Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A034105.477ON83783741700.0
ZYRO0D11308g5.477ON86880328080.0
Suva_8.1925.477ON87976025950.0
Skud_15.3045.477ON88376225760.0
Smik_15.3205.477ON87376025600.0
YOR141C (ARP8)5.477ON88176225460.0
Kpol_543.105.477ON87676424120.0
NCAS0H022905.477ON86378523510.0
TBLA0A025305.477ON85475422980.0
CAGL0I07161g5.477ON83777121620.0
TPHA0J027905.477ON88275321590.0
KAFR0E025305.477ON84282221350.0
SAKL0G03608g5.477ON79474621040.0
Kwal_55.212505.477ON77575319980.0
KNAG0B040205.477ON93480120050.0
NDAI0C013705.477ON97466619800.0
KLTH0F14960g5.477ON77575419370.0
AFR135W5.477ON79175819100.0
Ecym_23115.477ON77576918990.0
KLLA0E03213g5.477ON78878917460.0
Kpol_181.22.593ON4632351128e-05
Ecym_23062.593ON407991092e-04
CAGL0K05335g7.448ON529921074e-04
TDEL0B068602.593ON461971065e-04
ZYRO0F01122g2.593ON4621161065e-04
ABR084W2.593ON4641151057e-04
TDEL0C031207.448ON438711048e-04
NDAI0A013007.448ON565921040.001
TBLA0H028002.593ON4841431030.001
Kpol_520.117.448ON4881311010.002
NCAS0B071302.117ON381162980.004
Suva_13.2022.593ON467141980.004
NCAS0A147207.448ON48592970.006
TBLA0B010702.117ON383187940.012
Suva_15.3262.117ON384162910.031
KNAG0H036502.117ON38781900.032
ZYRO0F02772g8.23ON375214900.040
Suva_16.3647.448ON48079880.064
Skud_13.1892.593ON467101880.067
Smik_13.2032.593ON467164880.068
YMR033W (ARP9)2.593ON46799870.078
YPR034W (ARP7)7.448ON47779870.080
NCAS0C037008.23ON375214850.13
TDEL0B048102.117ON373174850.13
Smik_16.2787.448ON47671850.15
KAFR0K021507.448ON49095850.16
ACR184C7.448ON40184840.17
NDAI0C005802.593ON50195840.23
Skud_8.1902.117ON38472820.29
Skud_16.3217.448ON47979820.39
Smik_8.2102.117ON38472810.47
ZYRO0G05676g2.117ON38184810.48
CAGL0H09042g2.117ON387240800.60
ZYRO0G17182g7.448ON465151800.62
YHR129C (ARP1)2.117ON38472790.74
SAKL0F13772g7.448ON42284790.87
KAFR0I015802.593ON45999780.96
KAFR0E043804.368ON41273781.0
NDAI0B044602.117ON38173781.1
KLTH0C05324g7.448ON39984781.1
KAFR0L010807.266ON62657771.4
TDEL0D015501.287ON48074761.7
KAFR0F005902.117ON386100752.0
TPHA0I013002.117ON37972752.2
KLLA0C12507g2.593ON45472752.2
TPHA0N014302.593ON472116752.3
CAGL0F05907g2.593ON46284733.7
NCAS0H030602.593ON472174733.9
TDEL0F045608.331ON238249744.1
TBLA0F004507.448ON48298716.8
NCAS0C035703.163ON8761087010.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03410
         (837 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...  1610   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...  1086   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...  1004   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   996   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   990   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   985   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   933   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   910   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   889   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   837   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   836   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   827   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   815   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   774   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   776   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   767   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   750   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   740   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   736   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   677   0.0  
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    48   8e-05
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    47   2e-04
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    46   4e-04
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    45   5e-04
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    45   5e-04
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    45   7e-04
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    45   8e-04
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    45   0.001
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    44   0.001
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    44   0.002
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    42   0.004
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    42   0.004
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    42   0.006
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    41   0.012
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    40   0.031
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    39   0.032
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    39   0.040
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    39   0.064
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    39   0.067
Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 ...    39   0.068
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    38   0.078
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    38   0.080
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    37   0.13 
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    37   0.13 
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    37   0.15 
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    37   0.16 
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    37   0.17 
NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {O...    37   0.23 
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    36   0.29 
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    36   0.39 
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    36   0.47 
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    36   0.48 
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    35   0.60 
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    35   0.62 
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    35   0.74 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    35   0.87 
KAFR0I01580 Chr9 complement(332644..334023) [1380 bp, 459 aa] {O...    35   0.96 
KAFR0E04380 Chr5 complement(878026..879264) [1239 bp, 412 aa] {O...    35   1.0  
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    35   1.1  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    35   1.1  
KAFR0L01080 Chr12 complement(202561..204441) [1881 bp, 626 aa] {...    34   1.4  
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    34   1.7  
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    33   2.0  
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    33   2.2  
KLLA0C12507g Chr3 complement(1063093..1064427,1064541..1064570) ...    33   2.2  
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    33   2.3  
CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} simila...    33   3.7  
NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.5...    33   3.9  
TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8....    33   4.1  
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    32   6.8  
NCAS0C03570 Chr3 complement(712859..715489) [2631 bp, 876 aa] {O...    32   10.0 

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score = 1610 bits (4170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/837 (94%), Positives = 787/837 (94%)

Query: 1   MSQDTSEKSVVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVKXXXXXXXXXNNLHAAE 60
           MSQDTSEKSVVY                             SVK         NNLHAAE
Sbjct: 1   MSQDTSEKSVVYEEPIDIPLEEDDDEDEEDDEVEEHDQEHDSVKEEDDEEDDENNLHAAE 60

Query: 61  ISRSATATPIGQRNHVXXXXXXXXXXXXAKSQERAKKHPRLDPAKAPPGKKVPLHLLEKR 120
           ISRSATATPIGQRNHV            AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKR
Sbjct: 61  ISRSATATPIGQRNHVEDEEDEDYNDEDAKSQERAKKHPRLDPAKAPPGKKVPLHLLEKR 120

Query: 121 RLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALR 180
           RLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALR
Sbjct: 121 RLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALR 180

Query: 181 ERKTLRNNTQTSSINNTPDVIDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLR 240
           ERKTLRNNTQTSSINNTPDVIDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLR
Sbjct: 181 ERKTLRNNTQTSSINNTPDVIDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLR 240

Query: 241 IGFAKDEVPLVVPSCVAIPKTELNDEFQEAPLKREQPEEFEELKSTIQHSFRERMRYYKR 300
           IGFAKDEVPLVVPSCVAIPKTELNDEFQEAPLKREQPEEFEELKSTIQHSFRERMRYYKR
Sbjct: 241 IGFAKDEVPLVVPSCVAIPKTELNDEFQEAPLKREQPEEFEELKSTIQHSFRERMRYYKR 300

Query: 301 KVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPF 360
           KVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPF
Sbjct: 301 KVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPF 360

Query: 361 TKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSH 420
           TKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSH
Sbjct: 361 TKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSH 420

Query: 421 VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480
           VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS
Sbjct: 421 VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480

Query: 481 LVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLY 540
           LVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLY
Sbjct: 481 LVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLY 540

Query: 541 NFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRD 600
           NFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRD
Sbjct: 541 NFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRD 600

Query: 601 IFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNY 660
           IFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNY
Sbjct: 601 IFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNY 660

Query: 661 TPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSL 720
           TPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSL
Sbjct: 661 TPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSL 720

Query: 721 TSFPNFYKKLAKQAKDIKTAGKTGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHL 780
           TSFPNFYKKLAKQAKDIKTAGKTGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHL
Sbjct: 721 TSFPNFYKKLAKQAKDIKTAGKTGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHL 780

Query: 781 LPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           LPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY
Sbjct: 781 LPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/803 (65%), Positives = 630/803 (78%), Gaps = 26/803 (3%)

Query: 59  AEISRSATATPIGQRNHVXXXXXXXXXXXXAK-----------SQERAKKHPRLDPAKAP 107
           A  SRS T+TP+G  N                           SQ + KK+P+LDPAKAP
Sbjct: 68  ANASRSGTSTPLGNANTAAGDDDEMDDDELDDDDGDENNKKRDSQGKFKKYPKLDPAKAP 127

Query: 108 PGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSS 167
           PGKKVPLHLLEKRRLGRIKAAEEFA+KLK+IGIEK+E+ TLP TGLFQP++LINQKNYSS
Sbjct: 128 PGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQKNYSS 187

Query: 168 DYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTN---TEVPDYIAAADEDIDLS 224
           DYLKKDEQ+FALR+RK LRNNTQ  S+ NTPDV D+K  N   TE+ +  AA DEDIDLS
Sbjct: 188 DYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNE--AAGDEDIDLS 245

Query: 225 DANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELN-----DEFQEAPLKREQPEE 279
           DANTTLVIHPGS  L++GFAKDE P V+PSCVAIPK+EL+     D+  +    R+QP E
Sbjct: 246 DANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYTRDQPTE 305

Query: 280 FEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSK 339
           FEE+K+ +QHSFRERMR+YKRKV  NAHEQV+++NK SKP++IED+ND   INWI    +
Sbjct: 306 FEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINWITTPDR 365

Query: 340 RYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLE 399
           RYYG++AL+CSK+ F IR P  KGGSFN++SPDY SLQDL+ D   LLEH L +    L+
Sbjct: 366 RYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSPRFQLK 425

Query: 400 RAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVV 459
           R+QF+QYKVVLVIPDLF KSHVET IR L+TEMQFQAVAI+QESLA CYGAG S+STCVV
Sbjct: 426 RSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVV 485

Query: 460 NIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWIL 519
           NIGAT T IAC+DEGTVL++S ++LDYG DD+TKLFALFLLQSEFPYQDWDI ++HGW L
Sbjct: 486 NIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETAHGWHL 545

Query: 520 AEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIISYLH 579
           AEELKK YTTFQDANV VQLYNFIKR+P QQ+E+++FKVFDEV LAPL+LFYP I++ L 
Sbjct: 546 AEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPLSLFYPGIVAQLR 605

Query: 580 SKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDL 639
           ++    S N  +ES+LP SRDIFT+ ++DWRSLSQ+ECLD  LY GN +   ++ KLLD 
Sbjct: 606 NELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLCKLLDA 665

Query: 640 QTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKI 699
            +  D+ Q++  +E D R+NY PLEKAI+QSITNA    DV+KMSSFYSNILV GGGS +
Sbjct: 666 PSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCGGGSNV 725

Query: 700 PALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGES-----EEEDQSSK 754
           PA DFILTDRINIWRPR+LS TSFP+ YKKL+KQ KDIK + K GE      +E++Q  +
Sbjct: 726 PAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKE 785

Query: 755 KINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEEL 814
           K+ E+I  EL+ Y + IE+QN ++H LPV+VLPPPRD+D A L WKGA VLAQIKLVEEL
Sbjct: 786 KVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEEL 845

Query: 815 YLTSTDWDIHGSRILQYKCLFTY 837
           YLT  DWDIHGSRILQYKC+FTY
Sbjct: 846 YLTGADWDIHGSRILQYKCIFTY 868

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/760 (65%), Positives = 605/760 (79%), Gaps = 17/760 (2%)

Query: 89  AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148
           A++ +R KK+P+LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEK+E+TTL
Sbjct: 126 AQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTL 185

Query: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNN--TQTSSINNTPDVIDIKNT 206
           PATGLFQP+LLINQKNYSSDYLKKD+QIFALR+RK LRNN  TQ SS  NTPDV+D+K+ 
Sbjct: 186 PATGLFQPLLLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSS-TNTPDVVDMKSL 244

Query: 207 NTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELN-- 264
               P   A  +++IDL+D   T+VIHPGS  ++IGF KDE P+VVP+CVA+PK  LN  
Sbjct: 245 PNSEPS-TAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPKKWLNLA 303

Query: 265 DEFQEA--PLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMI 322
           ++  E    L+R+Q EEFE +KS ++ +FRERMRYYKRKVP NAHEQVVS+N++SKP+++
Sbjct: 304 NDQNEGNISLQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNESSKPEVV 363

Query: 323 EDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLIND 382
             +NDP  I WI   SK YYGS+AL+C  E F IR PF KGG FN+ SP Y SL +LI+D
Sbjct: 364 SVKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-KGGCFNIDSPYYKSLAELISD 422

Query: 383 VISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQE 442
           VI LLE+AL +E LN++  +F+QYKVVLVIPD+F KSHVETFIR LLTE+QFQAVAIIQE
Sbjct: 423 VIKLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTELQFQAVAIIQE 482

Query: 443 SLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQS 502
           SLA CYGAG S+STCVVNIGAT T IAC+DEGTVLENS V+LDYGGDD+T+LFAL LLQS
Sbjct: 483 SLATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDITRLFALLLLQS 542

Query: 503 EFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEV 562
           +FP QDW INS HGW+LAE+LKK +TTFQDA++AVQLYNFI R P++ +E+YEFK+FDEV
Sbjct: 543 DFPLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKPTEKYEFKLFDEV 602

Query: 563 SLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDL 622
            LAPLALF+P+I   + + S +   NS++E QLP SRD+FTN +NDW SLSQ E  +GDL
Sbjct: 603 MLAPLALFFPQIFKLIRAPSGK---NSSLEFQLPESRDLFTNELNDWNSLSQFESKEGDL 659

Query: 623 YSGNNNNQLIMSKLLDLQTSFDDFQSKP-PMEADSRKNYTPLEKAIIQSITNASTPIDVA 681
           Y   N++  I++K LD  T  D  Q KP    + S++N TPLEKAIIQSITNAS   DV 
Sbjct: 660 YCNLNDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENLTPLEKAIIQSITNASVTADVT 719

Query: 682 KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIK--- 738
           +MSSFYSNIL+VGG SKIPALDFILTDRINIWRP LLS TSFP FYKKL K+ KD++   
Sbjct: 720 RMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDLESHF 779

Query: 739 -TAGKTGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAEL 797
            +A +  E E +     +INE + AEL     SIE QNG+EHL P++++PPPRDM+ A +
Sbjct: 780 VSAPEKTEEENKQVLQLQINEKVVAELDEQHQSIEHQNGNEHLFPISIIPPPRDMNPALI 839

Query: 798 AWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
            WKGA VLAQIKLVEEL++T+ DWD+HGSRILQYKC+FTY
Sbjct: 840 IWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/762 (64%), Positives = 607/762 (79%), Gaps = 21/762 (2%)

Query: 89  AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148
            ++ +R KK+P+LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEK+E+TTL
Sbjct: 130 VQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTL 189

Query: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNN--TQTSSINNTPDVIDIKNT 206
           PATGLFQP++LINQKNYSSDYLKKD+QIFALR+RK LRNN  TQ SS  NTPDV+D+KN 
Sbjct: 190 PATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSS-TNTPDVVDLKNL 248

Query: 207 NTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDE 266
           +   P   A  +++IDL+D   T+VIHPGS  ++IGF KDE P++VP+CVA+PK  LN  
Sbjct: 249 SHTEPS-TAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPNCVAVPKKWLN-- 305

Query: 267 FQEAP------LKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQ 320
               P      L+REQ +EFE +KS ++ +FRERMRYYKRKVP NAHEQVVS+N+NSKP+
Sbjct: 306 LGNGPNEDNISLQREQSDEFENIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPE 365

Query: 321 MIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLI 380
           +I ++NDP  I WI   SK YYGS+AL+C  E F +R PF +GGSFN++SP Y SL +LI
Sbjct: 366 IISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVVRKPF-QGGSFNINSPYYESLAELI 424

Query: 381 NDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAII 440
           +DV  LLE+AL++E LN++  +F+QYKVVLVIPD+F K+HVETFIR LLTE+QFQAVA+I
Sbjct: 425 SDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQFQAVAVI 484

Query: 441 QESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLL 500
           QESLA CYGAG S+STCVVNIGAT T IAC+DEGTVLE+S V+L+YGGDD+T+LFAL LL
Sbjct: 485 QESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITRLFALLLL 544

Query: 501 QSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFD 560
           QS+FP QDW I++ HGW+LAE+LKK +TTFQDA++AVQLYNFI R P+Q SE+YEFK+FD
Sbjct: 545 QSDFPLQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQPSEKYEFKLFD 604

Query: 561 EVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDG 620
           EV LAPLALF+P+I   + S S +   NSN+E QLP SRD+FTN +NDW SLSQ E  +G
Sbjct: 605 EVMLAPLALFFPQIFKLIRSSSGK---NSNLEFQLPESRDLFTNELNDWNSLSQFESKEG 661

Query: 621 DLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEAD-SRKNYTPLEKAIIQSITNASTPID 679
           DLYS  N++  I++K+L+  T  D  Q KP    D S++N+ PLEKAIIQSI NAS   D
Sbjct: 662 DLYSNLNDDLKILNKILEAHTIIDQIQDKPENYGDTSKENFAPLEKAIIQSIANASITAD 721

Query: 680 VAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKT 739
           V +M+SFYSNIL+VGG SKIPALDFILTDRINIWRP LLS  SFP FYKKL K+ KD+++
Sbjct: 722 VTRMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLES 781

Query: 740 --AGKTGESEEEDQS--SKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAA 795
                  ++EEE++     +I + + AEL     +IE QNG+EHL PV+++PPPRDM+ A
Sbjct: 782 HFVNAPDKTEEENKQVMQSQIKDKVVAELDEQHQNIENQNGNEHLFPVSIIPPPRDMNPA 841

Query: 796 ELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
            + WKGA VLAQIKLVEEL++T+ DWD+HGSRILQYKC+FTY
Sbjct: 842 LIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/760 (63%), Positives = 605/760 (79%), Gaps = 17/760 (2%)

Query: 89  AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148
           A++ +R KK+P+LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEK+E+TTL
Sbjct: 120 AQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTL 179

Query: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNN--TQTSSINNTPDVIDIKNT 206
           PATGLFQP++LINQKNYSSDYLKKD+QIFALR+RK LRNN  TQ SS  NTPDVID+KN 
Sbjct: 180 PATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSS-TNTPDVIDLKNL 238

Query: 207 NTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDE 266
                +  A+ +E+IDL+D+  T+VIHPGS  ++IGF KDE P++VP+CVA+PK  LN E
Sbjct: 239 PHSEAN-TASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNCVAVPKKWLNLE 297

Query: 267 FQEA----PLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMI 322
             E      L+REQ E+F  +KS ++ +FRERMRYYKRKVP NAHEQV+S+N+NSKP++I
Sbjct: 298 SSENDEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVISFNENSKPEII 357

Query: 323 EDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLIND 382
            ++NDP  I WI   SK YYGS+AL+C  E F IR PF KGGSFN++SP Y SL +LI+D
Sbjct: 358 SEKNDPSPIKWIFDDSKLYYGSDALRCVDEKFIIRKPF-KGGSFNINSPYYKSLAELISD 416

Query: 383 VISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQE 442
           V  LLE+AL +E LN++ A+F+QYKVVLVIPD+F KSH+ETFIR LLTE+QFQAVAIIQE
Sbjct: 417 VTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFIRVLLTELQFQAVAIIQE 476

Query: 443 SLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQS 502
           SLA CYGAG S+STCVVNIGA+ T IAC+DEGTVLE+S ++LDYGGDD+T+LF LFLLQS
Sbjct: 477 SLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLDYGGDDITRLFGLFLLQS 536

Query: 503 EFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEV 562
           +FP QDW INS HGW+LAE+LKK +TTFQDA+VAVQLYNFI R P+Q +E+YEFK+FDEV
Sbjct: 537 DFPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFINRSPNQPTEKYEFKLFDEV 596

Query: 563 SLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDL 622
            LAPLALF+P+I   + + S +   NS++E QLP SRD+FTN +NDW SLSQ E  +G+L
Sbjct: 597 MLAPLALFFPQIFKLIRTSSDK---NSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNL 653

Query: 623 YSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEAD-SRKNYTPLEKAIIQSITNASTPIDVA 681
           Y   +++  I+ K+L      D  Q KP    + S++N+ PLEKAIIQSI NAS   DV 
Sbjct: 654 YCNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPLEKAIIQSIANASITADVT 713

Query: 682 KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKT-- 739
           +M+SFYSNIL+VGG SKIPALDFILTDRINIWRP LLS  SFP FYKKL K+ KD+++  
Sbjct: 714 RMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLESHF 773

Query: 740 AGKTGESEEEDQ--SSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAEL 797
                ++EEE++    ++I E +  EL     +IE QNG+EH+ P++++PPPRDM+ A +
Sbjct: 774 VNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPISIIPPPRDMNPALI 833

Query: 798 AWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
            WKGA VLAQIKLVEEL++T+ DWD+HGSRILQYKC+FTY
Sbjct: 834 IWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/762 (63%), Positives = 602/762 (79%), Gaps = 21/762 (2%)

Query: 89  AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148
            ++ +R KK+P+LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAK LK+IGIEK+E+TTL
Sbjct: 128 VQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTL 187

Query: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNN-TQTSSINNTPDVIDIKNTN 207
           PATGLFQP++LINQKNYSSDYLKKD+QIFALR+RK LRNN T   S  NTPDVID+K+  
Sbjct: 188 PATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDVIDLKS-- 245

Query: 208 TEVPDYIAAA---DEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELN 264
             +P   A+A   +++IDL+D   T+VIHPGS  ++IGF KD+ P+VVP+CVA+PK  L+
Sbjct: 246 --LPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLD 303

Query: 265 DEFQE----APLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQ 320
            E  E      L+REQ EEF  +KS ++ +FRERMRYYKRKVP NAHEQVVS+N+NSKP+
Sbjct: 304 LENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPE 363

Query: 321 MIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLI 380
           +I ++NDP  I WI   SK YYGS+AL+C  E F IR PF +GGSFNV SP Y SL +LI
Sbjct: 364 IISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELI 422

Query: 381 NDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAII 440
           +DV  LLEHAL++E LN++  +F+QYKVVLVIPD+F KSHVETFIR LLTE+QFQAVAII
Sbjct: 423 SDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAII 482

Query: 441 QESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLL 500
           QESLA CYGAG S+STCVVNIGA  T IAC+DEGTVLE+S ++LDYGGDD+T+LFALFLL
Sbjct: 483 QESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLL 542

Query: 501 QSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFD 560
           QS+FP QDW I+S HGW+LAE LKK +TTFQDA+VAVQLYNF+ R P+Q +E+YEFK+FD
Sbjct: 543 QSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFD 602

Query: 561 EVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDG 620
           EV LAPLALF+P+I   + + S +   NS++E QLP SRD+FTN +NDW SLSQ E  +G
Sbjct: 603 EVMLAPLALFFPQIFKLIRTSSHK---NSSLEFQLPESRDLFTNELNDWNSLSQFESKEG 659

Query: 621 DLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADS-RKNYTPLEKAIIQSITNASTPID 679
           +LY   N++  I++++LD     D  Q KP    ++ ++N+ PLEKAI+QSI NAS   D
Sbjct: 660 NLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITAD 719

Query: 680 VAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKT 739
           V +M+SFYSNIL+VGG SKIPALDFILTDRINIWRP LLS  SFP FYKKL K+ KD++ 
Sbjct: 720 VTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEG 779

Query: 740 AGKTGESEEEDQSSK----KINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAA 795
                  + ED++ +    +I E I  EL+    +IE QNG+EH+ PV+++PPPRDM+ A
Sbjct: 780 HYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPA 839

Query: 796 ELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
            + WKGA VLAQIKLVEEL++T++DWD+HGSRILQYKC+FTY
Sbjct: 840 LIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/764 (58%), Positives = 580/764 (75%), Gaps = 17/764 (2%)

Query: 89  AKSQERAK---KHPRLDPAKAPP----GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIE 141
           +K Q++A+   K    D   A P     KKVP HLLEKRRLGR+KAAE FA KLK+ GIE
Sbjct: 115 SKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIE 174

Query: 142 KIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVI 201
           +++++ L  TGLF  +LL+NQKN SSDYLKKD+Q+FALRERKTLRNNT  S+  NTPDV+
Sbjct: 175 RVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDVV 234

Query: 202 DIKNTNTE-----VPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCV 256
           D+K  N       V + +   D+DID +D  TT+VIHPGSR+L+IGFAKDE PLVVPSCV
Sbjct: 235 DLKALNNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCV 294

Query: 257 AIPKTELNDE-FQEAPL-KREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYN 314
           AIPK  L  E  +E  + K E  E    +K+ +Q SFRERMRYYKRK+  N+HE+V ++N
Sbjct: 295 AIPKNSLYSENVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFN 354

Query: 315 KNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYA 374
           + +KP+++ED+ND G I WI  S K Y+G EA +C+KE F IR PF KGGS N+ SP Y+
Sbjct: 355 EQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYS 414

Query: 375 SLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQF 434
           SL +L++DV  L E+AL+    ++ +AQ  Q KV+LVIPDLF KSH+ET  R LL EMQF
Sbjct: 415 SLPELLSDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQF 474

Query: 435 QAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKL 494
           QAVAI+QESLA CYGAG S+++C+VNIGAT T+IAC+DEGTVLENSL+ LDYGGDD+T+L
Sbjct: 475 QAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRL 534

Query: 495 FALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQY 554
           F LFLL++ FP+QD D++S+HGW LAE+LKK Y TF+DAN+ VQLYNF+KR+P + SE+Y
Sbjct: 535 FTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKY 594

Query: 555 EFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQ 614
           EFKVFDEV LAPLALFYP+I   L    S++    N+E QLP SRD++T+++NDWRS+SQ
Sbjct: 595 EFKVFDEVILAPLALFYPDIFQELKKLDSKNK--FNLEDQLPVSRDLYTDSINDWRSVSQ 652

Query: 615 SECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNA 674
            +CLDGDLY+GN N   I++K+L++ +S ++++     E D R+NY PLEKAIIQSITNA
Sbjct: 653 LQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNA 712

Query: 675 STPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQA 734
              +DV+KM+ FY+NI+VVGG S IP LDF+LTDRINIWRP+ L  T+FP+F+K ++KQ 
Sbjct: 713 CVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQV 772

Query: 735 KDIKTAGKTGES-EEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMD 793
           K+I++  K   + EEE++  + I E+I  EL+ Y +SIE+Q   +H  PV VLPPPRDM+
Sbjct: 773 KEIQSTSKASTTPEEEEKIKQSIKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMN 832

Query: 794 AAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
              L WKGA VLAQIKL+EEL++T+TDWD+ GSRILQYKCLFTY
Sbjct: 833 PEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/785 (56%), Positives = 587/785 (74%), Gaps = 25/785 (3%)

Query: 64  SATATPIGQRNHVXXXXXXXXXXXXAKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLG 123
           + T TP+G  N               K +   KK  +++P K P GKKVPLHLLEKRRLG
Sbjct: 93  TRTLTPMGSANG-----------KTTKEEGPQKKVQKVEPNKVPLGKKVPLHLLEKRRLG 141

Query: 124 RIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALRERK 183
           RIKAA+EFAKKLK+IGIEK+ES  +P TG+FQP+LLINQKNYSSDYL+KDEQIFALRERK
Sbjct: 142 RIKAAKEFAKKLKEIGIEKVESVPVPMTGMFQPLLLINQKNYSSDYLRKDEQIFALRERK 201

Query: 184 TLRNNT-QTSSINNTPDVIDIKNTNTEVPDYIAAA--DEDIDLSDANTTLVIHPGSRHLR 240
           TLR+NT Q  S +NTP+V D+++   E  ++  A   +++I L+D NTT+VIHPGS  L+
Sbjct: 202 TLRSNTTQNISSSNTPEVTDLQSVR-ETSNFTTANGNNDEILLNDPNTTIVIHPGSSFLK 260

Query: 241 IGFAKDEVPLVVPSCVAIPKTELND----EFQEAPLKREQPEEFEELKSTIQHSFRERMR 296
           +GFA DEVP ++P+CVA+PKT+ N+    + ++  +  E  E+FE LK+ ++ SF ERMR
Sbjct: 261 VGFALDEVPELIPNCVALPKTDFNNTNIIKSKQTSVNIEDNEKFESLKAEMEESFEERMR 320

Query: 297 YYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRI 356
           YYKR++  N H+QVVS+N+ SKP+ +  QNDP  I+WI   +KR+YG +AL+C+ E F  
Sbjct: 321 YYKRRIQPNGHDQVVSFNRLSKPESLPVQNDPAHIDWITDGTKRFYGDDALRCTDENFIK 380

Query: 357 RCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLF 416
           R PF KGGSFN SS  Y SLQDL++DV+ L+E  LS++  N++ +QFSQYKVVLVIPD F
Sbjct: 381 RYPFKKGGSFNTSSNSYKSLQDLLSDVVGLIEGTLSSDKFNIKSSQFSQYKVVLVIPDSF 440

Query: 417 HKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTV 476
            KSHVE FIR L+TE+QFQAVAIIQESL+ CYG+G   STCVVN+G+  T++AC+DEG V
Sbjct: 441 EKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKETTVACVDEGIV 500

Query: 477 LENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVA 536
           L+NSL++LDYG +D+TKLFA FLL  +FPY++WD+NS+ GW LAEEL K+  TFQDA++ 
Sbjct: 501 LDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTEGWRLAEELMKQCVTFQDADIT 560

Query: 537 VQLYNFIKRVPDQQS-EQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQL 595
           VQL NFIKR P   + E+ +FKVF+EV LAPLALFYPEI   L SK S+   N+ +E QL
Sbjct: 561 VQLSNFIKRTPRGNTVEKLDFKVFEEVMLAPLALFYPEIFKLLRSKESEEQ-NAELEYQL 619

Query: 596 PASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEAD 655
           P SRDIFT+ +NDWRSLSQ++C++   +   ++   ++ K +D   + + F   PP E  
Sbjct: 620 PPSRDIFTDKINDWRSLSQNDCINHQTFCDIHDEYELLKKAVDCPNTLETFMDNPPEEKK 679

Query: 656 SRKNYTPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRP 715
           S  N+TPL+KAI++SIT AS  +DV+KM++FYSNILVVGGGSKIP  D +L DR+NIWRP
Sbjct: 680 STFNFTPLDKAIVESITTASLGLDVSKMATFYSNILVVGGGSKIPGFDLMLMDRVNIWRP 739

Query: 716 RLLSLTSFPNFYKKLAKQAKDIKTAGKTGESEE---EDQSSKKINEMISAELQAYWDSIE 772
           RLLSL +F +FY++L KQ K++++  KTG+ EE   ED+ ++KI+E+I  EL  Y + IE
Sbjct: 740 RLLSLRAFTHFYRELTKQLKELQSL-KTGDGEEEIKEDELNEKISELIKTELTKYLEVIE 798

Query: 773 AQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYK 832
            Q+G+EH LPV V+P P ++D   +AWKGA VLAQIKLVEEL++T+ DWD+HG+RILQYK
Sbjct: 799 QQSGNEHFLPVEVIPSPNEIDPGSIAWKGASVLAQIKLVEELFITNGDWDVHGNRILQYK 858

Query: 833 CLFTY 837
            + TY
Sbjct: 859 SILTY 863

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/754 (57%), Positives = 571/754 (75%), Gaps = 22/754 (2%)

Query: 95  AKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLF 154
           +KK+P++D +K    KK  LHLLEKRRLGR+KAAEEFAKKLKQ GIEKIE+ T+  TGLF
Sbjct: 112 SKKNPKIDSSK---NKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLF 168

Query: 155 QPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTS-SINNTPDVIDIKNTNTEVPDY 213
           QP +LINQKNYSSDYLKKD QIFA+R RK +R N QT+ S+NNTPD  + +    +    
Sbjct: 169 QPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQ---- 224

Query: 214 IAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPK-------TELNDE 266
            AA DEDI+L D +TT+VIHPGS+ L+IG+A+D  P+++PSCVA+PK       +ELND 
Sbjct: 225 -AAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDN 283

Query: 267 FQEAPLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQN 326
           F  +   ++Q E+F+E K+ +  SF+ERMR+YKRKV  N HEQV+S+NKNSKP+ + ++N
Sbjct: 284 FNYS---KDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKN 340

Query: 327 DPGAIN-WIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVIS 385
           D   +N WI    K+Y+GS+A++CSKE F IR PF  GGSFN+ +P Y +L +L+++V  
Sbjct: 341 DIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCE 400

Query: 386 LLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLA 445
            L H L+++   L+ + FS YK+VLVI D+F KSH+E   R LL EMQF AVAIIQESLA
Sbjct: 401 FLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLA 460

Query: 446 GCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFP 505
            CYGAG  SSTCVVN+GAT T IAC+DEG+++E+S+VSLDYGGDD+TKLF++ LLQS FP
Sbjct: 461 TCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFP 520

Query: 506 YQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLA 565
           Y D +IN++H WILAE+LKK + TF DANV VQLYNFIKRVP Q  ++YEF+ F+EV LA
Sbjct: 521 YTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLA 580

Query: 566 PLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSG 625
           PL+LFYP+++  L S+      N  V+ QLPASRDIFT+ +NDW+S++Q++CL+ +LYS 
Sbjct: 581 PLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSE 640

Query: 626 NNNNQLIMSKLLDLQTSFDDFQSKPPMEAD-SRKNYTPLEKAIIQSITNASTPIDVAKMS 684
            ++   ++ + L++  + ++ + +   E +    NYT LEKAIIQSI NAS  +D++K++
Sbjct: 641 TSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKAIIQSIANASASLDISKIN 700

Query: 685 SFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTG 744
           SFYSNIL+VGGG+KIP+LDFIL DRI IWRPRLLS+ SFP FYKKL K  K++   GKT 
Sbjct: 701 SFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTN 760

Query: 745 ESEEEDQSSKK-INEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGAC 803
           ++ EE++S KK I+E+I  E +AY   +E Q  ++   PV++LP PR+MD AEL WKGA 
Sbjct: 761 KTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGAS 820

Query: 804 VLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           VLAQIKLVEEL++T+ DWD+HGSRILQ+KC+FTY
Sbjct: 821 VLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/771 (51%), Positives = 556/771 (72%), Gaps = 28/771 (3%)

Query: 90  KSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLP 149
           + +++ +K+P LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+KLK +GIE++E+  LP
Sbjct: 72  RGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLP 131

Query: 150 ATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRN-NTQTSSINNTPDV-------- 200
            +GLF PV LINQKNYSSDYL+KDE  FA+RERK +RN N   S+   T ++        
Sbjct: 132 QSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSAS 191

Query: 201 -------IDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVP 253
                    + +T+T++      + EDID +D   T+VIHPGS  ++IG A DE P+ +P
Sbjct: 192 MASSASLDALVDTDTKL-----QSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIP 246

Query: 254 SCVAIPKTELNDEFQEAP---LKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQV 310
           + VA+P++++ +   E P   L  E  ++F EL + ++++F+ERM+YYKRK+  NAHEQV
Sbjct: 247 NLVAVPRSQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQV 306

Query: 311 VSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSS 370
            S+N NSKP+ + D+ND G I+WI  + K+YYG +A +C  + F +R PF K G FN+ S
Sbjct: 307 TSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLES 366

Query: 371 PDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLT 430
            +Y+S+QDL+ DV  L++ ALS++  N+ ++++  YK V+VIPDLF KSH+ETFIR LL 
Sbjct: 367 NNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLN 426

Query: 431 EMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDD 490
           EM F++VA++QESLA CYGAG S+ TCVVNIGA    IAC+D+GT++++S V+LDYGG+D
Sbjct: 427 EMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGND 486

Query: 491 LTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQ 550
           +T L A+ L QS+FPY++W++++ +GW  AE+ KKK+ TFQDA++AVQL+NFIKRVP   
Sbjct: 487 VTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP 546

Query: 551 SEQYEFKVFDEVSLAPLALFYPEIISYLHSKS--SQHSGNSNVESQLPASRDIFTNTVND 608
           SE+Y+FKVFDEV LAPL LFYPEI  Y+  +   +     + +  Q+  SRDI+TN++ND
Sbjct: 547 SEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLND 606

Query: 609 WRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAII 668
           WRS++Q +C +  +Y    ++  I+   LDL T  +D QSK   E   +K + PL+KAI+
Sbjct: 607 WRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIV 666

Query: 669 QSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYK 728
           QSITNA+  +D++K+S FYSNI++VGGG+ IPALDFIL+DRINIWRP +L ++SFPNFYK
Sbjct: 667 QSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYK 726

Query: 729 KLAKQAKDIKTAGK--TGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVL 786
            L KQ KDI+T+ K  TG+  +E + +++   ++  EL     S+E  N  +H   V VL
Sbjct: 727 SLTKQLKDIQTSNKSNTGDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHFFTVGVL 786

Query: 787 PPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           P PR++D + L WKGA VLAQIKL+EELY++  DWD+HG+R+LQYKC+F Y
Sbjct: 787 PAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/753 (55%), Positives = 542/753 (71%), Gaps = 22/753 (2%)

Query: 107 PPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYS 166
           P   K+   +LE+RRLGR +AA  +A KL++ GIEK E+  + +TGLF+P+ L+NQKN S
Sbjct: 130 PVSTKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQKNCS 189

Query: 167 SDYLKKDEQIFALRERKTLRNNTQTSSIN-------------NTPDVIDIKNTNTE---- 209
           SDYLK + QIFALRERK LRNNT   +IN             NTP+V D+KN N+E    
Sbjct: 190 SDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKNVNSESNVS 249

Query: 210 -VPDYIAAADED-IDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDE- 266
            + + I   + D I   D  TT+VIHPGSR+L+IGFAKD+ PLV+P+CVA PK  L  E 
Sbjct: 250 LIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKNSLYSEN 309

Query: 267 FQEAPLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQN 326
            +E  + +E+ + F+  K+ IQ SFR+RMRYYKRK+  N+HE+V S+N  SKP+ +ED+ 
Sbjct: 310 VEETIVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKPEKVEDKT 369

Query: 327 DPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISL 386
           +   + WI    K YYG EA +CSK+ F IR PF KGGSFN++SP Y SL ++I D+ +L
Sbjct: 370 EYNRVEWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLPEIIGDISNL 429

Query: 387 LEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAG 446
            E+ALS +  NL+ +++S+YK++LVIPD+F KSH+ET  R LL EM+FQAVAI+QESLA 
Sbjct: 430 FEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAVAIMQESLAA 489

Query: 447 CYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPY 506
            YGAG   +TC+VNIGAT T +ACIDEGTV E+SL++LDYGGDD+TKLF   LLQ+EFPY
Sbjct: 490 SYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLHLLLQNEFPY 549

Query: 507 QDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLAP 566
           QD DINSSHGW   E LKK++ TF+DAN+ VQLYNFIK  P  Q+E+ EFKVFDEV  AP
Sbjct: 550 QDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPGAQAEKLEFKVFDEVINAP 609

Query: 567 LALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGN 626
           L LFYPEI   +  ++ +   N  ++ QLP S D++T   +DWRSLSQ +CLD D YSGN
Sbjct: 610 LGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQCLDNDTYSGN 669

Query: 627 NNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDVAKMSSF 686
           +N+  +++KLL+   + DD       + ++ KNYT L+KAIIQSITNA   +D +KM+ F
Sbjct: 670 DNDLDVITKLLNANLNLDDMDLINNDQNENEKNYTSLDKAIIQSITNAVVTMDTSKMTQF 729

Query: 687 YSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGES 746
           Y+NI+VVGG S IP+LDFILTDRINIWRPR+LS   FP+F++ L KQ KD  TA K+   
Sbjct: 730 YNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDFNTANKSNNR 789

Query: 747 EEEDQSSKK--INEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACV 804
            EE +  +K  I E+I  EL+ Y D++E+QN +EHLLPV+VLPPP DMD + L WKGA V
Sbjct: 790 PEEGEEEQKKGIAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMDPSVLNWKGASV 849

Query: 805 LAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           L Q+KL+EELY+T+ DWD+ GSRILQYKCLF Y
Sbjct: 850 LGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/822 (51%), Positives = 561/822 (68%), Gaps = 64/822 (7%)

Query: 63  RSATATPIGQRNHVXXXXXXXXXXXXAKSQERAK------KHPRLDPAKAPPGKKVPLHL 116
           RS+T TP+ +R                +S    K      K  +L   K   G KVP HL
Sbjct: 38  RSSTNTPLAERAATIDGEEDVDGDDDIESNNSVKTVKIDGKDVQLSYGKTMAGTKVPKHL 97

Query: 117 LEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQI 176
           LE+RR+GRIKAAE FAKKLK+IGIEKIE+ TLP TGLFQP+ LINQKNYSSDY++KD+QI
Sbjct: 98  LERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLNLINQKNYSSDYIRKDDQI 157

Query: 177 FALRERKTLRNNTQTSSINNT--PDVIDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHP 234
           FALRERKTLR++T  ++ N +    V+D+K             D++IDL+D N+T++I P
Sbjct: 158 FALRERKTLRSSTNANNNNTSTPKAVVDLKT---------GVMDDEIDLNDPNSTIIIQP 208

Query: 235 GSRHLRIGFAKDEVPLVVPSCVAIPKTE-LNDEFQEAPLKREQPEEFEELKSTIQHSFRE 293
           GS  ++IGFA DE PL++P+ VAIPK +       E+ L  EQ EEFE+LK+ +  +F+E
Sbjct: 209 GSETMKIGFALDETPLLIPNLVAIPKKDDSKGPSTESKLNTEQSEEFEDLKNELHSTFKE 268

Query: 294 RMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKET 353
           RMRYYKR++  N+HEQV S+N+N++P+ I D NDP  I WI ++ K YYG++AL C +  
Sbjct: 269 RMRYYKRRIQPNSHEQVKSFNRNAQPETILDNNDPARIRWITQNDKVYYGNDALLCPESF 328

Query: 354 FRIRCPFT---KGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLN--LERAQFSQYKV 408
           F  R PF     G  FN+    Y+S+Q+L+ DVI L+E      GLN  LE     +YK 
Sbjct: 329 FSHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKLIEF-----GLNKLLEAKNKDKYKA 383

Query: 409 VLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSI 468
           +LVIPDLF KSHVE  IR LLTE+ F AVAIIQESLA CYGAG S+STCVVN+GA+ TS+
Sbjct: 384 ILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASETSV 443

Query: 469 ACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYT 528
           +CIDEG VLENSL++L+YGGDD+T+LF++ L  + FPYQDW++ S  GW +AE LKK+  
Sbjct: 444 SCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWNVESIAGWNIAETLKKQIV 503

Query: 529 TFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGN 588
           T QDA+V VQL NF+KRV ++ +E+YEFK FDEV LAPLALF P I SYL ++ S+   N
Sbjct: 504 TLQDADVTVQLSNFMKRVFNEPTEKYEFKTFDEVMLAPLALFAPRIFSYLRNEESK---N 560

Query: 589 SNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQS 648
           S ++ QLP S+D+FT+ +NDWRS++Q  C +   Y   ++   +++ LL++ +  + FQS
Sbjct: 561 STLQYQLPESKDLFTHELNDWRSMTQEACKNNGSYCDISDELQLLTALLEVDSKLEAFQS 620

Query: 649 KPPMEADSRKNYTPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTD 708
           +     D+++N  PL+KAIIQSIT+A   +D +KM SFYSNILVVGG S IPA DF+LTD
Sbjct: 621 EATTTLDNKRNMLPLDKAIIQSITDACLSLDPSKMDSFYSNILVVGGSSNIPAFDFMLTD 680

Query: 709 RINIWRPRLLSLTSFPNFYKKLAKQAKDIK----------------------------TA 740
           RINIWRPRLLSL+SFP FYK L+K+ KD++                             A
Sbjct: 681 RINIWRPRLLSLSSFPQFYKNLSKEIKDLEMESQSTAKLQAQTGSVVPTTGSSTPLATNA 740

Query: 741 GKTGES-----EEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAA 795
           G  GE+     E   + S  IN++I  +LQ Y  ++E+QN +EH  PV V+PPPRDM AA
Sbjct: 741 GNDGETMADLNEVSKKLSSNINDLIKTKLQDYISNVESQNSNEHYFPVGVVPPPRDMSAA 800

Query: 796 ELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
            L+WKGA VLAQIKLVEEL++T+ DWD+HGSRILQ+KC+FTY
Sbjct: 801 ILSWKGASVLAQIKLVEELFITNLDWDMHGSRILQHKCIFTY 842

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/746 (55%), Positives = 541/746 (72%), Gaps = 29/746 (3%)

Query: 107 PPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYS 166
           PPGKKVP+HLLEKRRLGRIKAAEEFAKKLK IGIEK +++ L  TGLF+P+LLINQKNYS
Sbjct: 63  PPGKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLLLINQKNYS 122

Query: 167 SDYLKKDEQIFALRERKTLRNNTQTSSI---------NNTPDVIDIKNTNTEVPDYIAAA 217
           SDYLKKD+QIFA+RERK+LRN    +           N TP+VI  +  N +     A  
Sbjct: 123 SDYLKKDDQIFAMRERKSLRNPNSGNGNGNTGNNAVSNATPEVIPEEEDNDDN--DDAEG 180

Query: 218 DEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEFQEAPLKREQP 277
            +D++      T+VIHPGS+ L+IGFA D +P  VPSC+AIP+   N     +P  RE P
Sbjct: 181 TDDLN------TIVIHPGSKFLKIGFATDVLPQSVPSCIAIPRATKNS--VRSPQIRE-P 231

Query: 278 EEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKS 337
            EF+ LKS IQ  F+ERMRYYKRKV  NAH+ V+++N   +P++I + ND   + WI+  
Sbjct: 232 SEFDGLKSAIQQDFKERMRYYKRKVIPNAHDAVINFNSKVEPELIHEHNDLHRVEWIQNG 291

Query: 338 SKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLN 397
           S ++YG EA +C    F +R PF +G SFNV SP Y S Q+L+ DV SLLE+ L  E ++
Sbjct: 292 SNQFYGEEATRCLPSHFTLRYPFARG-SFNVESPYYMSFQELLGDVQSLLEYCLKQEKID 350

Query: 398 LERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTC 457
           + + QF+ YK+VLVIPDL+ K++VETFI  LL +M FQAVAIIQESLA  YGAG S+STC
Sbjct: 351 VTKQQFANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTC 410

Query: 458 VVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGW 517
           VV+IGAT T IAC+DEGTVL NS V+LDYGGDD+T+LF+ FLLQS+FPY DWD+++ HGW
Sbjct: 411 VVDIGATSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLSTPHGW 470

Query: 518 ILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQ-YEFKVFDEVSLAPLALFYPEIIS 576
           +LAE LKK++TTFQDANVAVQLYNFIKR P + + Q YEFKVFDEV LAP+A+F+P+I+S
Sbjct: 471 MLAESLKKEFTTFQDANVAVQLYNFIKRTPGEANAQKYEFKVFDEVMLAPMAMFFPKILS 530

Query: 577 YLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKL 636
            L+ + +Q      V +Q P S+DI+T   N+ RS+SQ EC +   Y     +  I+ K+
Sbjct: 531 LLNPQKTQQE--HYVTNQFPRSKDIYTLRDNNPRSISQRECHENKTYCDMTRDLDILQKI 588

Query: 637 LDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPID--VAKMSSFYSNILVVG 694
           L+L    D++ +    +     N TPLEKAI++SITNAS  +D  ++++ +FYSN+LVVG
Sbjct: 589 LNLPDEIDEYSNSNLSKKHHHDNITPLEKAIVESITNASISLDNNMSRLGNFYSNLLVVG 648

Query: 695 GGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGESEEEDQ--- 751
           GGSK P+LDFILTDRINIWRPRLLS+ +   FYKK+ +Q KD +   K  E  + +Q   
Sbjct: 649 GGSKFPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFEQENKVSEVTDPEQLAT 708

Query: 752 SSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLV 811
             KK+ +M+  ELQ+YW+S++A  G+E++ P+NVLPPPRDMD A L WKG  VLA+IKLV
Sbjct: 709 LKKKLLKMVKLELQSYWESVDALGGNENVFPINVLPPPRDMDPAVLTWKGGSVLARIKLV 768

Query: 812 EELYLTSTDWDIHGSRILQYKCLFTY 837
           EELY+T+ DWD+ GSRILQYKC+F Y
Sbjct: 769 EELYITAKDWDVLGSRILQYKCIFDY 794

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/753 (52%), Positives = 522/753 (69%), Gaps = 29/753 (3%)

Query: 91  SQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPA 150
           S   A K  + DP +     KVP HLLEKRRLGR KAAE++A+K+K IGIEK ++  L  
Sbjct: 46  SHSNASKVKKPDP-QVKQNTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQ 104

Query: 151 TGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTNTEV 210
            GLF+P+ LINQKNYSSDYLK+D+QIFA+RERK+LRN T + S  + PD  D        
Sbjct: 105 LGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNATASQSTPDMPDDDD-------- 156

Query: 211 PDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEFQEA 270
                   E +D      T+VIHPGS+ L+IGFA D +P  +PSCVA+PK   +   Q  
Sbjct: 157 -------QESVDGDSELNTIVIHPGSKSLKIGFATDVLPQSIPSCVAVPKR--SQSLQGE 207

Query: 271 PLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGA 330
             +    EE++E K +IQ  F+ERMRYYKRK+  N+H+ VV++N    P++I + ND   
Sbjct: 208 TKQPHDTEEYQETKDSIQQDFKERMRYYKRKIIPNSHDIVVNFNSRVSPEIIPEHNDLHR 267

Query: 331 INWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHA 390
           I+WI + S+ YYG EA +C    F +R PF KG  FN+ SPDY+SLQ+L+NDV  LL+ A
Sbjct: 268 IDWIDQPSRPYYGKEATRCLPSHFTVRHPFWKG-RFNIESPDYSSLQELLNDVCELLKFA 326

Query: 391 LSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGA 450
           LS   ++++ +Q S YKVV+V+PDL+ K++VETFIR LL ++ FQAVAIIQESLA CYGA
Sbjct: 327 LSQPKIDVKPSQISNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGA 386

Query: 451 GQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWD 510
           G   STCVV+IGAT T IAC+DEG V ENS+++LDYGGDD+T+LFA FLL+S FPYQD D
Sbjct: 387 GIGESTCVVDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLD 446

Query: 511 INSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQ-QSEQYEFKVFDEVSLAPLAL 569
           ++S  GW L E+LK+KYTTFQDA+V +QLYNFIKR+P +  +E++EFKVFDEV  AP+ L
Sbjct: 447 LDSPQGWSLVEQLKEKYTTFQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEVMTAPMGL 506

Query: 570 FYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNN 629
           F+P +   L  K   +  N  V+SQLP S+D+FT   N+ +S+SQ  C   + Y     +
Sbjct: 507 FFPHVFPLL--KEQNNPTNEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTYCDMGRD 564

Query: 630 QLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDV--AKMSSFY 687
             I+ KLL+L +  +++QS     A+    YT LEKAII+SITNA   +D   AK + FY
Sbjct: 565 LDILQKLLNLPSEIEEYQSA--ASANVEPAYTALEKAIIESITNACVSLDNNHAKAAQFY 622

Query: 688 SNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGESE 747
           SNILVVGG SK P+LDFILTDRINIWRPRLLS+ + P F+ +++KQ K+ +   K  E +
Sbjct: 623 SNILVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQTNKLSEIK 682

Query: 748 EEDQ---SSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACV 804
           EE++     KK+ + I  ELQ+YW+ ++A  G+E + P+NVLP PR+MD A L WKG  V
Sbjct: 683 EEEELLSQKKKLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPREMDPALLTWKGGSV 742

Query: 805 LAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
            A++KL+EELY+++ DWD+  SRILQYKC+F Y
Sbjct: 743 FARLKLIEELYVSANDWDVLNSRILQYKCIFDY 775

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/801 (48%), Positives = 536/801 (66%), Gaps = 78/801 (9%)

Query: 104 AKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQK 163
           +K+  GKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEK++STTLP+TG  +P+++INQK
Sbjct: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204

Query: 164 NYSSDYLKKDEQIFALRERKTLRN----------------NTQTSSINNTPDVIDIKNTN 207
           NYSSDY++KD+QIFALRERK LR+                     S ++TP+V       
Sbjct: 205 NYSSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTNNGSNTNGVGSASHTPEV-----AT 259

Query: 208 TEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEF 267
           + +P+      +DID +DA TT+VI PGS  ++IGFA DE PLV+P+CVA+P +      
Sbjct: 260 STIPNEFTLKSDDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPNCVAVPHSGETPIG 319

Query: 268 QEAPLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQND 327
             A L R+QP++F + K  +Q SF+ERMR+YKR+V  ++++QV ++N+ +KP++IEDQND
Sbjct: 320 NAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQND 379

Query: 328 PGAINWIKKSSKR-----YYGSEALKCSKETFRIRCPFTKGGS-----FNVSSPDYASLQ 377
           P  I W  +   +     Y G EAL C +E +  R PF  G S     FN+    Y SL 
Sbjct: 380 PAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDEKRYTSLA 437

Query: 378 DLINDVISLLEHALSA--EGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQ 435
            L+ DV  LLEHA+    +  + +  +  +YK VLVIPDLF KSHVET IR LL+E+ F 
Sbjct: 438 ALLCDVSRLLEHAIDKLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFN 497

Query: 436 AVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLF 495
           AVAI+QESLA CYG+G S+STCVVN+GAT T +AC+DEG V+ENS+++L+YGGDD++KLF
Sbjct: 498 AVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLF 557

Query: 496 ALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYE 555
           A+ LL S FPYQ+WDI+S  G ++AE LKK+  TFQDA++  QL+NFIKRVP   +E+ E
Sbjct: 558 AVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIE 617

Query: 556 FKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQS 615
           FK FDEV LAPLALFYP+I S L     ++  N  ++ QLP SRD+FTN  N+W+SLS+ 
Sbjct: 618 FKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEM 677

Query: 616 ECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEAD-----SRKNYTPLEKAIIQS 670
           +C    LYS      +++  LL + +     +  PP ++      +  N T L+K++IQS
Sbjct: 678 DCATNTLYSDMVQESVLLDNLLGINSR----REGPPKDSGVGSETTELNLTALDKSVIQS 733

Query: 671 ITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKL 730
           ITNA+  ++  KM+SFYSNIL+VGG S IP  D IL DRIN+WRP+L++L SFPNFY +L
Sbjct: 734 ITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNEL 793

Query: 731 AKQAKDIKTAGKTGES----------------------------------EEEDQSSKKI 756
            K+ KD++T+ KT  +                                   +E + ++KI
Sbjct: 794 VKEIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKETSSDAKEYELNEKI 853

Query: 757 NEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYL 816
            ++I   L+ Y  +IE QNG+EH +PV+V P P +M+ + L W+GA VLAQIKL+EEL++
Sbjct: 854 QKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFV 913

Query: 817 TSTDWDIHGSRILQYKCLFTY 837
           T+ DWD+HGSR+LQ+KC+FTY
Sbjct: 914 TNIDWDVHGSRVLQHKCIFTY 934

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/666 (56%), Positives = 500/666 (75%), Gaps = 21/666 (3%)

Query: 90  KSQERA-KKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148
           KS+E A KK+P++DP K PPGKKVPLHLLEKRRLGRIKAAEEFAKKLK+ GIEK+ES T+
Sbjct: 149 KSKEEAYKKYPKMDPKKVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTV 208

Query: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTNT 208
           P TGLFQP+ LINQKNYSS YLK D+QIF LR+ K+L+N +   +   TPD I +++  T
Sbjct: 209 PPTGLFQPLNLINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTATPDNI-VESVAT 267

Query: 209 EVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTEL----- 263
            + +   +  + ++L+D   T++IH GS  L+IG A DE P++VP+CVAIPK E      
Sbjct: 268 GINN--KSTGDQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCVAIPKQEYEGMTR 325

Query: 264 ----NDEFQEAPLKR-----EQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYN 314
                D     P         Q +EF +LK  I+ +F+ERM+YYKR++  N+ EQV S+N
Sbjct: 326 NINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRIQPNSCEQVKSFN 385

Query: 315 KNSKPQMIEDQNDPGAINWIKKSS-KRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDY 373
           K SKP+++   NDP  I WI +S+ KRYYGS A +C+   F+ R PF+  GSFN++S DY
Sbjct: 386 KISKPEILPISNDPQRIQWINESTNKRYYGSNAERCTDLHFKTRKPFSNNGSFNIASTDY 445

Query: 374 ASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQ 433
            SLQDL++DV +L+EH+L++   +L+ +QF ++KVVL+IPD F KSHVE FI  LLT ++
Sbjct: 446 ISLQDLLSDVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSFGKSHVELFITLLLTHLK 505

Query: 434 FQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTK 493
           FQAVAIIQESLA CYGAG S  TCVVN+GA+ T++AC+DEGTVLENS+VSL+YGG+D+T 
Sbjct: 506 FQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSMVSLNYGGNDITN 565

Query: 494 LFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQS-E 552
           +FA FLLQ++FPY +W++NS  GW LAEELK+KY TFQD +V VQL+NFIKR+P   + E
Sbjct: 566 IFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFNFIKRLPGMDTIE 625

Query: 553 QYEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSL 612
           +Y+FKVFD+V LAPL LF+P+I+  +  +  Q+  N  ++SQLP SRDI+T  +NDWRS+
Sbjct: 626 KYDFKVFDDVMLAPLTLFFPKILKLMKEQQPQNR-NKFLQSQLPDSRDIYTTKINDWRSI 684

Query: 613 SQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSIT 672
           +Q ECL+  L+S  +N   ++ + L++    ++FQ+  P   + + NYTPL+ AIIQSI 
Sbjct: 685 TQEECLESKLFSYIDNELELLKRTLEVPILLENFQNNSPDNKNDKLNYTPLDVAIIQSIM 744

Query: 673 NASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAK 732
           NAST ID++KMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYK+L+K
Sbjct: 745 NASTNIDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKELSK 804

Query: 733 QAKDIK 738
             KD++
Sbjct: 805 DIKDLQ 810

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 84/129 (65%), Gaps = 6/129 (4%)

Query: 715 PRLLSLTSFPNFYKKLAKQAKDIKTAGKTGESEE-----EDQSSKKINEMISAELQAYWD 769
           P +  + S  N    L     D     +T E EE     + +   KINE++  +L+ Y +
Sbjct: 846 PAITQVPSGTNISNNLNSTKIDNTPGAETNEVEEAVNKLKREMDDKINELLKEKLEEYLE 905

Query: 770 SIE-AQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRI 828
           ++E AQNG++H LPV+V+P PRD+D A + WKGA VLAQ+K++EELY+T+ DWD+HGSRI
Sbjct: 906 TVEKAQNGNDHYLPVSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTNADWDVHGSRI 965

Query: 829 LQYKCLFTY 837
           LQYK +F Y
Sbjct: 966 LQYKSIFPY 974

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/754 (51%), Positives = 514/754 (68%), Gaps = 31/754 (4%)

Query: 91  SQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPA 150
           S   A K  + DP  A    KVP HLLEKRRLGR KAAE++A+K+K IGIEK ++  L  
Sbjct: 46  SNPNASKVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQ 104

Query: 151 TGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTNTEV 210
            GLF+P+ LINQKNYSSDYLK+D+QIFA+RERK+LRN                 N N   
Sbjct: 105 LGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRN----------------ANANQAT 148

Query: 211 PDYIAAAD-EDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEFQE 269
           PD     D E +D      T+VIHPGSR+L+IG A + +P  +P CVA+PK     +   
Sbjct: 149 PDMPEDDDQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTP 208

Query: 270 APLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPG 329
            P   E  EE+   K +IQ  F+ERMRYYKRKV  N+H+  V++N    P+ I + ND  
Sbjct: 209 EPQVDE--EEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLH 266

Query: 330 AINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEH 389
            ++WI+ +SK YYG +A +C    F +R PF KG  FN+ SPDY SLQ+L+ DV  LL+ 
Sbjct: 267 RVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKF 325

Query: 390 ALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYG 449
           ALS   +++  +Q   YKVV+V+PD F K++VETFIR L+T+++FQAVA+IQESLA CYG
Sbjct: 326 ALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYG 385

Query: 450 AGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDW 509
           AG   STCVV+IGAT T IAC+DEG V++NS+++LDYGGDD+TKLFA FLL+S FPYQD 
Sbjct: 386 AGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDL 445

Query: 510 DINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQ-SEQYEFKVFDEVSLAPLA 568
           D+NS  GW L E+LK+KY TFQDA+V +QLYNFIKR+P++  +E++EFKVFDEV  AP+ 
Sbjct: 446 DLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMG 505

Query: 569 LFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNN 628
           LF+P I+  L  K+     N  V SQLP S+D+FT   N+ +S+SQ  C     Y   + 
Sbjct: 506 LFFPHILRLLKDKNV--PVNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHR 563

Query: 629 NQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDV--AKMSSF 686
           +  I+ KLL+L +  +++QS     A+    YTPLEKAI++SITNA   +D   +K ++F
Sbjct: 564 DLDILQKLLNLPSEIEEYQSS--TCANLEPAYTPLEKAIVESITNACVSLDNNHSKAANF 621

Query: 687 YSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGES 746
           YSNILVVGG SK  +LDFILTDRINIWRPRLLS+ + P F  +++KQ K+ +   K  E 
Sbjct: 622 YSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEI 681

Query: 747 EEEDQ---SSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGAC 803
           ++E++     KK+ + I  ELQ+YW+ ++A  G+E + P NVLP PR+MD A L WKG  
Sbjct: 682 KDEEELAAQKKKLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGS 741

Query: 804 VLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           V A++KL+EELY++ +DWDI GSRILQYKC+F Y
Sbjct: 742 VFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/758 (50%), Positives = 524/758 (69%), Gaps = 32/758 (4%)

Query: 99  PRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVL 158
           P    A A  GKKVP HLLEKRRLGRIKAAEEFA+KLK+IGIEK ++  +  TGLF+P+ 
Sbjct: 47  PETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRPLP 106

Query: 159 LINQKNYSSDYLKKDEQIFALRERKTLRN-NTQTSSINNTPDVIDIKNTNTEVPDYIAAA 217
           LINQKNYSSDYL+KD+QIF++RERK+LR+ N    + +  P ++     +    D     
Sbjct: 107 LINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLLAEAGED----DLKLNG 162

Query: 218 DED-IDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDEFQEAPLKREQ 276
           DED ID ++   T+VIHPGSR L+IG + D  PL VPSCVA+ +     +  E   + ++
Sbjct: 163 DEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARRA--SQRLEPQQRYDK 220

Query: 277 PEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKK 336
            E+F E    IQ  F+ERMRYYKRK+  N+HEQV+SYN  ++P+ I + ND   I WIK 
Sbjct: 221 DEDFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIPEHNDLHRIEWIKD 280

Query: 337 SSKR--YYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAE 394
           + +   YYG  A +C  E F IR PF+  G+FNV  PDY+SLQ+L+NDV  L+  ALS  
Sbjct: 281 APEGTIYYGEGAERCLPENFVIRYPFS-NGAFNVECPDYSSLQELLNDVTKLITFALSET 339

Query: 395 GLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSS 454
            L + R+QF  YKV+L+IPDLF K++VE  IR LL+EM FQAVA+IQESLA CYGAG S+
Sbjct: 340 KLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSN 399

Query: 455 STCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSS 514
           STCV++IGA+ T I+C+DEG V++NS + L YGGDD+T+LF   LLQS FPY DW++N+ 
Sbjct: 400 STCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNFPYPDWNLNTR 459

Query: 515 HGWILAEELKKKYTTFQDANVAVQLYNFIKRVPD-QQSEQYEFKVFDEVSLAPLALFYPE 573
            GWILAE+LKK + TFQDA+VAVQL+NF KR P    +E++EFK+F+EV ++P+A FYP+
Sbjct: 460 QGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPGAEKFEFKLFNEVMISPMAYFYPQ 519

Query: 574 IISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIM 633
           I+S+L   +S    N  +  QLP SRD +T   ++ +S++Q     G +Y+  N +  I+
Sbjct: 520 ILSFLKPATSY---NKYMAQQLPESRDPYTYKPDNPKSIAQESAFTGKVYTDINKDLDII 576

Query: 634 SKLLDLQTSFDDFQSKPP-------MEADSRK--NYTPLEKAIIQSITNASTPI--DVAK 682
            KL+ +    +   S P        ++ ++R+  NYTPL+KAII+S+T AS  +  +++K
Sbjct: 577 RKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIESVTTASVLLGDNMSK 636

Query: 683 MSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGK 742
           + +FYSN+LV+GG SK+P LD ILTDRINIWRPRLLS+++ P  YKK+++  K ++   K
Sbjct: 637 LVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKVSEMVKQVENEIK 696

Query: 743 TG--ESEEE-DQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAW 799
               ESEEE  QS KK+ + I  EL+ YW+S++     EH+ P+ VLPPPR+MD + L W
Sbjct: 697 KNNPESEEEIAQSRKKLIKSIKIELENYWESVDPY---EHVYPIAVLPPPREMDPSMLTW 753

Query: 800 KGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           KG  V  +IKL EELY+T+ DW++ GSRIL+YKC+F Y
Sbjct: 754 KGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY 791

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/769 (50%), Positives = 523/769 (68%), Gaps = 32/769 (4%)

Query: 89  AKSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTL 148
           A + E     P      +   KKVP HLLEKRRLGRIKAAEEFA+KLK+IGIEK ++  +
Sbjct: 19  AAATEGKVTKPETGGVASTQSKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHI 78

Query: 149 PATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTNT 208
             TGLF+   LINQKNYSSDYL+KD+QIF++RERK LR+    S  N++  +I + +   
Sbjct: 79  SQTGLFRVHSLINQKNYSSDYLRKDDQIFSMRERKNLRSGNVNSITNSSQPLIALPDVQD 138

Query: 209 EVPDYIAAADEDI--DLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELNDE 266
           +  +     DED   D +D NT +VIHPGSR L+IG + D  PL +PSCVAI ++E   E
Sbjct: 139 D--EVKTNGDEDGLDDTADTNT-IVIHPGSRSLKIGLSTDVFPLSIPSCVAIARSE-QVE 194

Query: 267 FQEAPLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQN 326
               P + +  EEF      IQ  F+ERMRYYKRK+  N+HEQV+SYN   +P+ I + N
Sbjct: 195 VPSQP-RYDNDEEFMGNLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSKCQPEKIPEHN 253

Query: 327 DPGAINWIKKS---SKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDV 383
           D   I WIKKS   +K YYG  A +C  E F +R PF   GSFNV SP+Y SLQ+L+NDV
Sbjct: 254 DLHRIEWIKKSDASTKVYYGEYAERCLPEGFLLRYPFA-NGSFNVKSPNYNSLQELLNDV 312

Query: 384 ISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQES 443
           ++L+  ALS   LN+ ++QFS Y VVL+IPDLF KS+VE  IR L++EM FQAVA+IQES
Sbjct: 313 VNLITFALSETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALIQES 372

Query: 444 LAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSE 503
           LA CYGAG S+STCV++IG + T I+C+DEG V++NS + L YGGDD+TKLFA  LLQS 
Sbjct: 373 LASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSN 432

Query: 504 FPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPD-QQSEQYEFKVFDEV 562
           FPY+DW++N+  GW+LAE+LKK + TFQDA+VAVQL+NF KR P+   +E+YEFK+F+EV
Sbjct: 433 FPYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRNPNISGAEKYEFKLFNEV 492

Query: 563 SLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDL 622
            ++P+A FYP+I++ L         N  V+ QLP SRD +T   +D +S+S    L G  
Sbjct: 493 MVSPMAYFYPQILALLKPPVEV---NKYVQQQLPPSRDPYTCKPDDPQSVSNLGSLSGKW 549

Query: 623 YSGNNNNQLIMSKLLDLQ--------TSFDDFQSKPPME-ADSRKNYTPLEKAIIQSITN 673
           Y+  + +  I+ KL+ +          S D   S   +E  +   NY PL+KAII+S+TN
Sbjct: 550 YTEMSKDLDIVRKLISITDKVEALSANSSDGTASDTIVENTEEVSNYMPLDKAIIESVTN 609

Query: 674 ASTPI--DVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLA 731
           A+  +  +++K+++FYSN+L+VGG SK+P LD ILTDRINIWRPRLLS+++ P  YKK++
Sbjct: 610 AAVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVIYKKIS 669

Query: 732 KQAKDIKTAGKTG--ESEEE-DQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVLPP 788
              K +++  K    ESEEE  QS KK+ + I  EL+ YW+S++     EH+ P+ VLPP
Sbjct: 670 DMVKQVESEIKKNNVESEEEIQQSRKKLIKSIKIELENYWESVDPY---EHVYPITVLPP 726

Query: 789 PRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837
           PR+MD + L WKG  V  +IKL EELY+T  DW++ GSRIL+YKC+F Y
Sbjct: 727 PREMDPSMLTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKCIFDY 775

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/789 (46%), Positives = 506/789 (64%), Gaps = 56/789 (7%)

Query: 93  ERAKKHPRLDPAKAP------------PGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGI 140
           E   K P  +P+K P            P KKVP HLLEKRRLGRIKAAEEFAKKLK IGI
Sbjct: 9   ESPSKEPSKEPSKEPLLGSDGKISKDIPSKKVPQHLLEKRRLGRIKAAEEFAKKLKIIGI 68

Query: 141 EKIESTTLPATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTSSINNTPDV 200
           E+ E+  +      +PV +INQKNYSS+YLK D+QIF +RERK LR   QT   ++ P  
Sbjct: 69  ERQENEHIAQPITLKPVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSSAPAA 128

Query: 201 IDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPK 260
                  T   D    AD +    D   +++IHPGS  ++IG   D  P  VP+ VA+P 
Sbjct: 129 ----GIGTPALDDDNMADSNAIEDDELDSIIIHPGSSFIKIGPNYDIFPQQVPNLVAVPT 184

Query: 261 TELNDEFQEAPLKRE---QPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNS 317
                     P  +E     E F++LK  IQ  F+ERMRYYKR++  N+ EQ  ++N  S
Sbjct: 185 -----HGGTVPSPQEDISNNEIFQQLKDDIQFDFKERMRYYKRRIMPNSTEQAAAFNAKS 239

Query: 318 KPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQ 377
            P+++ D ND G I WIK  SK YYG +A +C    F++R PF   GSFN++ P+Y S Q
Sbjct: 240 DPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDFKLRSPFL-NGSFNLNEPNYNSFQ 298

Query: 378 DLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAV 437
           +++ DV  L+  +L+ E + +ER QFS Y+VVL++PDLF K+ VE+ I  LL E+ FQ++
Sbjct: 299 EILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVPDLFDKTFVESMIHLLLIELDFQSI 358

Query: 438 AIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFAL 497
           A+IQESLA CYGAG S+STCV++IGA  T IAC+D+G V++NS + L+YGGDD+T+LFA 
Sbjct: 359 ALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVVVKNSALRLNYGGDDITRLFAH 418

Query: 498 FLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVP----DQQSEQ 553
            LLQ++FPY DW+IN  +GW LAE LKK+  TFQDA++A+QLY+FIKR P      QS +
Sbjct: 419 MLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIAIQLYSFIKRDPYARKYTQSHK 478

Query: 554 YEFKVFDEVSLAPLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLS 613
           YE+K+FDEV  AP+ +F+P+I   +  K  QH  N  V  Q P S+DI+T   ND +SL+
Sbjct: 479 YEYKLFDEVMCAPMGIFFPDIFEVI--KPKQHKPNEYVIRQCPRSKDIYTLKPNDTKSLT 536

Query: 614 QSECLD--GDLYSGNNNNQLIMSKLLDLQT-------------SFDDFQSKPPMEADSRK 658
           Q  C+      YS  + +  I+ KLL+L T             S ++ Q    +E  + +
Sbjct: 537 QMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDDESAGSKEETQINDEIEDINLR 596

Query: 659 NYT----PLEKAIIQSITNASTPI--DVAKMSSFYSNILVVGGGSKIPALDFILTDRINI 712
            Y     PLEKAII+SITNAS  +  +++K++  YSNIL+VGG SKIPALDFILTDRINI
Sbjct: 597 QYNNLSMPLEKAIIESITNASMLLGDNMSKLNVLYSNILIVGGSSKIPALDFILTDRINI 656

Query: 713 WRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGESEEEDQSS----KKINEMISAELQAYW 768
           WRP+LLS+++     +K+ +  K  +T  K      + Q++    KK++++I AE++AYW
Sbjct: 657 WRPKLLSISALSTLMEKIGEVIKSYETDNKLDLEPTDPQAAIAYKKKLSKLIKAEIEAYW 716

Query: 769 DSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRI 828
           DS++  +  + LLP+N+LPPP DMD + L WKG  V ++IKL+EEL +T  DW++ G+RI
Sbjct: 717 DSLQTLHSDDDLLPINILPPPHDMDPSMLTWKGGSVFSKIKLLEELNITKQDWNMLGNRI 776

Query: 829 LQYKCLFTY 837
           LQYKC+F Y
Sbjct: 777 LQYKCIFEY 785

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 101/235 (42%), Gaps = 27/235 (11%)

Query: 302 VPFNAHEQVVSYNKNSKPQMI-EDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPF 360
           V F   +++  Y +   P ++ E Q+  G++N++ +             SKE      P 
Sbjct: 21  VQFGLQDEMFVYPELEIPTVVYEHQDSSGSVNYLSRPKD--------SDSKEIH----PI 68

Query: 361 TKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSH 420
             G   N+     A LQ L    +S+L     ++  + +R + S    +L+    + + H
Sbjct: 69  VNGEIVNID----AFLQFLKIVYVSILNEKSLSDPNSFDR-ELSNIPFLLISHHSWSQFH 123

Query: 421 VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480
           +E    F+   +Q  +   +  SLA  Y      ++C+++IG THT I  + +   +++ 
Sbjct: 124 IEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYLQMDHI 183

Query: 481 LVSLDYGG----DDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQ 531
             S+ YGG    D L+K     +L    P Q  D+  S  + +  E  KK + F+
Sbjct: 184 ASSIKYGGQTINDSLSK-----ILTDLSPEQIEDLKKSAIFEVLSEDAKKESAFK 233

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%)

Query: 401 AQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVN 460
           AQ S   + L+    + +S  E   +F+   M+     I+  SLA  Y  G   +  V++
Sbjct: 41  AQVSNIPMFLITHYSWSQSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVID 100

Query: 461 IGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFL 499
           IG  HT I  I + T LE    S   GGD +    A FL
Sbjct: 101 IGGAHTDIIPIVDYTPLEYLAYSAPVGGDAINAKLASFL 139

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 5/92 (5%)

Query: 404 SQYKVVLVIPDLFHKSH----VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVV 459
           S+  +V+ +P + ++      VE ++     +++   + I+ E L      G+SSS  V+
Sbjct: 114 SELPLVITLPSMTNRELETKIVENYMELAFEKLKVPVLQIVVEPLGIMLSTGKSSS-LVI 172

Query: 460 NIGATHTSIACIDEGTVLENSLVSLDYGGDDL 491
           ++GAT  ++  I +GT+L NS+V   + GD L
Sbjct: 173 DVGATGCTVTPIIDGTILRNSIVKSRFAGDFL 204

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 401 AQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVN 460
           A+ S   +++V    + +  +E   +F+   +Q     ++  SLA  Y      + C+++
Sbjct: 103 AELSSIPLLMVAHHSWSQIQLEVITQFVFEALQINNALLLPASLASSYAMSSLQNCCIID 162

Query: 461 IGATHTSIACIDEGTVLENSLVSLDYGG----DDLTK 493
           IG THT I  I + T LE     + YGG    D L+K
Sbjct: 163 IGTTHTDIIPIIDYTPLEALSSKIAYGGQLINDQLSK 199

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 55/116 (47%)

Query: 384 ISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQES 443
           +S+L    + +G +   A+ S   V +V    + +  +E+ ++FL   ++     ++  +
Sbjct: 87  VSILSKRSNLKGPDSFDAELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTA 146

Query: 444 LAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFL 499
           L+  Y  G   + CV++IG  HT I  + +   L     ++ YGG+ + +  A  L
Sbjct: 147 LSSTYAMGSLQNCCVIDIGTAHTDIIPVVDYAPLVPLTSTIPYGGNTINENLARIL 202

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 1/115 (0%)

Query: 385 SLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESL 444
           S+L H + AE  +   A  S   ++L+    + +   E   +++  EM+     ++  +L
Sbjct: 82  SILSHWI-AEHPDTWEAHASNIPMLLLTHYSWSQREQELITQYVFEEMRLNHFMVVPAAL 140

Query: 445 AGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFL 499
           +  Y  G   +  V++IGATHT I  I +   L+    S   GGDD+    A  L
Sbjct: 141 SISYAFGSIQNCLVIDIGATHTDIVPIVDYVPLDYMAYSAPIGGDDINAKLATLL 195

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 421 VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480
           VE +    L ++Q  A+ I+ E LA     G+SS+  V+++GA  T++  I +GTV+ + 
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKSSA-LVIDVGARGTTVTPIVDGTVVRSG 171

Query: 481 LVSLDYGGDDL 491
           ++   +GGD L
Sbjct: 172 VMKSRFGGDFL 182

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 400 RAQFSQYKVVLVIPDL---FHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSST 456
           R    +Y +V+ IP +        +E +   +    +F    II E LA     G+SS  
Sbjct: 100 RCSPEEYPLVITIPSMKKEIDGEVLEKYFSLVFERFKFPVFQIILEPLAITLSLGKSSG- 158

Query: 457 CVVNIGATHTSIACIDEGTVLENSLVSLDYGG 488
            V+++G++   +  I +GTV++N+++S  YGG
Sbjct: 159 LVIDMGSSGCRVTPIIDGTVIKNAVLSSKYGG 190

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 64/143 (44%), Gaps = 7/143 (4%)

Query: 358 CPFTKGGSFNVSSPDYASLQDLINDV-ISLLEHALSAEGLNLERAQFSQYKVVLVIPDLF 416
           CP   G   N+ +      Q+ +  + ISLL+        + E + F+   ++L+    +
Sbjct: 65  CPIENGMIINLEA-----FQEFLKYIYISLLKQKHDENADSFEYS-FTNIPLLLLNNHKW 118

Query: 417 HKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTV 476
            +  +E+   F+  +++   + ++  SL   Y      + C+++IG  HT I  I + T 
Sbjct: 119 SQFQMESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTT 178

Query: 477 LENSLVSLDYGGDDLTKLFALFL 499
           + +   +L+YGG  +  +    L
Sbjct: 179 INHLSNTLNYGGSYINTILQKLL 201

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 63/131 (48%), Gaps = 17/131 (12%)

Query: 408 VVLVIPDLFHKSH------VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNI 461
           V++ IP    K+       +E + +    + +   + I+ ESL+   G G+ +S  V++I
Sbjct: 102 VLITIPSSISKNEDIENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTS-LVIDI 160

Query: 462 GATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDI-----NSSHG 516
             + +S+  I +G +++N +V   YGGD     F  + +  +F   D D+     NSS+ 
Sbjct: 161 SGSGSSVTPIVDGVIIKNGIVKSKYGGD-----FLDYQIIKKFSTIDEDLEEEMTNSSNI 215

Query: 517 WILAEELKKKY 527
           W+ +    K +
Sbjct: 216 WVSSNSWIKNF 226

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 71/162 (43%), Gaps = 17/162 (10%)

Query: 332 NWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHAL 391
           N I  +   Y G+ A K S+   R+R P  +G            + +  +D+ +L  H  
Sbjct: 50  NAISNNDLTYIGNRAQK-SRGLLRLRHPMNRG------------IVENWDDMETLWSHTF 96

Query: 392 SAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAG 451
           +     L+   F ++ +++    L  + + +        +  F AV I   S    Y +G
Sbjct: 97  NDI---LKINDFDEHPLLITEAPLNPEKNRDKMCEVFFEKFDFAAVYIANPSTLSLYASG 153

Query: 452 QSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTK 493
           +++  CV++ G  + S   I EG  L +S+  +D GG D+T+
Sbjct: 154 RTTG-CVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTE 194

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 359 PFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHK 418
           P   G   +++    A LQ L    +SLL    + +G +   A+ S   ++L+    + +
Sbjct: 67  PIQNGSIIDIN----AFLQFLRLIYVSLLSDR-ANKGQDAFEAELSNIPLLLITHHSWSQ 121

Query: 419 SHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLE 478
           S +ET  +++   ++   +  +  SLA  Y      + C++++G  HT I  I +   L+
Sbjct: 122 SDLETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLD 181

Query: 479 NSLVSLDYGG----DDLTKLF 495
           + + SL  GG    D L KL 
Sbjct: 182 HLVSSLPVGGQSINDSLKKLL 202

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 405 QYKVVLVIPDLFHKSHVETFIRFLLTEMQFQ-----AVAIIQESLAGCYGAGQSSSTCVV 459
           +Y +V+ IP       V+  I     E+ F+      + II E LA     G+SSS  VV
Sbjct: 105 EYPLVITIPS--ANKDVDEIILKKYFELAFETFNVPVLQIIIEPLAVALSLGKSSS-LVV 161

Query: 460 NIGATHTSIACIDEGTVLENSLVSLDYGGDDL 491
           N+GA+  ++  I +GTV++++++   YGGD L
Sbjct: 162 NLGASGCNVTPIVDGTVIKHAVMKSKYGGDFL 193

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 80/187 (42%), Gaps = 17/187 (9%)

Query: 398 LERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTC 457
           L+ +   ++ +V+    L  K + E     L       A+ I   ++   Y +G+++  C
Sbjct: 100 LKVSNLGEHPLVVTEAPLNPKPNREKMCETLFESFNIPALYIANPAVLSLYASGRTTG-C 158

Query: 458 VVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGW 517
           VV  G  + S   I EG  L  S+  +D GG D+TK   L L +S      W  +SS   
Sbjct: 159 VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKST---GMWLYSSSEQE 215

Query: 518 ILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSL--------APLAL 569
           I+   L K+   +  +N   +   F+    DQ+ +   FK+ D  +L        AP  L
Sbjct: 216 IV--RLIKENGCYICSNHKKEEEKFLL---DQEKKSISFKLPDGKNLVIGPGRFRAPEIL 270

Query: 570 FYPEIIS 576
           F P +I 
Sbjct: 271 FNPLLIG 277

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 73/162 (45%), Gaps = 15/162 (9%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           E   + L       A+ +   ++   Y +G+++  CV++ G  + S   I +G  L  S+
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASGRTTG-CVIDCGEGYCSTVPIYDGFALPASM 183

Query: 482 VSLDYGGDDLTKLFALFLLQSE----FPYQDWDINSS---HGWILAEELKKKYTTFQDAN 534
           + +D GG D+TK     L +S     F   + +I  +       LA ++KK+  T+   +
Sbjct: 184 MRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQES 243

Query: 535 VAVQLYNFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIIS 576
              Q    + ++PD +      ++ ++   AP  LF P+II 
Sbjct: 244 ---QDLTSVFKLPDGKC----IEIGNDRYRAPEILFSPQIIG 278

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           ET    L     F A+ +   ++   Y  GQ++  CV+  G  +++   + +G  L +S+
Sbjct: 128 ETMCEILYETFNFDALYVAHPAVLSLYATGQTTG-CVLECGEGYSASTPVYQGFALPSSI 186

Query: 482 VSLDYGGDDLTKLFALFLLQS 502
             +D GG D+T+    ++ +S
Sbjct: 187 RRIDIGGRDITQELQFYIRKS 207

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 94/214 (43%), Gaps = 17/214 (7%)

Query: 400 RAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVV 459
           R    ++ V+L    +  KS+ E   + +       A  +  +++   Y +G+++   V+
Sbjct: 95  RVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-IVL 153

Query: 460 NIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWIL 519
           + G   T +  I  G  + ++++ +D  G DLT      L +  + +     +++    +
Sbjct: 154 DSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREI 208

Query: 520 AEELKKK--YTTF---QDANVAVQLYNFIK--RVPDQQSEQYEFKVFDEVSLAPLALFYP 572
             ++K+K  Y      Q+   A Q  +  K   +PD Q       + +E   AP ALF+P
Sbjct: 209 VRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELPDGQV----ITIGNERFRAPEALFHP 264

Query: 573 EIISYLHSKSSQHSGNSNVESQLPASRDIFTNTV 606
            ++S   S   Q + NS ++  +   +D++ N V
Sbjct: 265 SVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIV 298

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 413 PDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACID 472
           PD+   S +E +      +++     I+ E LA     G+SS+  V+++GA+  ++  I 
Sbjct: 115 PDM---SILERYYELAFDKLKVPVFQIVIEPLAIALSMGKSSA-FVIDMGASGCNVTPII 170

Query: 473 EGTVLENSLVSLDYGGDDL 491
           +G V++N++V   +GGD L
Sbjct: 171 DGIVVKNAVVRSKFGGDFL 189

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/101 (19%), Positives = 47/101 (46%)

Query: 401 AQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVN 460
           A+ S   ++L+    + +S +E   +++   ++   +  +  SLA  Y      + C+++
Sbjct: 104 AELSNIPLLLITHHFWSQSDLERITQYIFESLEINNLIQLPASLAATYSMISLQNCCIID 163

Query: 461 IGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQ 501
           +G  HT +  I +   L++ + S+  GG  + +     L Q
Sbjct: 164 VGTYHTDVIPIVDYAQLDHLVSSIPMGGQSINESLKKLLPQ 204

>Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 73/164 (44%), Gaps = 11/164 (6%)

Query: 338 SKRYYGSEALKCSKE--TFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEG 395
           SK+  GS+A   S +  T  +  P   G   ++++  +     LI   +S+L    S   
Sbjct: 44  SKKQDGSDAYHSSNKDNTAELVNPIQNGRIIDINA--FTQFLRLI--YVSILSDRASKNQ 99

Query: 396 LNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSS 455
              E A+ S   ++L+    + +S +E   +++   ++   +  +  SLA  Y      +
Sbjct: 100 DAFE-AELSNIPLLLITHHSWSQSDLERITQYVFESLEINNLIQLPASLAATYSMISLQN 158

Query: 456 TCVVNIGATHTSIACIDEGTVLENSLVSLDYGG----DDLTKLF 495
            C++++G  HT I  I +   L++ + S+  GG    D L KL 
Sbjct: 159 CCIIDVGTYHTDIIPIVDYAQLDHLVSSIPIGGQSINDSLKKLL 202

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 4/99 (4%)

Query: 401 AQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVN 460
           A+ S   ++L+    + +S +E   +++   ++   +  +  SLA  Y      + C+++
Sbjct: 104 AELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIID 163

Query: 461 IGATHTSIACIDEGTVLENSLVSLDYGG----DDLTKLF 495
           +G  HT I  I +   L++ + S+  GG    D L KL 
Sbjct: 164 VGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLL 202

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 413 PDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACID 472
           PD+   + +E +      ++      I+ E LA     G+SS+  V++IGA+  ++  I 
Sbjct: 115 PDM---AILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSA-FVIDIGASGCNVTPII 170

Query: 473 EGTVLENSLVSLDYGGDDL 491
           +G V++N++V   +GGD L
Sbjct: 171 DGIVVKNAVVRSKFGGDFL 189

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 94/214 (43%), Gaps = 17/214 (7%)

Query: 400 RAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVV 459
           R    ++ V+L    +  KS+ E   + +       A  +  +++   Y +G+++   V+
Sbjct: 95  RVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG-IVL 153

Query: 460 NIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWIL 519
           + G   T +  I  G  L ++++ +D  G DLT      L +  + +     +++    +
Sbjct: 154 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF-----STTAEREI 208

Query: 520 AEELKKK--YTTF---QDANVAVQLYNFIK--RVPDQQSEQYEFKVFDEVSLAPLALFYP 572
             ++K+K  Y      Q+   A Q  +  K   +PD Q       + +E   AP ALF+P
Sbjct: 209 VRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQV----ITIGNERFRAPEALFHP 264

Query: 573 EIISYLHSKSSQHSGNSNVESQLPASRDIFTNTV 606
            I+S   +   Q + NS ++  +   ++++ N V
Sbjct: 265 SILSLESAGIDQTTYNSIMKCDVDVRKELYGNIV 298

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 74/174 (42%), Gaps = 31/174 (17%)

Query: 418 KSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVL 477
           +S+ E  +          A+ +    +   Y +G+++  CVV+ G  + S   + EG  L
Sbjct: 118 ESNKEKMLEVFFETFNIPAICVSIPGVLSLYASGRTTG-CVVDCGEGYCSSVPVCEGYTL 176

Query: 478 ENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAV 537
            +S+  ++ GG D+TK    F L+ E          S  W+ +   ++   T ++ +  V
Sbjct: 177 ASSIKRINLGGIDVTKQLQ-FQLRKE----------SGVWLFSSGERELVRTMKEKSCYV 225

Query: 538 QLYNFIKRVPDQQSEQYE-------FKVFDEVSL--------APLALFYPEIIS 576
            L     ++ D++   +E       FK+ D   L        AP  LF P+II+
Sbjct: 226 SL----NQLKDEEKFTFEPGKMNTNFKLPDGNMLTLSKSRFRAPEILFQPQIIA 275

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 421 VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480
           +E +      +++     I+ E LA     G+SS+  V+++GA+  ++  I +G V++N+
Sbjct: 120 LERYYELAFDKLKVPVFQIVIEPLAIALSMGKSSA-FVIDMGASGCNVTPIIDGIVVKNA 178

Query: 481 LVSLDYGGDDL 491
           +V   +GGD L
Sbjct: 179 VVRSKFGGDFL 189

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 48/95 (50%), Gaps = 4/95 (4%)

Query: 400 RAQFSQYKVVLVIP---DLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSST 456
           + +  ++ +V+ +P   D      +E +      +     + +I E LA     G+SS+ 
Sbjct: 93  KCKSDEFPLVITVPIMKDAVALRVMERYFDLAFNKFNVPVLQVIIEPLAIALSMGKSSA- 151

Query: 457 CVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDL 491
            VV++G++  ++  + +GTV +NS++   Y GD L
Sbjct: 152 LVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAGDFL 186

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 408 VVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTS 467
           V + +P     +    F   +L +++   + +I E LA     G+S++  VV++GA+  +
Sbjct: 94  VCITVPPDLSATVRSQFHELVLCKLRAPVLQLISEPLAVTLSLGRSTAL-VVDVGASKVT 152

Query: 468 IACIDEGTVLENSLVSLDYGGDDL 491
           +  I +G+V++  ++   Y GD L
Sbjct: 153 VTPIVDGSVVKTGILRSRYAGDFL 176

>NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {ON}
           Anc_2.593 YMR033W
          Length = 501

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 42/95 (44%)

Query: 401 AQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVN 460
            + S    +L+    + +  +E   +F+   ++     ++  SL+         + C+++
Sbjct: 108 TELSNIPFLLITHYTWSQPQLEKITQFIFESLKILNAMLLPSSLSTSVAMISLQNCCIID 167

Query: 461 IGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLF 495
           IG +HT I  I + T L     +L  GGD++ K  
Sbjct: 168 IGKSHTDIIPIIDYTPLSFLASTLPMGGDNINKFL 202

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           E   + L       A+ I   ++   Y +G+++  CVV+ G  + S   I +G  L  S+
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASGRTTG-CVVDCGEGYCSTVPIYDGFALPASI 183

Query: 482 VSLDYGGDDLTK 493
           + +D GG D+T+
Sbjct: 184 MRMDIGGRDITE 195

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 413 PDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACID 472
           PD+   S +  +      ++      I+ E LA     G+SS+  V+++GA+  ++  I 
Sbjct: 115 PDM---SILRRYYELAFDKLNVPVFQIVIEPLAIALSMGKSSA-FVIDMGASGCNVTPII 170

Query: 473 EGTVLENSLVSLDYGGDDL 491
           +G V++N++V   +GGD L
Sbjct: 171 DGIVVKNAVVRSKFGGDFL 189

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           E   + +       A+ +   ++   Y +G+++  CVV+ G  + S   I +G  L  S+
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASGRTTG-CVVDCGEGYCSSVPIYDGFALPASI 183

Query: 482 VSLDYGGDDLTK 493
           + +D GG D+T+
Sbjct: 184 MRMDIGGGDITE 195

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 419 SHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLE 478
           S+ +     L      QA+ +   ++   Y +G+ S  CV++ G  ++    + +G  L+
Sbjct: 119 SNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISG-CVLDCGDGYSCSVPVYQGYTLK 177

Query: 479 NSLVSLDYGGDDLTKLFALFLLQS 502
           +++  +D GG DLT+   L L +S
Sbjct: 178 SAIKRIDLGGRDLTEQLQLQLRKS 201

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 95/240 (39%), Gaps = 34/240 (14%)

Query: 398 LERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTC 457
           LE  Q  ++ VVL       K   E     L  +    A+   ++ +   YG G+++  C
Sbjct: 99  LEIEQLQEHPVVLTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTG-C 157

Query: 458 VVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGW 517
            V+ G     I  + +G ++  S    + GG  +T    L LL+   P  +   N  +G 
Sbjct: 158 SVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTM-LDLLRHNHPKLE---NGQNGI 213

Query: 518 ILAEELKKKYTTF-QDANVAVQLYNFIK--------RVPDQQSEQYEFKVFDEVSLAPLA 568
            L   +K++     +D    ++ Y  I         R+PD    +   + F+    AP  
Sbjct: 214 ELIRSIKERCCVLSKDFYNEIRAYELITSKTSNNKYRLPDGNIIEIGSERFE----APEI 269

Query: 569 LFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNN 628
           +F P+   Y               S++P  + I  N+++    L +S+ L+  + SG ++
Sbjct: 270 IFNPQAYGY---------------SEIPLQKMII-NSISRAGILPRSQLLESIVLSGGSS 313

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 69/151 (45%), Gaps = 17/151 (11%)

Query: 421 VETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480
           V  +      +++   + I+ E LA      +SS+  V++IGA    I  + +GTV+++ 
Sbjct: 119 VHKYFELAFEKLRVPTLQIVVEPLAIALSMSKSSA-LVIDIGARECKITPVIDGTVVKSG 177

Query: 481 LVSLDYGGDDL----TKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVA 536
           ++   + GD L    T+L    L  +E   Q W   +S  WI  ++ K       D N+ 
Sbjct: 178 VMKSKFAGDFLDFQVTELLKDRLPPAESSCQMW--YNSQTWI--QQFKNTMLQVCDRNLV 233

Query: 537 VQLYNFIKRVPDQQSEQYE---FKVFDEVSL 564
                 ++R+ ++QS Q +   F+ F   SL
Sbjct: 234 E-----VQRLHEEQSNQLQPVGFQQFTSNSL 259

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           E   + L       A+ +   ++   Y +G+++  CVV+ G  + S   I +G  L  S+
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASGRTTG-CVVDCGEGYCSTVPIYDGFALPASM 183

Query: 482 VSLDYGGDDLTK 493
           + +D GG D+T+
Sbjct: 184 MRMDIGGADITE 195

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 408 VVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTS 467
           V+ V PDL   +    ++   L +++     ++ E LA     G+++S  VV+IGA+  +
Sbjct: 94  VITVPPDLSAGTR-SKYLELALEKLKVPVFQMVVEPLAISLSLGRNTS-LVVDIGASKIT 151

Query: 468 IACIDEGTVLENSLVSLDYGGDDL 491
           +  I +G+V++ +++   + GD L
Sbjct: 152 VTPIIDGSVVKPAVLRSKFAGDFL 175

>KAFR0I01580 Chr9 complement(332644..334023) [1380 bp, 459 aa] {ON}
           Anc_2.593 YMR033W
          Length = 459

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 47/99 (47%)

Query: 401 AQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVN 460
            + S   ++LV    + +S +E   +F+   +    + ++  SLA  Y      + CV++
Sbjct: 100 GELSNIPIILVTHYSWSQSQLERITQFVFESLNVNNLLLLPSSLAASYSMVSLQNCCVID 159

Query: 461 IGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFL 499
           IG  HT I  I + T L +   S+  GGD +T+  A  L
Sbjct: 160 IGKEHTDIIPIVDYTPLNHLASSIPNGGDFVTENLAKIL 198

>KAFR0E04380 Chr5 complement(878026..879264) [1239 bp, 412 aa] {ON}
           Anc_4.368 YJR136C
          Length = 412

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 357 RCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLF 416
           R  FT G  + V  P   + + L+N +I++LE  + A G + ER    QY  + +I  LF
Sbjct: 308 RIIFTVG-EYLVRDPFITTSKSLVNAIINVLESVIDAAGYDNERIIAHQYDFLAMIIILF 366

Query: 417 HKSHVETFIRFLL 429
            K   E  +  L+
Sbjct: 367 EKCENEGIVNDLI 379

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 426 RFLLTEMQFQ-----AVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENS 480
           R ++ E  F+     ++ +   S+   Y +G ++  CVV+ G  + S   I EG VL  S
Sbjct: 123 RHIMCERLFETFNIPSLYVANPSVLSLYASGNTTG-CVVDCGDGYCSSTPIYEGFVLPAS 181

Query: 481 LVSLDYGGDDLTK 493
           +  ++ GG D+T+
Sbjct: 182 IRKMEVGGRDITE 194

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 408 VVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTS 467
           V  V PDL      + ++   L  ++     ++ E LA     G++++  VV++GA  ++
Sbjct: 91  VATVAPDLPDAVRAQ-YLEMALGRLKIPVFQLVVEPLAVALSLGRNTA-LVVDVGAAKST 148

Query: 468 IACIDEGTVLENSLVSLDYGGDDL 491
           +  I +GTV++ ++    + GD L
Sbjct: 149 VTPIIDGTVVQTAVARSKFAGDFL 172

>KAFR0L01080 Chr12 complement(202561..204441) [1881 bp, 626 aa] {ON}
           Anc_7.266 YER077C
          Length = 626

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 511 INSSHGWILAEELKKKYT--------TFQDANVAVQLYNFIKRVPDQQSEQYEFKVF 559
           + S+H  +L  E  KK +        T +   + ++L+NFI R   QQS Q++FK++
Sbjct: 429 LKSAHTLVLCYEAFKKQSLKSRINSSTIETEKLLIELHNFIIRTEGQQSTQFDFKIY 485

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 224 SDANTTLVIHPGSRHLRIGFAKDEVP-LVVPSCVAIPKTELNDE-----FQEAPLKREQP 277
            D  T +VI PGS    IGF+  + P  ++PSC    K E  D      F E  +   +P
Sbjct: 11  GDEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAPKKIFAEQSIGIPRP 70

Query: 278 EEFEELKSTIQHSF 291
           +   E+K  +Q+S 
Sbjct: 71  D--YEIKPIVQNSM 82

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 48/100 (48%), Gaps = 1/100 (1%)

Query: 403 FSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIG 462
            +++ +++  P L + ++ +     L     F AV I    +   Y +GQ++  C V+ G
Sbjct: 107 LNEHPILITEPPLNNMANRQKMCEALFEIFGFPAVYISVSPVLSLYASGQTTG-CAVDCG 165

Query: 463 ATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQS 502
             + +   +  G  L +S+  +D GG D+T+     +L++
Sbjct: 166 DGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKN 205

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           E     L       A+ +   ++   Y  G+++  CV++ G  + S   I EG  L  S+
Sbjct: 121 EHMCEILFESFNIPAIHVENPAVLALYSGGRTTG-CVIDCGEGYCSAVPIYEGFALTPSI 179

Query: 482 VSLDYGGDDLTK 493
             +D GG ++T+
Sbjct: 180 RRIDIGGREITE 191

>KLLA0C12507g Chr3 complement(1063093..1064427,1064541..1064570)
           [1365 bp, 454 aa] {ON} similar to uniprot|Q05123
           Saccharomyces cerevisiae YMR033W ARP9 Actin-related
           protein involved in transcriptional regulation; subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 454

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 32/72 (44%)

Query: 422 ETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSL 481
           E   R     M+ +   I+  SLA  +  G   +  +++IG  HT +  I + T L   +
Sbjct: 118 ELLCRTAFEAMKLKHFVILPSSLANSFAYGSLQNCLIIDIGKFHTDVVPIMDYTPLTCFI 177

Query: 482 VSLDYGGDDLTK 493
             +  GG+ + K
Sbjct: 178 RQITSGGNSINK 189

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 420 HVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLEN 479
            +E   + +   ++  +  ++  SLA  +      ++ V++IG THT I  I + + L +
Sbjct: 131 QIEKINQHVFEILKLNSFLMLPTSLAATHAMAALQNSIVIDIGKTHTDILPIVDYSQLTH 190

Query: 480 SLVSLDYGGDDL-TKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDAN 534
              ++  GG+D+ T L ++    S+   +D  +++ +  +L  E KK Y     A+
Sbjct: 191 FSSTIPIGGNDINTHLKSILPSLSDDQIEDLKLSNIYE-VLNAEAKKNYADLHQAD 245

>CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033w ARP9
           Actin-related protein
          Length = 462

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 44/84 (52%)

Query: 408 VVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTS 467
           V+LV    + +  +E   +F+   ++   + ++  SLA  +      ++ V++IG THT 
Sbjct: 114 VLLVTHHTWSQLQLEMITKFVFENLEINNLLLLPLSLASTFAMVSLQNSLVIDIGTTHTD 173

Query: 468 IACIDEGTVLENSLVSLDYGGDDL 491
           I  + + T +E+   +++ GGD +
Sbjct: 174 IIPVVDYTPMEHLTSTINLGGDSI 197

>NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 11/174 (6%)

Query: 367 NVSSPDYASLQDLINDV-ISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFI 425
           N S  D  +  +LI  + +S+L         N   ++ S    +L+    + +  +E   
Sbjct: 69  NGSIVDLDAFLNLIKLIYVSILAEKHKQNPENAFTSELSNIPFLLISHHSWSQYQLEKIT 128

Query: 426 RFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLD 485
           +F+   ++ +    +  SLA           C+++IG  HT I  I + T + +   ++ 
Sbjct: 129 QFVFETLKIKNFMFLPTSLAASIAMISLQHCCIIDIGYNHTDICPIMDYTPIAHLTTTIP 188

Query: 486 YGGDDLTKLFALFLLQSEFPYQDWD-----INSSHGWILAEELKKKYTTFQDAN 534
            GG  + +      L+ + P    D       SS   +L +E  KKY+ F D +
Sbjct: 189 IGGTSINE-----SLRRQLPNLTVDQIETLKKSSIFEVLNDEDVKKYSKFGDVH 237

>TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8.331
           YDR150W
          Length = 2382

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 262 ELNDEFQE-APLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQ 309
           ELND+  E   LK  QP EF+ L   I+H+ R+ +R  +RKVP   H Q
Sbjct: 235 ELNDQIGEFKKLKVMQPIEFDALNKEIKHA-RQTIRKLRRKVP-EVHRQ 281

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/98 (20%), Positives = 48/98 (48%), Gaps = 7/98 (7%)

Query: 400 RAQFSQYKVVLVIPDL------FHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQS 453
           +   ++Y ++ ++P +        K   E + +    + +   + +I   LA  +  G+ 
Sbjct: 110 KCDMTEYPLLALMPVIGKDKKELEKQIKEEYYKLAFEKFRIPILYLIPSPLAIAFSLGKK 169

Query: 454 SSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDL 491
           S+  VV+IGA    +  I +GT+++++++   + GD L
Sbjct: 170 SA-LVVDIGAKTCQVTPILDGTIIKDAVMKSKFAGDFL 206

>NCAS0C03570 Chr3 complement(712859..715489) [2631 bp, 876 aa] {ON}
           Anc_3.163 YOL063C
          Length = 876

 Score = 31.6 bits (70), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 16/108 (14%)

Query: 684 SSFYSNILVVG-GGSKIPAL-------DFILTDRINIWRPRLLSLTSFPNFYKKLAKQAK 735
           S F S I +   G SK+  +       D  L DR   + P +L   +     KKL +Q+K
Sbjct: 27  SCFDSKIFIANDGSSKVSGMSSIKRYFDMSLRDRDGDFPPHVLE--AVKKHLKKLQEQSK 84

Query: 736 DIKTAGKTGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPV 783
                 +  E+EE+  S  K ++ +   L+  W S  AQN +E LLP+
Sbjct: 85  G---GHRITENEEDWISQVKASKDL---LEPVWSSTTAQNPAELLLPI 126

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,657,630
Number of extensions: 3901300
Number of successful extensions: 16237
Number of sequences better than 10.0: 117
Number of HSP's gapped: 16662
Number of HSP's successfully gapped: 119
Length of query: 837
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 719
Effective length of database: 39,950,811
Effective search space: 28724633109
Effective search space used: 28724633109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)