPFEN------SYEN------------------------ 881

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                                + V Q++P+  K  +YL ++A +YFP++ +S L  ++S+ 
Sbjct: 882  --------------------ITVQQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNT 921

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLIDGST 1279
            +S L+ + +     LA LID SIPLTGL+   T
Sbjct: 922  SSNLYTDVEGPAKYLAYLIDASIPLTGLLGSDT 954

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score =  101 bits (252), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 153/352 (43%), Gaps = 81/352 (23%)

Query: 1069 WLPSSIQVQSDPTRS---GTSSFDPAVTATLPQLI-APPTAVPVPENASKITVGFKKNLN 1124
            W+P+S+ +    T S    T S D    ++LP++I     +  VPE  S IT+GFKK LN
Sbjct: 591  WIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPLN 650

Query: 1125 YEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQF 1184
            Y F+VS S ++AQI ++LP +L+  FE                 S F             
Sbjct: 651  YPFVVSESKSSAQIMYYLPKLLNANFE-----------------SIF------------- 680

Query: 1185 HQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVS 1244
                                S +  +Q+MP+ I+D  YL+++A+L+FP++ +  L +MV 
Sbjct: 681  --------------------SDIKTVQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVK 720

Query: 1245 DDTSQLFNNPDPTL-DALAALIDPSIPLTGLIDGSTGSLNGGXXXXXXXXXXXXXXXXXX 1303
            + +S L++    T+  +L+ALIDP IP+TGL D  T +                      
Sbjct: 721  NTSSSLYSTQYETITQSLSALIDPRIPVTGLTDTKTNNAGSSSSSSSNSNGRSSNSNQDT 780

Query: 1304 XXX-------XGSL------GTATNSGLSSAVKKRLV-IYLTCLVFGTLLWILVFMFLYK 1349
                       GSL       +A++ G  S  KKR++ I +  +  G  + I++F+F   
Sbjct: 781  EHSSSFGNINSGSLDYIPSSKSASSDGTQSKTKKRIIPIIVGTIAGGMAVIIMLFLFFRY 840

Query: 1350 HLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDK----SDDV 1397
            H        KR  Q +  QE     NF   +S      E  N++    SDDV
Sbjct: 841  HA------MKRREQLN--QERLARLNFERASSCSDDSIERYNNEKQQYSDDV 884

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 148/349 (42%), Gaps = 64/349 (18%)

Query: 1059 SSSVGGRTTFWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVG 1118
            SS++  ++ +W+P+S+ V S    + TS+     T  +PQ I      P PEN S IT+G
Sbjct: 1488 SSTITRQSNWWIPTSLAVASTMNSTDTSTLP---TQAIPQAIGSVEQPPAPENHSLITIG 1544

Query: 1119 FKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTT 1178
            FKK LNYEF+VS   + AQI ++LP                       LV++F F N   
Sbjct: 1545 FKKELNYEFVVSHPMSGAQIINYLP---------------------NTLVNAF-FGN--- 1579

Query: 1179 LMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSE 1238
                      VT IS   ++  P+N +  D             YL +IA +YFP+  +  
Sbjct: 1580 ----------VTNISV--NNLVPYNDTKSD-------------YLITIATVYFPTDEIKH 1614

Query: 1239 LQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGL-IDGSTGSLNGGXXXXXXXXXXXX 1297
            L+ ++ D +S  +         LA L+DPSIPLTGL + G++   N              
Sbjct: 1615 LRELIHDKSSSFYTASQDVARQLANLVDPSIPLTGLNLFGNSDDTNNNNPYSPDNSNSEG 1674

Query: 1298 XXXXXXXXXXGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVI 1357
                             NSG +   K ++   +  +V G    I + +F   H    R  
Sbjct: 1675 IGTLDVSPINKVSVLKNNSG-ALNTKGKVTGLIIGVVIGGCCLIALSIFSIGHFIMKRHN 1733

Query: 1358 AKRAYQRDAAQEEKQHYNF---ADITSVHSAETEPANDKSD--DVPQEK 1401
            A    + +       H+NF   ++I+++HS  TE  + +S   D P E+
Sbjct: 1734 ANVTEETNIV----DHFNFTKKSNISTLHSNLTEKFSRRSHNFDDPNER 1778

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 109/220 (49%), Gaps = 53/220 (24%)

Query: 1068 FWLPSSIQVQSDPTRSGT---SSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLN 1124
            +W+P+ +  ++    + +   S+  P+ T  +PQ+I  P  V V E  + IT+GFKK L+
Sbjct: 645  WWIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLH 704

Query: 1125 YEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQF 1184
            YEF+V+   ++AQI  FLP +L+ P+             G +      F+N         
Sbjct: 705  YEFVVTQPKSSAQIISFLPNLLNQPY-------------GNI------FSN--------- 736

Query: 1185 HQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVS 1244
                                  + V+Q++P+     +Y  ++A +YFP+A ++ L  +V 
Sbjct: 737  ----------------------ISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVK 774

Query: 1245 DDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNG 1284
            D +S L+     +L  LA +IDPSIP+TGL+  +T +++G
Sbjct: 775  DTSSILYTEVSESLKTLADMIDPSIPITGLVKNATQTVDG 814

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 99.8 bits (247), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 107/209 (51%), Gaps = 50/209 (23%)

Query: 1069 WLPSSI--QVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            WLP+++  + ++  T+S +++     T TLPQ I   T +  P   + ITVGFKK LNY 
Sbjct: 535  WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYP 594

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F V++  + AQIF FLP VL++PF  NG +               +F+NT+         
Sbjct: 595  FTVNNPVSNAQIFEFLPKVLNYPF--NGAQ---------------KFDNTS--------- 628

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                                  V++++P+ +   +YL ++A +YFP   VS LQ+ + + 
Sbjct: 629  ----------------------VLELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNS 666

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            +S ++NN    L  L++ ID SIPLTGL+
Sbjct: 667  SSVIYNNDVTALKQLSSYIDASIPLTGLV 695

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 97.8 bits (242), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 104/213 (48%), Gaps = 53/213 (24%)

Query: 1066 TTFWLPSSIQVQSD-PTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLN 1124
            T +W+P+ +  QS+ P+ S +       T TLPQ+IA  T +P PE  S IT+GFKK LN
Sbjct: 603  TNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIPEPEGYSLITIGFKKPLN 662

Query: 1125 YEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQF 1184
            YEF+V++  ++AQIF FLP VL+ PF  N T                 FNN T       
Sbjct: 663  YEFIVANPKSSAQIFSFLPDVLNAPF--NNT-----------------FNNIT------- 696

Query: 1185 HQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVS 1244
                                    V+Q++P+     NYL ++A +YFP+  +  L S++ 
Sbjct: 697  ------------------------VLQLVPLQNPSLNYLVTVAKVYFPTDMIDTLSSLIE 732

Query: 1245 DDT--SQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            D T  S ++        +LA LI   IPLTGL+
Sbjct: 733  DYTTPSLIYTINQGAKGSLANLISSDIPLTGLL 765

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 51/209 (24%)

Query: 1068 FWLPSSIQVQ-SDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126
            +W+P+ +  Q ++   S +++     T TLP  IA  T +  P+  S IT+GFKK LNYE
Sbjct: 789  WWIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYE 848

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQ 1186
            F+VS   ++AQIF +LP  L+ PF     KD               F N           
Sbjct: 849  FVVSEPKSSAQIFAYLPEALNTPF-----KDV--------------FTN----------- 878

Query: 1187 ETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDD 1246
                                + V+QI+P+     +YL S+A +YFP+A +  L S++++ 
Sbjct: 879  --------------------ISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNT 918

Query: 1247 TSQLFNNPDPTLDALAALIDPSIPLTGLI 1275
            +S  + +   T  ++AA++D SIPLTGL+
Sbjct: 919  SSSFYTDGMGTAKSMAAMVDASIPLTGLL 947

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (52%), Gaps = 14/123 (11%)

Query: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPT--AVPVPENASKITVGFKKNLNYE 1126
            WLPS++ V+++P+ S    F+P+ T   P+ I P      P P ++  I V   + LNY 
Sbjct: 1556 WLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRPLNYP 1615

Query: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDF------SYKRRGTLLVSSFEFNN-TTTL 1179
            FL+ +  ++AQ+ +++PF+LS+        DF      SY   GT    S E N+ TTTL
Sbjct: 1616 FLIENLVSSAQVMNYIPFILSYSL-----IDFSPAAPSSYSLSGTAYDISSEINSGTTTL 1670

Query: 1180 MPA 1182
             P 
Sbjct: 1671 SPV 1673

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 115/284 (40%), Gaps = 54/284 (19%)

Query: 1192 ISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSDDTSQLF 1251
            I+  S S +P     ++V QI+P++I+DR+Y  +   +Y P+  V +LQ+ + D  S L+
Sbjct: 1762 ITPTSSSLYPSLYPGIEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILY 1821

Query: 1252 NNPDPTLDALAALIDPSIPLTG------LIDGSTGSLN-----------GGXXXXXXXXX 1294
            +NP      L+  ID SIP+ G        DG+    N            G         
Sbjct: 1822 HNPVYIARELSNFIDSSIPIVGSGKYWTAYDGNPNEENELNTSSNSEDTNGSDVEPNSDD 1881

Query: 1295 XXXXXXXXXXXXXGSLGTATNSGLSSAVK-KRLVIYLTCLVFG------TLLWILVFM-F 1346
                         G+L T T     + ++  +  IY+  ++FG      ++L+ + FM F
Sbjct: 1882 ASQNTNSLVYQDMGTLDTGTILSKKTTLETSKAWIYIVAMIFGFISLLFSILFSMTFMKF 1941

Query: 1347 LYKHLYGGRVI---AKRAYQRDA---AQEEKQHYNFADITSVHSAETEPANDKSDDVPQE 1400
             Y+  +  ++I    K    +DA   A    ++ N   I  VH+    P  +K +  P  
Sbjct: 1942 SYQFEFITKIIRPTEKIWPTKDASIGASHALKNKNILPI--VHT----PIMEKGEIFPSP 1995

Query: 1401 KDVASASQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYY 1444
                              I     VY  + GL Y V ++G++YY
Sbjct: 1996 S-----------------INDCEIVYDNNNGLAYTVDKEGNYYY 2022

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
            similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 1516 ITSSNSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGMGQE----GNPDF 1571
            +++  S ++  +   ++Y +T+   +NE+++ +YL++D   EI +  +G      GNP  
Sbjct: 199  LSTGASVSLFCFTGFSIYLLTKNQTTNELNASKYLNRDL--EIFNESLGHSPQSVGNPFD 256

Query: 1572 LSSTEQNWHI 1581
            L S  QNW +
Sbjct: 257  LGSRYQNWCV 266

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score = 34.3 bits (77), Expect = 2.5,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 1099 LIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDF 1158
            L A    + +P    K+ V   K+ + E L   + T   ++HF+      PF +   KDF
Sbjct: 216  LRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDF 275

Query: 1159 S---YKRRGTLLVSSFEFNNTTTLMPAQFHQETVTGISKRSDSEFPFNASAV---DVIQI 1212
            +   Y  +G +L++   F   T +       E++ G     DSEF      +    V+Q 
Sbjct: 276  NVFLYVIKGAVLINEKIFKENTAIF-FDVDGESIEGQFATDDSEFVLVGGEILNQPVVQQ 334

Query: 1213 MPMIIKDRNYLTSI 1226
             P +  D+  L  +
Sbjct: 335  GPFVETDKQKLMQV 348

>Kpol_163.1 s163 (208..1008) [801 bp, 266 aa] {ON} (208..1008) [801
            nt, 267 aa]
          Length = 266

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 14/75 (18%)

Query: 1424 TVYSVSQGLQYFVAEDGSFYYAGPLQSTSEENETTKG----DSADIEDINDYLYSADQER 1479
            TVYS    + + +   G++YY G   + +E N   K      S D+ +I  YLYS     
Sbjct: 53   TVYSKEHEMTFIIDHQGNYYYGGSQDTVNEVNFMVKTVSTVKSDDLSNIEKYLYS----- 107

Query: 1480 SIVTNEQSSCDIGSL 1494
                 E+SS D  S+
Sbjct: 108  -----EKSSSDTASI 117

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.122    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 123,987,031
Number of extensions: 4731182
Number of successful extensions: 38695
Number of sequences better than 10.0: 632
Number of HSP's gapped: 35794
Number of HSP's successfully gapped: 2209
Length of query: 1696
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1572
Effective length of database: 39,262,815
Effective search space: 61721145180
Effective search space used: 61721145180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)