Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A034005.476ON81039016630.0
ZYRO0D11286g5.476ON7171565643e-61
NCAS0H022805.476ON6571394847e-51
NDAI0C013805.476ON7671274445e-45
Kwal_55.212545.476ON8531464431e-44
AFR136C5.476ON6951444362e-44
KLLA0E03191g5.476ON7701504365e-44
KLTH0F14982g5.476ON8281354376e-44
CAGL0I07183g5.476ON7711534294e-43
SAKL0G03586g5.476ON8531324314e-43
Skud_15.3035.476ON7481504294e-43
Smik_15.3195.476ON7621394294e-43
YOR140W (SFL1)5.476ON7661484294e-43
Suva_8.1915.476ON7581484285e-43
KNAG0B040405.476ON8521664271e-42
Ecym_23125.476ON7561224196e-42
TDEL0G010105.77ON3981492241e-18
NDAI0D034304.385ON5971212219e-18
Kpol_1062.85.77ON4331432152e-17
NCAS0E038705.77ON3931452098e-17
TBLA0A107004.385ON5871182102e-16
Kpol_265.24.385ON5491542074e-16
TPHA0C001504.385ON5101202064e-16
SAKL0H02354g5.77ON3851262035e-16
KLLA0A10219g4.385ON4751182039e-16
ZYRO0C11506g5.77ON3341491962e-15
KAFR0B069904.385ON5451191976e-15
SAKL0B12408g4.385ON4651181949e-15
CAGL0F08195g5.77ON3251261901e-14
TPHA0H011305.77ON4391471931e-14
Skud_7.2086.209ON8361211952e-14
KLTH0D17182g4.385ON4641471912e-14
KAFR0B044105.77ON4651361903e-14
NCAS0A064504.385ON6091161923e-14
TDEL0D003204.385ON5471181913e-14
TBLA0A020006.209ON627641905e-14
TPHA0E028806.209ON7181431905e-14
CAGL0F09097g4.385ON6301171896e-14
YGR249W (MGA1)5.77ON4561401878e-14
ZYRO0G00484g4.385ON6471501889e-14
ADL388W4.385ON4821171851e-13
TPHA0A052505.77ON6011511861e-13
YHR206W (SKN7)4.385ON6221161861e-13
Smik_8.2964.385ON6251161861e-13
KAFR0C022506.209ON613651861e-13
YGL073W (HSF1)6.209ON8331211872e-13
Ecym_74744.385ON4961181852e-13
Suva_7.5445.77ON4691301842e-13
Skud_8.2734.385ON6231161852e-13
Kpol_1033.466.209ON717651852e-13
Smik_7.2096.209ON837651862e-13
Suva_15.4124.385ON6171161842e-13
Suva_7.1976.209ON8461211853e-13
KNAG0F020206.209ON771671843e-13
ZYRO0G08734g6.209ON5721251824e-13
TDEL0E051706.209ON546671814e-13
TBLA0G02700singletonON445641805e-13
Smik_16.585.77ON4531261805e-13
Kwal_47.167704.385ON4611181798e-13
SAKL0A04576g6.209ON557651799e-13
Kwal_56.240366.209ON567651781e-12
KLTH0H04290g6.209ON569671781e-12
KLLA0D03322g6.209ON6771231781e-12
NDAI0B009405.77ON5261451762e-12
Skud_7.5825.77ON4521401762e-12
KLLA0A05368g5.77ON4121551742e-12
NDAI0I011106.209ON9051081753e-12
AFL085C6.209ON5691521744e-12
Ecym_22086.209ON529651735e-12
KNAG0M001804.385ON6151161726e-12
KLTH0H00814g5.77ON3901551672e-11
TBLA0E049804.385ON7911201692e-11
AEL216C5.77ON4501391662e-11
CAGL0H03443g6.209ON706651655e-11
KNAG0K004705.77ON414711626e-11
NCAS0D037806.209ON760651647e-11
Kpol_1050.795.77ON4331421611e-10
Ecym_55735.77ON5721461556e-10
Suva_12.2414.385ON349721295e-07
Skud_10.3734.385ON346691143e-05
YJR147W (HMS2)4.385ON358671082e-04
Smik_10.4424.385ON34763960.005
Skud_15.3446.69ON465131781.1
Suva_8.2878.658ON43681716.8
TDEL0A020802.432ON78783717.1
NDAI0G031108.34ON170748718.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03400
         (810 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   645   0.0  
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   221   3e-61
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    191   7e-51
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   175   5e-45
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   175   1e-44
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   172   2e-44
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   172   5e-44
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   172   6e-44
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   169   4e-43
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   170   4e-43
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...   169   4e-43
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...   169   4e-43
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...   169   4e-43
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   169   5e-43
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   169   1e-42
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   166   6e-42
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    91   1e-18
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     90   9e-18
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    87   2e-17
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      85   8e-17
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    86   2e-16
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    84   4e-16
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    84   4e-16
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    83   5e-16
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    83   9e-16
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    80   2e-15
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    80   6e-15
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    79   9e-15
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    78   1e-14
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    79   1e-14
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    80   2e-14
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    78   2e-14
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    78   3e-14
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    79   3e-14
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    78   3e-14
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    78   5e-14
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    78   5e-14
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    77   6e-14
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    77   8e-14
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    77   9e-14
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    76   1e-13
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    76   1e-13
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    76   1e-13
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    76   1e-13
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    76   1e-13
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    77   2e-13
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    76   2e-13
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    75   2e-13
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    76   2e-13
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    76   2e-13
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    76   2e-13
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    75   2e-13
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    76   3e-13
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    75   3e-13
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    75   4e-13
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    74   4e-13
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               74   5e-13
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    74   5e-13
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    74   8e-13
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    74   9e-13
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    73   1e-12
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    73   1e-12
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    73   1e-12
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    72   2e-12
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    72   2e-12
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    72   2e-12
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    72   3e-12
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    72   4e-12
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    71   5e-12
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    71   6e-12
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    69   2e-11
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    70   2e-11
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    69   2e-11
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    68   5e-11
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    67   6e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     68   7e-11
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    67   1e-10
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    64   6e-10
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    54   5e-07
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    49   3e-05
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    46   2e-04
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    42   0.005
Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...    35   1.1  
Suva_8.287 Chr8 (521122..522432) [1311 bp, 436 aa] {ON} YOR237W ...    32   6.8  
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...    32   7.1  
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    32   8.2  

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/390 (81%), Positives = 319/390 (81%)

Query: 1   MLQQIPQEESNGGARKASILPGNXXXXXXXXXXXXXXXXXXXXHVPLQNTVFIHKLYNIL 60
           MLQQIPQEESNGGARKASILPGN                    HVPLQNTVFIHKLYNIL
Sbjct: 1   MLQQIPQEESNGGARKASILPGNGSSGGDSGTSTTAQSANASAHVPLQNTVFIHKLYNIL 60

Query: 61  EDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNMYGFHKVSNDHNK 120
           EDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNMYGFHKVSNDHNK
Sbjct: 61  EDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNMYGFHKVSNDHNK 120

Query: 121 GIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSRNIAALNVRKNS 180
           GI        PSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSRNIAALNVRKNS
Sbjct: 121 GIQQQQQQQQPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSRNIAALNVRKNS 180

Query: 181 NPTLSTNTGGHSQGEESDSAKXXXXXXXXXXXXXXXXXXXXXXXXXXXRPQFIINAENEX 240
           NPTLSTNTGGHSQGEESDSAK                           RPQFIINAENE 
Sbjct: 181 NPTLSTNTGGHSQGEESDSAKQQHVPQVQQPPQQQQQPFHPQMQPQWQRPQFIINAENEQ 240

Query: 241 XXXXXXXXXXXXXXXPLPPLSRTDSFILHRYSIFNQQFQSQQLETKLRELTQSFDGLRYD 300
                          PLPPLSRTDSFILHRYSIFNQQFQSQQLETKLRELTQSFDGLRYD
Sbjct: 241 QQQQQQQQQQQQQQQPLPPLSRTDSFILHRYSIFNQQFQSQQLETKLRELTQSFDGLRYD 300

Query: 301 YFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEVYHEASLKDDPSKLHQFQK 360
           YFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEVYHEASLKDDPSKLHQFQK
Sbjct: 301 YFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEVYHEASLKDDPSKLHQFQK 360

Query: 361 HQQEMSYLEQEILRFKANLMQRLTKKLGSC 390
           HQQEMSYLEQEILRFKANLMQRLTKKLGSC
Sbjct: 361 HQQEMSYLEQEILRFKANLMQRLTKKLGSC 390

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/345 (88%), Positives = 307/345 (88%)

Query: 466 CNSHRNQARISLHMHLTSYREIQKNXXXXXXXXXXXXXXXXXXXXXXXXXXSESNIQQPG 525
           CNSHRNQARISLHMHLTSYREIQKN                          SESNIQQPG
Sbjct: 466 CNSHRNQARISLHMHLTSYREIQKNPRSVSRSSAPSAAAFAPHLFAVPAAPSESNIQQPG 525

Query: 526 PFISPPDFAGPRMMMNPFETTGQTSSVKRNMSILMDPLSSAPHYSGPQNSSPSRHPGNLG 585
           PFISPPDFAGPRMMMNPFETTGQTSSVKRNMSILMDPLSSAPHYSGPQNSSPSRHPGNLG
Sbjct: 526 PFISPPDFAGPRMMMNPFETTGQTSSVKRNMSILMDPLSSAPHYSGPQNSSPSRHPGNLG 585

Query: 586 SQIPRNPSPLVNSCKPPKQENEPPANEVSQPVQQNSSTKRTTLKDGMFILKPNKNYSTTA 645
           SQIPRNPSPLVNSCKPPKQENEPPANEVSQPVQQNSSTKRTTLKDGMFILKPNKNYSTTA
Sbjct: 586 SQIPRNPSPLVNSCKPPKQENEPPANEVSQPVQQNSSTKRTTLKDGMFILKPNKNYSTTA 645

Query: 646 NRNIQNDNNXXXXXXXXXXXXENGNNAGSANEQNGSKDAPPIALSFRTFYSNNGDANLED 705
           NRNIQNDNN            ENGNNAGSANEQNGSKDAPPIALSFRTFYSNNGDANLED
Sbjct: 646 NRNIQNDNNTGTTTASMPPTTENGNNAGSANEQNGSKDAPPIALSFRTFYSNNGDANLED 705

Query: 706 QSKGESSPKNPLARTAQDATIQNSGKIPIFKTSQGYSKPSDSVRADSDLPATKEPSQHNI 765
           QSKGESSPKNPLARTAQDATIQNSGKIPIFKTSQGYSKPSDSVRADSDLPATKEPSQHNI
Sbjct: 706 QSKGESSPKNPLARTAQDATIQNSGKIPIFKTSQGYSKPSDSVRADSDLPATKEPSQHNI 765

Query: 766 ISPVPSRTDIESRRGSSGVYSLLNREGSAPASPMGESSSNKKIKL 810
           ISPVPSRTDIESRRGSSGVYSLLNREGSAPASPMGESSSNKKIKL
Sbjct: 766 ISPVPSRTDIESRRGSSGVYSLLNREGSAPASPMGESSSNKKIKL 810

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  221 bits (564), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 107/156 (68%), Positives = 119/156 (76%), Gaps = 12/156 (7%)

Query: 44  HVPLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFV 103
           H PLQ+TVFIHKLYNILEDDDLKDLIWWSPSG SFLIRP E+FSRALATYFKHTNIASFV
Sbjct: 71  HPPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFV 130

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAG------------QDGVKIWEFRHSMGI 151
           RQLNMYGFHKVSNDH K           ++ +             Q+ +KIW+FRHS G+
Sbjct: 131 RQLNMYGFHKVSNDHGKSSEHDSASNSRTNNSNSSDNNNNSNADVQEDIKIWKFRHSTGL 190

Query: 152 FKRGDIEGLKFIKRRSSRNIAALNVRKNSNPTLSTN 187
           FKRGDIEGLK+IKRRSSRNI+  +VRKNSN    TN
Sbjct: 191 FKRGDIEGLKYIKRRSSRNISHSSVRKNSNSNGHTN 226

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 61/101 (60%), Gaps = 19/101 (18%)

Query: 283 LETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEV 342
           LE++  EL+QS++ LRY+Y  LQY+HDE L  L+ +N DMV +L+ L+  VT+Q  S   
Sbjct: 359 LESRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQTSS--- 415

Query: 343 YHEASLKDDPSKLHQFQKHQQEMSYLEQEILRFKANLMQRL 383
                   +PS         QE S LEQE+LRFKA LM R+
Sbjct: 416 --------EPSP--------QEFSGLEQELLRFKALLMSRV 440

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 3/36 (8%)

Query: 533 FAGPRMMM-NPFETTGQTSSVKRNMSILMDPLSSAP 567
           F+GPRMMM NPFE+TG  S  KRNMSILMDPL+ AP
Sbjct: 527 FSGPRMMMMNPFESTGNGS--KRNMSILMDPLAPAP 560

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 7/59 (11%)

Query: 755 PATKEPSQHNIISPVPSRT--DIESRRGSSGVYSLLNREGSAPASPM-GESSSNKKIKL 810
           P+ KE  Q +I+ P+P+R+    E+ RGSSGVYSLLN E   PASP+ GE +  KK+KL
Sbjct: 663 PSAKE--QGDIVRPIPTRSLGSSENTRGSSGVYSLLNDE--RPASPLDGEMTPTKKVKL 717

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  191 bits (484), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 90/139 (64%), Positives = 106/139 (76%), Gaps = 8/139 (5%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108
           NT+FIHKLYNILED DL+DLIWWS SG SF I+PTE+FS+ALATYFKHTNI SFVRQLN+
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 109 YGFHKVSNDHNKGIXXXXXXXXPSSEAGQ-------DGVKIWEFRHSMGIFKRGDIEGLK 161
           YGFHKVSNDH             +   G+       + +KIWEF+HS GIFK+GD+EGLK
Sbjct: 107 YGFHKVSNDHQYINYPNNNNSNDNDSKGKEREDLTNETIKIWEFKHSAGIFKKGDVEGLK 166

Query: 162 FIKRR-SSRNIAALNVRKN 179
            IKRR SSRNI+A+N +KN
Sbjct: 167 LIKRRSSSRNISAMNQKKN 185

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 12/79 (15%)

Query: 312 LEQLRVLNTDMVKLLDFLQKFVTLQKLSSEVYHEASLKDDPSKLHQFQKHQQEMSYLEQE 371
           ++ LR +N DM KL+ F++ FVTL  L S  Y    + DDP K        Q     + E
Sbjct: 307 IDDLRSINQDMAKLIGFMEYFVTLH-LDSGKY---KIDDDPQK--------QNWENFQNE 354

Query: 372 ILRFKANLMQRLTKKLGSC 390
           +  FK N+++RL  KLG+ 
Sbjct: 355 LANFKNNVIKRLHTKLGAS 373

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 537 RMMMNPFETTGQTSSVKRNMSILMDPLS 564
           ++M NPFE T  + S KRN S+L+DPL+
Sbjct: 478 QIMQNPFERTNNSISTKRNQSVLLDPLT 505

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  175 bits (444), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 93/127 (73%), Gaps = 11/127 (8%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108
           NT+FIHKLYNILED DL+DLIWWS  G SFLIRPTERFS+ALATYFKHTNI SFVRQLN+
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 109 YGFHKVSNDH----NK-------GIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDI 157
           YGFHKVSNDH    NK        +         ++    + VKIWEF+HS GIF++GD+
Sbjct: 137 YGFHKVSNDHQYINNKTEDDTTTNVTNHANTDVNNNITDNEQVKIWEFKHSAGIFRKGDV 196

Query: 158 EGLKFIK 164
           E LK IK
Sbjct: 197 ESLKLIK 203

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 7/82 (8%)

Query: 305 QYKHDELLEQLRVLNTDMVKLLDFLQKFVTL-----QKLSSEVYHEASLKDDPSKLHQFQ 359
           QY H+ + + ++  N DM+KL+D++QKFV+L       + SE     SLKD+  K  Q+ 
Sbjct: 357 QYTHESVEQTMKAANMDMIKLIDYMQKFVSLLNKNTNGIISEPSIGTSLKDNEMK-QQWD 415

Query: 360 KHQQEMSYLEQEIL-RFKANLM 380
           + Q E++  ++ IL R + N M
Sbjct: 416 EFQSEITNFKRSILSRLQINAM 437

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/146 (59%), Positives = 103/146 (70%), Gaps = 13/146 (8%)

Query: 50  TVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNMY 109
           T FIHKLY++LED+++ +LIWWSPS TSFLIRPTERFS+ALATYFKHTN+ASFVRQLNMY
Sbjct: 58  TAFIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMY 117

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAG---------QDGVKIWEFRHSMGIFKRGDIEGL 160
           GFHKV NDH K             EAG          +   +WEF+HS   F+RGD+E L
Sbjct: 118 GFHKV-NDH-KAHGAKSGAANKGEEAGLKTRGGQPTDNSTSVWEFKHSSAAFRRGDMESL 175

Query: 161 KFIKRRSSRNIAALNVRKNSNPTLST 186
           K IKRRSSR  ++   RKNS  T+ST
Sbjct: 176 KLIKRRSSRYQSS--NRKNSASTVST 199

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 528 ISPPDFAGPRMMMNPFETTGQTSSVK-RNMSILMDPLSSAP 567
           I  P  + P + MNPFE  G TSS + RNMS+LMDPL+ AP
Sbjct: 583 IKAPGASAPCLKMNPFEKKGSTSSSRNRNMSVLMDPLAPAP 623

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 289 ELTQSFDGL---RYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTL 335
           +L+ +F G+   + D    Q +++  +E LR  N DM+KLLD +   VT+
Sbjct: 379 KLSDAFPGMHMAKLDNLSYQTQYEIAVEDLRNSNMDMIKLLDLVHSLVTV 428

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 104/144 (72%), Gaps = 18/144 (12%)

Query: 48  QNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLN 107
            NT FIHKLY++LEDD++KDLIWWS S  SFLI+P E+FS+ALAT+FKHTN+ASFVRQLN
Sbjct: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLN 82

Query: 108 MYGFHKVSNDHNKGIXXXXXXXXPSSEAG-----QDGVKIWEFRHSMGIFKRGDIEGLKF 162
           MYGFHKVS DH            PSS  G      + + +WEFRHSMG F++GD E LK 
Sbjct: 83  MYGFHKVS-DHK-----------PSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKS 130

Query: 163 IKRRSSRNIAALNVRKNSNPTLST 186
           IKRRSS+N   L+ R NS  +L++
Sbjct: 131 IKRRSSKNQVLLS-RNNSAQSLAS 153

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 41/99 (41%), Gaps = 25/99 (25%)

Query: 312 LEQLRVLNTDMVKLLDFLQKFVTLQKLSS--------------------EVYHEASLKDD 351
           +E LR  N DM+KLLD +QK + +    S                    ++   +   +D
Sbjct: 233 IEDLRATNLDMMKLLDLVQKAMHISSPPSANELGGSVCSTSGGSGLSSNQLGSASGSAND 292

Query: 352 PSKLHQFQK-----HQQEMSYLEQEILRFKANLMQRLTK 385
            +    F +      ++ + YL QEI  F+  ++ +L +
Sbjct: 293 VTSPSSFARSPTGTRERTLEYLHQEIAAFRTTILMKLQR 331

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  172 bits (436), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 104/150 (69%), Gaps = 8/150 (5%)

Query: 48  QNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLN 107
           QN  FIHKLY++LEDDDLK+LIWWSPS  SFLIRPTERFS+AL+ +FKHTN+ASFVRQLN
Sbjct: 84  QNPHFIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQLN 143

Query: 108 MYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRS 167
           MYGF KVS+  +           PS       + +WEF+HS G F++GD E LK IKR S
Sbjct: 144 MYGFQKVSDHKSTWAANTDDSDEPS-------INLWEFKHSSGYFRKGDTESLKSIKRGS 196

Query: 168 SRNIAALNVRKNSNPTLSTNTGGHSQGEES 197
           S+   + N RKNS PT ST +G  SQ   S
Sbjct: 197 SKYHMS-NNRKNSAPTASTFSGSGSQDSAS 225

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 283 LETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEV 342
           ++T + EL QS  GLR ++  LQ+ ++  +E+LR  N DM+K+LD +QK   ++++ S +
Sbjct: 307 IDTNVHELHQSISGLRNEHSDLQHSYEMAVEELRATNIDMIKMLDIVQK-TMVERIGSPL 365

Query: 343 YHEASL 348
             + S+
Sbjct: 366 NEDGSV 371

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  172 bits (437), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 97/135 (71%), Gaps = 5/135 (3%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108
           NT FIHKLY++LED ++ +LIWWSP  TSFLIRPTERF +ALATYFKHTN+ASFVRQLNM
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 109 YGFHKVSNDHNKGIXX---XXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKR 165
           YGFHKV NDH               P+S++ ++   IWEF+HS   F+RGD+E LK IKR
Sbjct: 131 YGFHKV-NDHKTHAASKNGAAKTDDPASKS-ENTTSIWEFKHSSSAFRRGDMESLKLIKR 188

Query: 166 RSSRNIAALNVRKNS 180
           RSSR  A+   R  S
Sbjct: 189 RSSRYQASARKRSTS 203

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 536 PRMMMNPFET-TGQTSSVKRNMSILMDPLSSAP 567
           P +MMNPFE  T  +SS  RNMS+LMDPL+ AP
Sbjct: 581 PYLMMNPFEKKTSTSSSGNRNMSVLMDPLAPAP 613

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 282 QLETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTL 335
           Q+ TK+ ++       ++D    Q +++  +E LR  N DMV+LLD +   VTL
Sbjct: 366 QINTKVSDVLHGVQLAKFDNNAYQNQYEAAVEDLRNSNMDMVRLLDLVHNLVTL 419

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  169 bits (429), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 108/153 (70%), Gaps = 11/153 (7%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108
           NTVFI+KLY++LE+ DL DLIWW+ +G SFLIRP+E FS+ LA YFKHTNI SFVRQLN+
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 109 YGFHKVSNDHNKGIXXXXXXXXPS--------SEAGQDGVKIWEFRHSMGIFKRGDIEGL 160
           YGFHK+SNDH   +         +        + +G + +K+WEF+HS G+FK+GD+E L
Sbjct: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127

Query: 161 KFIKRR-SSRNIAALNV-RKNSNP-TLSTNTGG 190
           K IKRR SSR I +L++   N+N  TL TN G 
Sbjct: 128 KLIKRRSSSRTIPSLSLASSNTNTSTLETNDGA 160

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  170 bits (431), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (75%), Gaps = 5/132 (3%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108
           +T FIHKLY++LED ++KDLIWWSP+  SFLI+P E+FS+ALAT+FKHTN+ASFVRQLNM
Sbjct: 42  HTAFIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 101

Query: 109 YGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           YGFHKV+++  K           S+   +D + +WEF+HS   F++GD+EGLK IKRRSS
Sbjct: 102 YGFHKVNDNTGKQTDKYSTD---SASTNEDSINLWEFKHSSSAFRKGDMEGLKTIKRRSS 158

Query: 169 RNIAALNVRKNS 180
           RN   +  RKNS
Sbjct: 159 RN--PILARKNS 168

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 275 NQQFQSQQLETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVT 334
           NQQ Q+Q L++K  E  Q+   L+ +     +  D+ + +LR  N DM++LL+ ++K+  
Sbjct: 234 NQQ-QNQVLDSKHNEGVQNTTSLKNEQANAPWNCDQTVYELRTTNMDMIRLLELIEKWFF 292

Query: 335 L---QKLSSEVYHEA---------------SLKDDPSKLHQFQKHQQEMSYLEQEILRFK 376
           L   Q   +   +EA               S + + S      +H Q++ +L  EI + K
Sbjct: 293 LSSTQNTGTSTTNEAIYRTTTPLTNISTNPSAETNMSPGQSLPQHHQQLDWLNGEISKLK 352

Query: 377 ANLMQRLTKKLG 388
           + ++ RL K +G
Sbjct: 353 STVLLRLQKGVG 364

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 10/44 (22%)

Query: 530 PPDF--------AGPRMMMNPFETTGQTSSVKRN--MSILMDPL 563
           PPD+          P +MMNPF     ++S  RN  MS+LMDPL
Sbjct: 534 PPDYYNQYSGSSGTPYLMMNPFAKRKSSASSARNRHMSVLMDPL 577

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score =  169 bits (429), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 96/150 (64%), Gaps = 28/150 (18%)

Query: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105
           P QN +FIHKLY ILEDD L DLIWWS SG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 41  PPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 100

Query: 106 LNMYGFHKVSNDH-----NKGIXXXXXXXXPSSEAG-----------------------Q 137
           LN+YGFHKVS+DH     N G          +++ G                        
Sbjct: 101 LNIYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGSKNSSGEENNGATVQEKEKEKS 160

Query: 138 DGVKIWEFRHSMGIFKRGDIEGLKFIKRRS 167
           +  KIWEF+HS GIFK+GDIEGLK IKRR+
Sbjct: 161 NPTKIWEFKHSSGIFKKGDIEGLKHIKRRA 190

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 48/82 (58%), Gaps = 2/82 (2%)

Query: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367
           DE L  L+ +N DM+K+++ +Q F++LQ    S+ +   ++    S+ +  + HQ+++  
Sbjct: 283 DETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSE-NIMKDHQKQLKT 341

Query: 368 LEQEILRFKANLMQRLTKKLGS 389
            E ++L FK ++M R  + + S
Sbjct: 342 FENDMLTFKQHVMSRAHRTMDS 363

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 7/53 (13%)

Query: 521 IQQPGPFIS-PPDFAG----PRMMMNPFETTG--QTSSVKRNMSILMDPLSSA 566
           I QP P    PP +A     P+MM NPF +    +  + KR  S+LMDPL+ A
Sbjct: 452 INQPIPIQQLPPQYADTFNTPQMMHNPFASKNGHKPGNTKRTNSVLMDPLTPA 504

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score =  169 bits (429), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 94/139 (67%), Gaps = 20/139 (14%)

Query: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105
           P QN +FIHKLY ILEDD L DLIWWSPSG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 59  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118

Query: 106 LNMYGFHKVSNDHNKGIXXXXXXXXPSSEAG---------QDGV-----------KIWEF 145
           LN+YGFHKVS+DH+            + ++           +GV           KIWEF
Sbjct: 119 LNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKIWEF 178

Query: 146 RHSMGIFKRGDIEGLKFIK 164
           +HS GIFK+GDIEGLK IK
Sbjct: 179 KHSSGIFKKGDIEGLKHIK 197

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367
           DE L+ L+ +N DMVK+++ +Q F++LQ    S+ +   ++    S+ +  ++HQ+++  
Sbjct: 293 DEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSE-NIVKEHQKQLKA 351

Query: 368 LEQEILRFKANLMQRLTKKLGSC 390
            E ++L FK ++M R  + + S 
Sbjct: 352 FENDMLTFKQHVMSRAHRTIDSL 374

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 7/53 (13%)

Query: 521 IQQPGPFIS-PPDFAG----PRMMMNPFET--TGQTSSVKRNMSILMDPLSSA 566
           + QP P    PP +A     P+MM NPF +  T +  + +R  S+LMDPL+ A
Sbjct: 466 VHQPIPIQQLPPQYADTFSTPQMMHNPFASKNTNKPGNTRRTNSVLMDPLTPA 518

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score =  169 bits (429), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 94/148 (63%), Gaps = 26/148 (17%)

Query: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105
           P QN +FIHKLY ILED+ L DLIWW+PSG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 59  PPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118

Query: 106 LNMYGFHKVSNDH-----------------NKGIXXXXXXXXPSSEAGQDGV-------- 140
           LN+YGFHKVS+DH                 N              E    GV        
Sbjct: 119 LNIYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNSSGDENTGGGVQEKEKSNP 178

Query: 141 -KIWEFRHSMGIFKRGDIEGLKFIKRRS 167
            KIWEF+HS GIFK+GDIEGLK IKRR+
Sbjct: 179 TKIWEFKHSSGIFKKGDIEGLKHIKRRA 206

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367
           DE L+ L+ +N DMVK+++ +Q F++LQ    S+ +   ++    S+ +  + HQ+++  
Sbjct: 299 DETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSE-NIVKDHQKQLQA 357

Query: 368 LEQEILRFKANLMQRLTKKLGSC 390
            E ++L FK ++M R  + + S 
Sbjct: 358 FESDMLTFKQHVMSRAHRTIDSL 380

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 7/53 (13%)

Query: 521 IQQPGPFIS-PPDFAG----PRMMMNPFET--TGQTSSVKRNMSILMDPLSSA 566
           I QP P    PP +A     P+MM NPF +    +  + KR  S+LMDPL+ A
Sbjct: 470 INQPIPIQQLPPQYADTFSTPQMMHNPFASKNNNKPGNTKRTNSVLMDPLTPA 522

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  169 bits (428), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 94/148 (63%), Gaps = 26/148 (17%)

Query: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105
           P QN +FIHKLY ILEDD L DLIWWSPSG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 55  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 114

Query: 106 LNMYGFHKVSNDH---------------------NKGIXXXXXXXXPSSEAGQDG----- 139
           LN+YGFHKVS+DH                     + G          +    Q+      
Sbjct: 115 LNIYGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGDETTGAGAQEKEKSNP 174

Query: 140 VKIWEFRHSMGIFKRGDIEGLKFIKRRS 167
            KIWEF+HS GIFK+GDIE LK IKRR+
Sbjct: 175 TKIWEFKHSSGIFKKGDIESLKHIKRRA 202

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367
           DE L  L+ +N DM+K+++ +Q F++LQ    S+ +   ++    S+ +  + HQ ++  
Sbjct: 293 DETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSE-NIIKDHQNQLKV 351

Query: 368 LEQEILRFKANLMQRLTKKLGS 389
            E ++L FK ++M R  + + +
Sbjct: 352 FESDMLTFKQHVMSRAHRTIDA 373

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  169 bits (427), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 105/166 (63%), Gaps = 33/166 (19%)

Query: 48  QNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLN 107
           QNTVFIHKLY+ILEDD L+DLIWW+P+G SF IRP E FS+ LATYFKHTNI SFVRQLN
Sbjct: 61  QNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLN 120

Query: 108 MYGFHKVSNDHNKGIXXXXX----------------------------XXXPSSEAGQDG 139
           +YGFHKV+N ++                                       P +++G   
Sbjct: 121 IYGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHSPSTGVVVKSEPHTKSGPGA 180

Query: 140 ----VKIWEFRHSMGIFKRGDIEGLKFIKRRSS-RNIAALNVRKNS 180
               VKIWEF+HS  +F+RGDIEGLKFIKRRSS ++I+ ++ RK S
Sbjct: 181 TSSPVKIWEFKHSANLFRRGDIEGLKFIKRRSSAKSISQMSSRKGS 226

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 16/73 (21%)

Query: 310 ELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEVYHEASLKDDPSKLHQFQKHQQEMSYLE 369
           EL+E+++  N DMV L+D +QK  ++                P+K    ++ ++    L+
Sbjct: 393 ELVERIKATNGDMVALIDLVQKLASI----------------PNKKKDTKEVEKARQSLQ 436

Query: 370 QEILRFKANLMQR 382
           ++IL+ KA++++R
Sbjct: 437 KKILKLKADVVKR 449

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  166 bits (419), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 94/122 (77%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108
           +T FIHKLY++LED+++KDLIWWS S  SFLI+P E+FS+ALAT+FKHTN+ASFVRQLNM
Sbjct: 70  STAFIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 129

Query: 109 YGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           YGFHKVS+  +            + +  +D + +WEFRHS+G F++GD E LK IKRRSS
Sbjct: 130 YGFHKVSDHKSNEKSSETDGAHGNGDIEEDSINLWEFRHSLGCFRKGDKESLKSIKRRSS 189

Query: 169 RN 170
           +N
Sbjct: 190 KN 191

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 53/108 (49%), Gaps = 24/108 (22%)

Query: 304 LQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEVYHEASL--------------- 348
           LQ ++D  +E+LR  N DM+KLLD +QK + +  + S   + +++               
Sbjct: 290 LQNRYDNAIEELRATNMDMMKLLDLVQKAIWISTVPSASSNTSAIAPGVSSGSRPSTPVN 349

Query: 349 ------KDDPSKLHQFQKHQQEMSYLE---QEILRFKANLMQRLTKKL 387
                 +D  S  ++      +  Y E   QEI++FKA+++ +L +++
Sbjct: 350 VSAQIGQDVVSPGYELSPKTNQKQYFEQLNQEIVKFKASILNKLQRQI 397

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 536 PRMMMNPFETTGQTSSV--KRNMSILMDPLSSAPHYSGPQNSSPSRHPGNL 584
           P +MMNPF     T S+  KR+MS+ MDPL+       PQ S+ +  P N+
Sbjct: 472 PYLMMNPFAKRKSTESLPKKRHMSVFMDPLAPV-----PQQSASTSAPTNI 517

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 84/149 (56%), Gaps = 11/149 (7%)

Query: 52  FIHKLYNILEDDDLKDLI-WWSPSGTSFLIRPTER-FSR-ALATYFKHTNIASFVRQLNM 108
           FIH+LY IL++  L++ I W+    + F+++P +  FS+  L  YFKH N++SFVRQL+M
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 109 YGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKR-GDIEGLKFIKRRS 167
           YGFHK++N   +G+         S E G      W F H +G F++  D+  LK I+R+S
Sbjct: 66  YGFHKITNP-QEGLGEGR-----SDEQGDRATTRWFFAHPLGYFRKDADLASLKKIQRKS 119

Query: 168 SRNIAALNVRKNSNPTLSTNTGGHSQGEE 196
           +  +     RKN   T+  N  G    EE
Sbjct: 120 T-GVGKDGRRKNVLSTVCVNYVGSKGNEE 147

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 89.7 bits (221), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 68/121 (56%), Gaps = 19/121 (15%)

Query: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLN 107
           N  F+ KLY ILE +   +L+ W+P GTSF++  T +F+ + L T+FKH+N +SFVRQLN
Sbjct: 80  NNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHFKHSNFSSFVRQLN 139

Query: 108 MYGFHKVSNDHNKGIXXXXXXXXPSSEAGQD--GVKIWEFRHSMGIFKRGDIEGLKFIKR 165
            Y FHKV                 S E G+   G   WEF H    FKR D  GL+ IKR
Sbjct: 140 KYDFHKVKRK--------------SDEPGRKKYGELSWEFTHPS--FKRHDEAGLENIKR 183

Query: 166 R 166
           +
Sbjct: 184 K 184

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 78/143 (54%), Gaps = 26/143 (18%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTS-FLIRP--TERFSRALATYFKHTNIASFVRQLNM 108
           F+H+LY+IL   DL D I+WS   +S F I+P  T+  S+ L +YFKH N++SFVRQL+M
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 109 YGFHKVSNDHNKGIXXXXXXXXPS-------------SEAG--------QD-GVKIWEFR 146
           YGFHK+S+ + +G         P              SE+         QD  + IW F 
Sbjct: 66  YGFHKLSHLNKQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRSLTIWYFT 125

Query: 147 HSMGIF-KRGDIEGLKFIKRRSS 168
           H  G F K  DI  L+ I+R+S+
Sbjct: 126 HPSGYFHKNADILNLEKIQRKST 148

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 83/145 (57%), Gaps = 18/145 (12%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSP-SGTSFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q+  FIH+L++IL++  L D I WS      F+++P +  FS + L  YFKH NI+SFV
Sbjct: 1   MQHRNFIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVK-IWEFRHSMGIFKRG-DIEGLK 161
           RQL+MYGFHK++  HN            ++    D V+ IW F+H  G F R   ++ LK
Sbjct: 61  RQLHMYGFHKIATVHN------------NNNVVNDKVQTIWHFKHPSGNFTRDVHLDSLK 108

Query: 162 FIKRRSSRNIAALNVRKNSNPTLST 186
            I+R+S+  I     RKN   TLS 
Sbjct: 109 KIQRKST-GIGKDGKRKNMLSTLSV 132

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 66/118 (55%), Gaps = 15/118 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMYG 110
           F+  +Y ILE +D  D+I WS  G SFL+  T +F S+ L  +FKH+N ASFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           FHKV     +             +  + G + WEF H +  FKR   +GL  IKR++S
Sbjct: 127 FHKVKRTQEE------------KKKWKYGEQSWEFCHPL--FKRNHDDGLNNIKRKTS 170

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 78/154 (50%), Gaps = 19/154 (12%)

Query: 48  QNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQL 106
           Q+  F+ K+Y ILE  D  D++ W+ +G SF++  T  F S+ L  +FKH+N ASFVRQL
Sbjct: 83  QSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQL 142

Query: 107 NMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           N Y FHKV     +             +A Q G   WEF H +  FKR     L  IKR+
Sbjct: 143 NKYDFHKVKRTQEE------------RKACQYGELSWEFNHPL--FKRNQEANLDNIKRK 188

Query: 167 SSRNIAALNVRKNSNPTLSTNTGGHSQGEESDSA 200
           ++     L   K    +L  N    +Q  E++SA
Sbjct: 189 AATQKKVLVDEK----SLLLNKADGTQALENESA 218

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (55%), Gaps = 15/120 (12%)

Query: 48  QNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQL 106
           Q   F+ K+Y+ILE  +  +++ W+ +G SF++  T +F S+ L  +FKH+N ASFVRQL
Sbjct: 47  QQNEFVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQL 106

Query: 107 NMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           N Y FHKV     +             +  Q G   WEF+H +  FKRG  E L  IKR+
Sbjct: 107 NKYDFHKVKRTQEE------------RKVWQYGELSWEFKHPL--FKRGQEENLDNIKRK 152

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 82.8 bits (203), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 69/126 (54%), Gaps = 9/126 (7%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSP-SGTSFLIRPT--ERFSRALATYFKHTNIASFV 103
           +Q   FIH+L+ IL+ +DL   I+WS  S T F ++P   E  S+ L  YFKH N++SFV
Sbjct: 1   MQTKTFIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIE-GLKF 162
           RQL+MYGFHK+++ +             ++ A      IW F H  G F R      L  
Sbjct: 61  RQLHMYGFHKIASSN-----APQSQIAANTTANNKDSVIWNFTHPSGNFHRDSTTVELSK 115

Query: 163 IKRRSS 168
           I+R+SS
Sbjct: 116 IQRKSS 121

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 65/118 (55%), Gaps = 17/118 (14%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE ++   +I WSP G +F++  T +F+   L  +FKH+N ASFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           FHKV    N+            SE  Q+    WEF H    F+R D  GL  I+R+ S
Sbjct: 103 FHKVKRKKNE-----------VSEGIQNA---WEFNHQY--FRRHDEAGLDNIRRKPS 144

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 73/149 (48%), Gaps = 9/149 (6%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPSGTS-FLIRPTERF--SRALATYFKHTNIASFV 103
           +    FIH+L+ IL D  L + I WS      F++RP +++  +  L  YFKH N++SFV
Sbjct: 1   MHTKTFIHQLHAILNDATLAEWIRWSDDQDGVFVLRPYDKWFSTLVLKRYFKHGNVSSFV 60

Query: 104 RQLNMYGFHKVSN----DHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKR-GDIE 158
           RQL+MYGFHK+SN        G         P   A      +W F H +GIF R     
Sbjct: 61  RQLHMYGFHKLSNFGSESSASGGSSISQLHGPPPPAKDKSATVWFFTHPLGIFTRNASAA 120

Query: 159 GLKFIKRRSSRNIAALNVRKNSNPTLSTN 187
            L  I R+S+  +     RKN   T+  N
Sbjct: 121 TLNRIPRKST-GVGRDGKRKNVLSTVCVN 148

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 65/119 (54%), Gaps = 21/119 (17%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KLYNILE+++  D++ W+  G SF++  T +F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 111 FHKVS---NDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHK+    +D  K I                G   WEF+H    F+  D   L  IKR+
Sbjct: 121 FHKIKTKPDDKEKLIY---------------GELSWEFQHP--CFRIHDASQLDNIKRK 162

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 15/118 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+NILE  +  D++ W+ +G SF++  T  F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 26  FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFASFVRQLNKYD 85

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           FHKV                   +  Q G   WEF H    F+  D + L  IKR+++
Sbjct: 86  FHKVK------------RTSEEKQNSQYGEHSWEFNHPY--FRIHDEDSLDKIKRKTA 129

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 68/126 (53%), Gaps = 8/126 (6%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPS--GTSFLIRPT--ERFSRALATYFKHTNIASF 102
           +Q+  F+H+L++IL D  L  +I W+    GT FL++P   E     L  YFKH N++SF
Sbjct: 1   MQHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSF 60

Query: 103 VRQLNMYGFHKVSNDH-NKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKR-GDIEGL 160
           VRQL+MYGFHKV N+  N  I         S +  +    IW+F H  G F R    E L
Sbjct: 61  VRQLHMYGFHKVGNNSVNSHINNIEGNKIVSKK--EPHFIIWKFSHPSGNFHRESSYETL 118

Query: 161 KFIKRR 166
             I R+
Sbjct: 119 CKITRK 124

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 76/147 (51%), Gaps = 30/147 (20%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTS-FLIRP-TERFS-RALATYFKHTNIASFVRQLN 107
            F+H+L++IL  ++L + I+W+    + F I+P   +FS + L  YFKH N++SFVRQL+
Sbjct: 5   TFLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLH 64

Query: 108 MYGFHKVSNDHNK--------GIXXXXXXXXP-----SSEAG------------QDGVK- 141
           MYGFHK+SN +N+        G+        P     S E G            QD  K 
Sbjct: 65  MYGFHKLSNSNNRSKCQVSFLGVDNSLTASDPKIEPESPEFGKYKEKMSRPALPQDRAKT 124

Query: 142 IWEFRHSMGIF-KRGDIEGLKFIKRRS 167
           IW F H  G+F K  +   L  I R+S
Sbjct: 125 IWYFTHPSGVFHKNAETSDLDKIHRKS 151

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 15/121 (12%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL+++L DD    LI W+P G SF++   E F    L  YFKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSR 169
           G+HKV +  +  I                    W+F +   I  R D+   K I+++ S 
Sbjct: 235 GWHKVQDVKSGSIQSSSDDK-------------WQFENENFIRGREDLLE-KIIRQKGSS 280

Query: 170 N 170
           N
Sbjct: 281 N 281

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 18/147 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE  +  D+I W+  G SF++  T  F+ + L  +FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSRN 170
           FHK+   + +             +  Q G   WEF+H    FK  D + L  IKR+S+  
Sbjct: 90  FHKIKRTNEE------------KQNSQYGEHSWEFKHPF--FKIHDEDQLDNIKRKSA-- 133

Query: 171 IAALNVRKNSNPTLSTNTGGHSQGEES 197
                +  + N  L    G ++ G +S
Sbjct: 134 -VQKKIMLDDNTVLVKQGGDNAGGLDS 159

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 14/136 (10%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSP-SGTSFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q   FIH+L++IL++ DL +LI WSP     FL++P +  FS + L  YFKH NI+SFV
Sbjct: 1   MQPRTFIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFV 60

Query: 104 RQLNMYGFHKV-SNDHNKGIXXXXXXXXPSSEA--------GQDGVKI-WEFRHSMGIFK 153
           RQL+MYGFHK+ S++H             +            +D   + W F H  G F 
Sbjct: 61  RQLHMYGFHKLPSHNHMTNSTANTTTTATTINNNDMNFENRDKDKASVEWHFTHPSGHFY 120

Query: 154 R-GDIEGLKFIKRRSS 168
           R  D   L  I+R+S+
Sbjct: 121 RDADASTLNKIQRKSA 136

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 21/116 (18%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMYG 110
           F+ KLY ILE +   D++ W+ +G +F++  T +F+   L  +FKH+N ASFVRQLN Y 
Sbjct: 56  FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFVRQLNKYD 115

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHK+                   +   D  + WEF+H    F+R   EGL  IKR+
Sbjct: 116 FHKI------------------KKKVTDVERSWEFKHPS--FRRHFDEGLDNIKRK 151

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 64/118 (54%), Gaps = 15/118 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KLY ILE  +  D++ W+ +G SF++  T +F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           FHKV     +             +  Q G   WEF+H    F   + E L  IKR+++
Sbjct: 94  FHKVKKTPEE------------RQTSQYGELSWEFKHPF--FTIHNEEALDNIKRKTT 137

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (71%), Gaps = 1/64 (1%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMYG 110
           F++KL+N+L D   +D+I WS  G SFL+   E+F    L  YFKH+N ASFVRQLNMYG
Sbjct: 163 FVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMYG 222

Query: 111 FHKV 114
           +HKV
Sbjct: 223 WHKV 226

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (48%), Gaps = 22/143 (15%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMY 109
            F++K++N++ D     LI W+  G SF +   E   R  L  YFKH+N ASFVRQLNMY
Sbjct: 170 TFVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMY 229

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSR 169
           G+HK+ +  +  I                    W+F +   I  R D+  L+ I R+ S 
Sbjct: 230 GWHKIQDVKSGSIQSSIEDK-------------WQFANDYFIRGREDL--LEHIVRQKST 274

Query: 170 NIAALNVRKNSNPTLSTNTGGHS 192
            +A      N NPT S   GG++
Sbjct: 275 PLA------NQNPTFSNYIGGYN 291

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 65/117 (55%), Gaps = 15/117 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+NILE +   +++ WS +G SF++  T +F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRS 167
           FHK+   + +             +    G + WEF +    FK  D + L  IKR++
Sbjct: 137 FHKIKRTNEE------------RQKSIYGEQSWEFENPN--FKINDEKSLDLIKRKT 179

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 71/140 (50%), Gaps = 19/140 (13%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPS-GTSFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q   F+H+L+ IL + ++   I+WSP+  T F ++P +  FS   L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDG----VKIWEFRHSMGIFKRGDIEG 159
           RQL+MYGFHK+S+              P   +  +G    +  W+F H  G F +    G
Sbjct: 61  RQLHMYGFHKLSHP------------SPDQSSANNGNVKELVEWKFTHPSGFFFKEANAG 108

Query: 160 LKFIKRRSSRNIAALNVRKN 179
           +    +R S  +     RKN
Sbjct: 109 ILNKIQRKSTGVGKDGKRKN 128

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE  +  D++ W+  G SF++  T +F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSRN 170
           FHKV     +             +  Q G   WEFRH    F   + E L  IKR+++  
Sbjct: 104 FHKVKKSPEE------------RQNSQYGELSWEFRHPY--FTIHNEEALDNIKRKTT-- 147

Query: 171 IAALNVRKNSNPTLSTNTGGHSQGEESDSA 200
           +    +  +S   L  N+G  +  EE   A
Sbjct: 148 VQKKIMLDDSTVLLKPNSGTQTGTEERAGA 177

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (52%), Gaps = 15/117 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE  +  D+I W+  G SF++  T  F+   L  +FKH+N +SFVRQLN Y 
Sbjct: 38  FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 97

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRS 167
           FHKV     +           SS  G+     WEF+H    F+R D   L  IKR++
Sbjct: 98  FHKVKRTPEE---------RQSSVYGEHS---WEFQHPR--FRRNDEAALDRIKRKT 140

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 36/151 (23%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTS-FLIRPTER-FS-RALATYFKHTNIASFVRQLN 107
           VFIH+LY+IL+  DL++ I W P     F I+P    FS + L  YFKH N  SFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 108 MYGFHKVSNDHN-------------------------------KGIXXXXXXXXPSSEAG 136
           MYGFHK+S + N                                 +         +++ G
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 137 QDGVKIWEFRHSMGIFKRG-DIEGLKFIKRR 166
           ++ ++ W F H  G+F +G D+  L  I+R+
Sbjct: 123 KEDIE-WYFTHPSGLFHKGSDVVTLNKIQRK 152

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 15/116 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE+++  D++ W+ +G SF++  T +F+   L  +FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHKV                   +  + G + WEF+H    F+    +GL  IKR+
Sbjct: 147 FHKV------------KRSPEERQRCKYGEQSWEFQHPE--FRVHYGKGLDNIKRK 188

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 65/116 (56%), Gaps = 15/116 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE+++  D++ W+ +G SF++  T +F+   L  +FKH+N ASFVRQLN Y 
Sbjct: 88  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 147

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHKV     +             +  + G + WEF+H    F+    +GL  IKR+
Sbjct: 148 FHKVKRSPEE------------RQKCKYGEQSWEFQHPE--FRVHYGKGLDNIKRK 189

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL+++L D+   DLI WS  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 151 AFVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMY 210

Query: 110 GFHKV 114
           G+HKV
Sbjct: 211 GWHKV 215

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 15/121 (12%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL+++L DD    LI W+  G SF++   E F  + L  YFKH+N ASFVRQLNMY
Sbjct: 174 AFVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 233

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSR 169
           G+HKV +  +  I                    W+F +   I  R D+   K I+++ S 
Sbjct: 234 GWHKVQDVKSGSIQSSSDDK-------------WQFENENFIRGREDLLE-KIIRQKGSS 279

Query: 170 N 170
           N
Sbjct: 280 N 280

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 60/118 (50%), Gaps = 17/118 (14%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE  +  ++I W+  G SF++  T  F+   L  +FKH+N +SFVRQLN Y 
Sbjct: 43  FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 102

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQD-GVKIWEFRHSMGIFKRGDIEGLKFIKRRS 167
           FHKV                P      D G   WEF+H    F+R D   L  IKR++
Sbjct: 103 FHKVKR-------------TPEERQNSDYGKHSWEFQHPK--FRRSDEAALDRIKRKT 145

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 71/130 (54%), Gaps = 20/130 (15%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPSGT-SFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q   F+H+L++IL + ++   I+WSP+ +  F ++P +  FS   L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDG----VKIWEFRHSMG-IFKRGDIE 158
           RQL+MYGFHK+S+              P   +  +G    +  W+F H  G  FK  +  
Sbjct: 61  RQLHMYGFHKLSHP------------SPEQTSANNGNTKELVEWKFTHPSGFFFKEANAG 108

Query: 159 GLKFIKRRSS 168
            L  I+R+S+
Sbjct: 109 VLNKIQRKST 118

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 15/116 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE+++  D++ W+ +G SF++  T +F+   L  +FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHKV                   +  + G + WEF+H    F+    +GL  IKR+
Sbjct: 147 FHKV------------KRSPEERQRCKYGEQSWEFQHPE--FRVHYGKGLDNIKRK 188

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMY 109
            F++K++N++ DD+  +LI WS  G S +I   E   R  L  YFKH+N ASFVRQLNMY
Sbjct: 185 TFVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMY 244

Query: 110 GFHKV 114
           G+HKV
Sbjct: 245 GWHKV 249

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL+++L DD    LI W+  G SF++   E F  + L  YFKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 234

Query: 110 GFHKV 114
           G+HKV
Sbjct: 235 GWHKV 239

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 64/116 (55%), Gaps = 15/116 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE+++  D++ W+ +G SF++  T +F+   L  +FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHKV     +             +  + G + WEF+H       G  +GL  IKR+
Sbjct: 147 FHKVKRSPEE------------RQKCKYGEQSWEFQHPEFRVHYG--KGLDNIKRK 188

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 15/121 (12%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL+++L DD    LI W+  G SF++   E F    L  YFKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSR 169
           G+HKV +  +  I                    W+F +   I  R D+   K I+++ S 
Sbjct: 235 GWHKVQDVKSGSIQSSSDEK-------------WQFENENFIRDREDLLE-KIIRQKGSS 280

Query: 170 N 170
           N
Sbjct: 281 N 281

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 1/67 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMY 109
            F++KL+++L D    DLI W+  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 168 AFVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMY 227

Query: 110 GFHKVSN 116
           G+HKV +
Sbjct: 228 GWHKVQD 234

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (52%), Gaps = 16/125 (12%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
           +F++K++++L D+   +LI W+  G SF++   E F  + L  YFKH+N ASFVRQLNMY
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSR 169
           G+HKV +  +  I                    W+F +   I  R D+  L+ I R+   
Sbjct: 172 GWHKVQDVKSGSIQNSSDDK-------------WQFENEFFIRGREDL--LQHIVRQRPA 216

Query: 170 NIAAL 174
           N A L
Sbjct: 217 NQARL 221

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 1/67 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++K++++L D+   +LI WS  G SF++   E F  + L  YFKH+N+ASFVRQLNMY
Sbjct: 119 AFVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMY 178

Query: 110 GFHKVSN 116
           G+HKV +
Sbjct: 179 GWHKVQD 185

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 1/64 (1%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMYG 110
           F++KL+N+L++   +D+I W+  G SFL+   E+F    L  YFKH+N ASFVRQLNMYG
Sbjct: 121 FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMYG 180

Query: 111 FHKV 114
           +HKV
Sbjct: 181 WHKV 184

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (54%), Gaps = 12/126 (9%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPS-GTSFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q   F+H+L++IL + ++   I+WSP+    F ++P +  FS   L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMG-IFKRGDIEGLKF 162
           RQL+MYGFHK+S+     +         ++      +  W+F H  G  FK  +   L  
Sbjct: 61  RQLHMYGFHKLSHPSPDQVS--------TNNGNVKELVEWKFTHPSGFFFKEANAGVLNK 112

Query: 163 IKRRSS 168
           I+R+S+
Sbjct: 113 IQRKST 118

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 15/118 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE  +  D+I W+  G SF++  T  F+ + L  +FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSS 168
           FHK+                 +SE G+     WEF H    FK  + + L  IKR+S+
Sbjct: 89  FHKIKR---------TSEEKQNSEYGEHS---WEFNHPH--FKIHNEDQLDNIKRKSA 132

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMY 109
            F++KL++++ D   + LI WS  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 165 AFVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMY 224

Query: 110 GFHKV 114
           G+HKV
Sbjct: 225 GWHKV 229

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (67%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL++++ D   + LI WS  G SF+I   E F    L  YFKH+N ASFVRQLNMY
Sbjct: 159 AFVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMY 218

Query: 110 GFHKV 114
           G+HKV
Sbjct: 219 GWHKV 223

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 1/67 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL++++ D   + LI WS  G SF+I   E F    L  YFKH+N ASFVRQLNMY
Sbjct: 160 AFVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMY 219

Query: 110 GFHKVSN 116
           G+HKV +
Sbjct: 220 GWHKVQD 226

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 66/123 (53%), Gaps = 17/123 (13%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSR-ALATYFKHTNIASFVRQLNMY 109
            F++KL++++ D   +  I WS SG S ++   ERF +  L  YFKH+N ASFVRQLNMY
Sbjct: 196 AFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMY 255

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLK-FIKRRSS 168
           G+HKV +  +  +                    WEF +    FKRG    L+  ++++S+
Sbjct: 256 GWHKVQDVKSGSMLSNNDSR-------------WEFENEN--FKRGKEYLLENIVRQKSN 300

Query: 169 RNI 171
            NI
Sbjct: 301 TNI 303

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 77/145 (53%), Gaps = 11/145 (7%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLI-WWSPSGTSFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q   F+++L+ IL+   L   I W+S   + FL++P +  FS + L  YFKH NI+SFV
Sbjct: 1   MQQRNFVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFV 60

Query: 104 RQLNMYGFHKV-SNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDI-EGLK 161
           RQL+MYGFHK+ SND    I        P++        IW F H  G F +    E LK
Sbjct: 61  RQLHMYGFHKISSNDLPNSI--LNSNPNPNNRINT----IWYFAHPSGFFTQTSTNEILK 114

Query: 162 FIKRRSSRNIAALNVRKNSNPTLST 186
            I+R+S+        RKN   TLS 
Sbjct: 115 KIQRKSTGVDKDGEKRKNILSTLSV 139

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (50%), Gaps = 19/140 (13%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPS-GTSFLIRPTE-RFS-RALATYFKHTNIASFV 103
           +Q   F+H+L++IL + ++   I+WS +    F ++P +  FS + L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDG----VKIWEFRHSMGIFKRGDIEG 159
           RQL+MYGFHK+S+              P   +  +G    +  W+F H  G F +    G
Sbjct: 61  RQLHMYGFHKLSHP------------SPEQASASNGNAKELVEWKFTHPSGFFFKEANAG 108

Query: 160 LKFIKRRSSRNIAALNVRKN 179
           +    +R S  +     RKN
Sbjct: 109 ILNKIQRKSTGVGKDGKRKN 128

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 80/155 (51%), Gaps = 9/155 (5%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPSGTS-FLIRPTE-RFS-RALATYFKHTNIASFV 103
           + +  FIH+L++IL  D+L + I WS    S F+I+P    FS + L  +FKH N++SFV
Sbjct: 1   MHSKTFIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKI----WEFRHSMGIFKRGDIEG 159
           RQL+MYGFHK+ +  +  +         ++ +  +        W+F H    F +   E 
Sbjct: 61  RQLHMYGFHKLPHSASSTLAASGADNNGATASTNNATSKSEIEWKFTHHSHDFCKSASEA 120

Query: 160 -LKFIKRRSSRNIAALNVRKNSNPTLSTNTGGHSQ 193
            LK I R+S+ N+     R+N    +  +  G SQ
Sbjct: 121 QLKRIHRKSN-NLGKDGKRRNVLSPVCVSYLGSSQ 154

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 14/108 (12%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++K+++++ D   K LI WS  G SF+++  E F    L  YFKH+N ASFVRQLNMY
Sbjct: 265 AFVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMY 324

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDI 157
           G+HKV +  +  I                    W+F +   I  R D+
Sbjct: 325 GWHKVQDAKSNSILTTADDR-------------WQFENKFFIKDREDL 359

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 76/152 (50%), Gaps = 25/152 (16%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMYG 110
           F++KL++++ D   + LI WS  G SF++   E+F    L  YFKH+N ASFVRQLNMYG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRS--- 167
           +HKV +  +  I                    WEF +   +  R D+     I+++S   
Sbjct: 220 WHKVQDVKSGSIQSNSDDR-------------WEFANENFLRGREDLLA-NIIRQKSSAG 265

Query: 168 SRNIAALNV-RKNSNPTLSTNTGGHSQGEESD 198
           SR+ A ++V   + N  L  N      GEE D
Sbjct: 266 SRDGAGMSVGAAHPNAVLVAN------GEEVD 291

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMY 109
            F++KL++++ D   + LI W+  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 213 AFVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMY 272

Query: 110 GFHKV 114
           G+HKV
Sbjct: 273 GWHKV 277

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 15/116 (12%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFS-RALATYFKHTNIASFVRQLNMYG 110
           F+ KL+ ILE +   +++ W+  G SF++  T +F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 78  FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 137

Query: 111 FHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRR 166
           FHKV    +              +  + G   WEF+H    F+  + + L  IKR+
Sbjct: 138 FHKVKRKMD------------DKQKPKFGELSWEFKHPA--FQIHNEKALDNIKRK 179

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 69/155 (44%), Gaps = 35/155 (22%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPS----GTSFLIRPTER-FSR-ALATYFKHTNIA 100
           +QN  FIH+L+ IL+  +L+  I W P     G  F +RP +  FS   L  YFKH N++
Sbjct: 1   MQNKTFIHQLHAILQQPELERWIRWEPDEQLRGV-FSLRPHDAAFSTNVLKRYFKHGNVS 59

Query: 101 SFVRQLNMYGFHKVSNDHN-KGIXXXXXXXXPSSEAGQD--------------------- 138
           SFVRQL+MYGFHK++                P++ AG                       
Sbjct: 60  SFVRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGTSSADGSAGAAATTAG 119

Query: 139 -----GVKIWEFRHSMGIFKR-GDIEGLKFIKRRS 167
                   +W+F H  G F R   +  L  I+R+S
Sbjct: 120 TKSGKSAVVWQFSHPSGAFCRDSTMSELGRIQRKS 154

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (51%), Gaps = 15/120 (12%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
           +F+  L+NILED+  +++I W+  G  F++     F S  L  +F H+N ASFVRQLN +
Sbjct: 34  LFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKF 93

Query: 110 GFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVKIWEFRHSMGIFKRGDIEGLKFIKRRSSR 169
           GFHK+     + +                G + WEF H    FK+ D   ++ I ++ SR
Sbjct: 94  GFHKIKKTQEERLMCIY------------GEQSWEFIHPN--FKKNDRILMEKISKKISR 139

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 67/139 (48%), Gaps = 7/139 (5%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPSGTS-FLIRP--TERFSRALATYFKHTNIASFV 103
           +Q   FIH+L+++L D  L+  I WS      F ++P   E     L   FKH N++SFV
Sbjct: 1   MQPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFV 60

Query: 104 RQLNMYGFHKVSNDHNKGIXXXXXXXXPSSEAGQDGVK--IWEFRHSMGIFKRGDIE-GL 160
           RQL++YGFHK+                P +   +   +  +W F H  G F +G  +  L
Sbjct: 61  RQLHLYGFHKLQTGPGAASSGPAGDNEPPTHIIKSNKESMVWYFTHPSGYFYKGACQPDL 120

Query: 161 KFIKRRSSRNIAALNVRKN 179
             I+R+S+  +     RKN
Sbjct: 121 ARIQRKSN-GVGKDGKRKN 138

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++K+++++ D     LI WS  G S ++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 229 AFVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMY 288

Query: 110 GFHKV 114
           G+HKV
Sbjct: 289 GWHKV 293

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPS-GTSFLIRP--TERFSRALATYFKHTNIASFV 103
           +Q   F+HKL++IL++  + +LI WS     +F ++P   +  +  L  YFKH N++SFV
Sbjct: 1   MQIKTFVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFV 60

Query: 104 RQLNMYGFHKV 114
           RQL+MYGFHK+
Sbjct: 61  RQLHMYGFHKI 71

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERF-SRALATYFKHTNIASFVRQLNMY 109
            F++KL++++ D+    LI WS  G SF++     F    L  YFKH+N ASFVRQLNMY
Sbjct: 196 AFVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMY 255

Query: 110 GFHKV 114
           G+HK+
Sbjct: 256 GWHKI 260

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 66/142 (46%), Gaps = 24/142 (16%)

Query: 51  VFIHKLYNILEDDDLKDLI-WWSPSGTSFLIRP--TERFSRALATYFKHTNIASFVRQLN 107
            F+H+L+++L   D K+ I W +   + F+I P   E   + L  YFKH N +SFVRQL+
Sbjct: 3   TFVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLH 62

Query: 108 MYGFHKV---SNDHNKGIXXXXXXXXPSSEAG-----------------QDGVKIWEFRH 147
           MYGF K+   +ND + G          ++                    + G   W F H
Sbjct: 63  MYGFQKLPIKNNDDSNGNVSITRGNELNNNVDIEFFNNDNPMYHIPSRPKRGSTTWHFTH 122

Query: 148 SMGIFKR-GDIEGLKFIKRRSS 168
             G F R  D+  L  I+R+SS
Sbjct: 123 PSGFFHRNSDVVTLNRIQRKSS 144

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 25/146 (17%)

Query: 47  LQNTVFIHKLYNILEDDDLKDLIWWSPSGTS-FLIRPT--ERFSRALATYFKHTNIASFV 103
           +Q   FIH+L+++L D  L+  I WS      F ++P   E   + L   FKH N++SFV
Sbjct: 1   MQPKTFIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFV 60

Query: 104 RQLNMYGFHKVS---NDHNKGIXXXXXXXXPSSEAGQDGVK------------------I 142
           RQL+MYGFHK+    N  +  +        P+S A                        +
Sbjct: 61  RQLHMYGFHKLQTGPNGMHTTVNAGAGAGLPASAATAGSTTSMDNEPPTHIIKSNKESMV 120

Query: 143 WEFRHSMGIFKRGDIE-GLKFIKRRS 167
           W F H  G F +   +  L  I+R+S
Sbjct: 121 WYFTHPSGYFYKDACQPDLARIQRKS 146

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
           (REAL)
          Length = 349

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHT--NIASFVRQLNM 108
           VF+ KL+ +L+ +   ++I W P GT F+I  T++F++ +   F  +  + ASFVRQL+ 
Sbjct: 6   VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 109 YGFHKVSNDHNK 120
           Y F K+   H K
Sbjct: 66  YEFQKMERLHGK 77

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 51  VFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRA-LATYFKHTNIASFVRQLNMY 109
           VF+ KL+++L+ +    +I WS  G+ F+I   E+F++  L  +F  ++  +FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 110 GFHKVSNDH 118
            F K    H
Sbjct: 66  SFQKTKRPH 74

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 48  QNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRA-LATYFKHTNIASFVRQL 106
           Q  VF+ KLY++L+ +   ++I WS  G+  +I   ++F++  L  +F     A+FV+QL
Sbjct: 9   QPDVFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFVKQL 68

Query: 107 NMYGFHK 113
           + Y F K
Sbjct: 69  SKYNFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
           (REAL)
          Length = 347

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 52  FIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRA-LATYFKHTNIASFVRQLNMYG 110
           F+  L+ IL+ +    +I WS  G+ F+I   ++F++  L  +F   + A+F +QL+ Y 
Sbjct: 7   FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 111 FHK 113
           F K
Sbjct: 67  FQK 69

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 61/131 (46%), Gaps = 11/131 (8%)

Query: 265 SFILHRYSIFNQQFQSQQLETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVK 324
           SFI     + + +     LE +L E   + + LR DY+ LQ +   L  + + L  D  K
Sbjct: 218 SFIKEIEEVEDNKISINSLEQQLLEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSK 277

Query: 325 LLDFLQKFVTLQKLSSEVYH----EASLKDDPSKLHQFQK-HQQEMSYLEQEILRFKANL 379
            +   QK   +QKL +EV        +LK D ++  Q +K + Q+  Y+E    ++ +++
Sbjct: 278 KMK--QKEYEVQKLKNEVKFLTNMNTNLKADKTQFSQKEKQYSQKYIYIE----KYMSHV 331

Query: 380 MQRLTKKLGSC 390
            Q   KK   C
Sbjct: 332 KQEYNKKEDEC 342

>Suva_8.287 Chr8 (521122..522432) [1311 bp, 436 aa] {ON} YOR237W
           (REAL)
          Length = 436

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 14/81 (17%)

Query: 734 IFKTSQGYSKPSDSVRADSDLP-----ATKEPSQHNIISPVPSRTDIESRRGSSGVYSLL 788
           ++  S  +S  S  ++ DS +P     ++K P++H I+ P+  +  +ESRR    V    
Sbjct: 266 LYVISGQWSGVSTIIKKDSQVPHQFYDSSKTPAEHLIVKPIEQQNPLESRRAWKDV---- 321

Query: 789 NREGSAPASPMGESSSNKKIK 809
                A A  +G +S  KK K
Sbjct: 322 -----AEAIRLGNNSMIKKAK 337

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 15/83 (18%)

Query: 305 QYKHDELLEQLRVLNTDMVKLLDFLQKF--------------VTLQKLSSEVYHEASLKD 350
           Q  H+E+ E + +LNTD V+L D L++               +T+ K+  E + ++ +  
Sbjct: 167 QACHEEMFEFMNILNTD-VELCDTLRQVLTDPEIKGKLSNEEITVGKILLEDFEKSGIYM 225

Query: 351 DPSKLHQFQKHQQEMSYLEQEIL 373
           +P    QF    QE+S + QE +
Sbjct: 226 NPEVRDQFIALSQEISLVGQEFI 248

>NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {ON}
           Anc_8.34
          Length = 1707

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 303 MLQYKHDELLEQLRVLNTDMV---KLLDFLQKFVTLQKLSSEVYHEAS 347
           ++Q  HD L+EQLR+LN D +   K +  L K  T  +LS E   E S
Sbjct: 294 LIQLLHDNLVEQLRLLNNDNITEYKDVPILVKSKTFLELSLESLRELS 341

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,258,984
Number of extensions: 2944625
Number of successful extensions: 12556
Number of sequences better than 10.0: 301
Number of HSP's gapped: 12571
Number of HSP's successfully gapped: 361
Length of query: 810
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 692
Effective length of database: 39,950,811
Effective search space: 27645961212
Effective search space used: 27645961212
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)