Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A033705.473ON37137118460.0
SAKL0G03520g5.473ON36937115630.0
ZYRO0D11220g5.473ON36837115530.0
KLTH0F15048g5.473ON36837115440.0
Kwal_55.212735.473ON36837115420.0
NDAI0C014105.473ON36937115210.0
YOR136W (IDH2)5.473ON36937115100.0
Skud_15.3005.473ON36937115000.0
Suva_8.1885.473ON36937115000.0
Smik_15.3165.473ON36937114970.0
Ecym_23135.473ON37037114940.0
CAGL0I07227g5.473ON36837114920.0
NCAS0H022505.473ON42237114960.0
KLLA0E03125g5.473ON36837114790.0
KNAG0B040705.473ON37337314760.0
AFR137C5.473ON36737114710.0
Kpol_440.125.473ON36837114710.0
KAFR0B063705.473ON37837814330.0
Kpol_543.85.473ON36837114120.0
TBLA0B022405.473ON37337314060.0
TPHA0J027705.473ON37635013780.0
TPHA0E014805.473ON37734812591e-173
Smik_14.2902.278ON3603756901e-87
Skud_14.2932.278ON3613756804e-86
YNL037C (IDH1)2.278ON3603756795e-86
Ecym_33162.278ON3623456761e-85
ADL223W2.278ON3623626761e-85
KLLA0F04103g2.278ON3613436682e-84
ZYRO0D02838g2.278ON3613776571e-82
NDAI0B035902.278ON3593546552e-82
Kwal_23.50122.278ON3613756535e-82
SAKL0E07876g2.278ON3613456492e-81
KLTH0G10186g2.278ON3603446456e-81
CAGL0G02673g2.278ON3583666422e-80
TBLA0B069102.278ON3653446371e-79
TPHA0D015602.278ON3603746361e-79
Kpol_1039.352.278ON3593436282e-78
NCAS0B062902.278ON3593766231e-77
TDEL0C038402.278ON3613806152e-76
KNAG0A052802.278ON3613456143e-76
KAFR0J014102.278ON3503755725e-70
Suva_14.3022.278ON3003175199e-63
CAGL0G02585g2.287ON3723983914e-43
YIL094C (LYS12)2.287ON3714033766e-41
Smik_9.852.287ON3714033741e-40
KLLA0E08339g2.287ON3693593741e-40
ADL214C2.287ON3673583731e-40
Suva_9.1052.287ON3713963732e-40
SAKL0E07656g2.287ON3683593722e-40
Ecym_33262.287ON3663593704e-40
NCAS0B062502.287ON3733533705e-40
Kpol_1003.392.287ON3703603705e-40
KNAG0A054202.287ON3723533662e-39
TPHA0C034102.287ON3713983643e-39
TBLA0B059402.287ON3693533635e-39
TDEL0G021802.287ON3693983627e-39
NDAI0B035502.287ON3723543628e-39
Skud_9.792.287ON3713573601e-38
ZYRO0A01914g2.287ON3683663564e-38
KLTH0G10384g2.287ON3673593443e-36
Kwal_27.115282.287ON3673633372e-35
KAFR0J013602.287ON3733793302e-34
AAL012C1.402ON3723102293e-20
KLLA0D04906g1.402ON3623042274e-20
Ecym_12961.402ON3632702274e-20
TBLA0C015001.402ON3653062275e-20
Skud_3.431.402ON3643032195e-19
NDAI0G042301.402ON3633022186e-19
TDEL0B060001.402ON3623022188e-19
YCL018W (LEU2)1.402ON3643522171e-18
Smik_3.661.402ON3643032171e-18
ZYRO0E04796g1.402ON3622662133e-18
NCAS0C048701.402ON3652662125e-18
SAKL0D08690g1.402ON3642672091e-17
Kwal_0.2251.402ON3643072081e-17
KAFR0I022001.402ON3652662062e-17
Kpol_1048.631.402ON3643042053e-17
KLTH0H12188g1.402ON3642672054e-17
Suva_3.31.402ON3642672054e-17
CAGL0H03795g1.402ON3653551966e-16
KNAG0I012801.402ON4473031889e-15
TPHA0B037301.402ON3653021833e-14
Suva_14.303singletonON53511213e-08
Kwal_26.7784singletonOFF16758730.81
KNAG0C018501.339ON49861686.4
KLLA0C16874g8.859ON44681686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03370
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   715   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   606   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   602   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   599   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   598   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   590   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   586   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   582   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   582   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   581   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   580   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   579   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    580   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   574   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   573   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   571   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   571   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   556   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   548   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   546   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   535   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   489   e-173
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   270   1e-87
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   266   4e-86
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   266   5e-86
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   265   1e-85
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   265   1e-85
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   261   2e-84
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   257   1e-82
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   256   2e-82
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   256   5e-82
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   254   2e-81
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   253   6e-81
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   251   2e-80
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            249   1e-79
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   249   1e-79
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   246   2e-78
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   244   1e-77
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   241   2e-76
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              241   3e-76
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   224   5e-70
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   204   9e-63
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   155   4e-43
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   149   6e-41
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   148   1e-40
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   148   1e-40
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   148   1e-40
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   148   2e-40
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   147   2e-40
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   147   4e-40
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   147   5e-40
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   147   5e-40
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              145   2e-39
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   144   3e-39
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   144   5e-39
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   144   7e-39
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   144   8e-39
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   143   1e-38
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   141   4e-38
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   137   3e-36
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   134   2e-35
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   131   2e-34
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    93   3e-20
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    92   4e-20
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    92   4e-20
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    92   5e-20
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    89   5e-19
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    89   6e-19
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    89   8e-19
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    88   1e-18
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    88   1e-18
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    87   3e-18
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    86   5e-18
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    85   1e-17
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    85   1e-17
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    84   2e-17
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    84   3e-17
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    84   4e-17
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       84   4e-17
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              80   6e-16
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    77   9e-15
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    75   3e-14
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    51   3e-08
Kwal_26.7784 s26 (509503..510006) [504 bp, 167 aa] {OFF} [contig...    33   0.81 
KNAG0C01850 Chr3 complement(363995..365491) [1497 bp, 498 aa] {O...    31   6.4  
KLLA0C16874g Chr3 (1473776..1473800,1474263..1475578) [1341 bp, ...    31   6.9  

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/371 (94%), Positives = 352/371 (94%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVLNVVSNPSKYSDVVYVCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 361 SSFTEAVISRL 371
           SSFTEAVISRL
Sbjct: 361 SSFTEAVISRL 371

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/371 (79%), Positives = 325/371 (87%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLRSQ+ R+   R L+S   KQPSIG++TGKP+P TGKYTVSFIEGDGVGPEISKSVKDI
Sbjct: 1   MLRSQVLRQLPRRFLSS--KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI 58

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           FAAA+VP+ WESC VTPL +NG+TTIP+ A +SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 59  FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTL 118

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKSVEGFKTTYE+VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITR+
Sbjct: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRD 178

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARAVGRPK++VVHKSTIQRLADGLFV VAKEL+ E+PDIQLQ +L+DN
Sbjct: 179 ASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDN 238

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVLNVVSNP  Y+D V VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 239 TVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGS 298

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGL+E A  IEKAVL+TIA+GPE+RT DLAGSAST
Sbjct: 299 APDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSAST 358

Query: 361 SSFTEAVISRL 371
           SSFTEAVI RL
Sbjct: 359 SSFTEAVIKRL 369

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/371 (79%), Positives = 324/371 (87%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M +SQ+CRR V RM +S   KQPSIGK+TGKPDPKTG Y VSFIEGDG+GPEISKSVKDI
Sbjct: 1   MFKSQVCRRAVARMFSS---KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           FAAAKVP+ +ES  V P+LVNGVT+IPE+AQ+SIN NLVALKGPLATP+GKGHRSMNLTL
Sbjct: 58  FAAAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFAN+RPAKSVEGFKT Y++V+LVLIRENTEGEYAGIEH IVPGVVQSIKLITRE
Sbjct: 118 RKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITRE 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIR+AYEYARA  RP+L+VVHKSTIQRL+DGLFV VAKEL  EFPDI+L+TELIDN
Sbjct: 178 ASERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDN 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
            VLN V++P+KYSD V VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 238 AVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAG++KANPTALLLSSVMML+HMGL EHAS+IEKAVLTTIAAGPESRTGDL GSAST
Sbjct: 298 APDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSAST 357

Query: 361 SSFTEAVISRL 371
           SSFTEAVI +L
Sbjct: 358 SSFTEAVIKKL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/371 (78%), Positives = 323/371 (87%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M +S   R +  R LA  T KQPSIG+YTGKPDP TGKYTVSFIEGDGVGPEISK+VKDI
Sbjct: 1   MFKSSFVRNSA-RFLA--TKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           FAAAK PI WESC V+PL +NG+TTIP+ AQ+SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 58  FAAAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKSV+G+KT Y++VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT++
Sbjct: 118 RKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQD 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARAV RPK+VVVHKSTIQRLADGLFV+VA++L+ E+PDI+LQTELIDN
Sbjct: 178 ASERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDN 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVL+ V +P+KYSDVV VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 238 TVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGL EHA KIEKAV TTIAAGPESRTGDL GSAST
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSAST 357

Query: 361 SSFTEAVISRL 371
           SSF EAVISRL
Sbjct: 358 SSFAEAVISRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/371 (78%), Positives = 323/371 (87%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M RSQ  R T+      AT KQPSIG+YTGKPDP TGKYTVSFIEGDGVGPEISK+VKDI
Sbjct: 1   MFRSQFGRNTLRFF---ATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           FAAAK PI WE+C VTPL +NG+TTIP+ AQ+SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 58  FAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS++GFKT Y++VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT++
Sbjct: 118 RKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARAV RPK++VVHKSTIQRLADGLFV+VA++LA E+PDI+LQTELIDN
Sbjct: 178 ASERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDN 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVL+ V +P KYSDVV VCPNLYGDI                   NIGH+VSIFEAVHGS
Sbjct: 238 TVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGL EHA KIEKAV +TIA+GPE+RTGDLAGSAST
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSAST 357

Query: 361 SSFTEAVISRL 371
           SSF EAVISRL
Sbjct: 358 SSFAEAVISRL 368

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/371 (76%), Positives = 318/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M R+ I R T  R L+     QPSIGK+TGKP+P TGK+TVSFIEGDG+GPEIS+SVK I
Sbjct: 1   MFRNIILRNTTRRFLS--VKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQI 58

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F AAKVPI WE C V+PL +NG+TTIPE A +SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 59  FDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 118

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS+EGFKT Y++VDLV+IRENTEGEY+GIEHV+ PGVVQSIKLITR+
Sbjct: 119 RKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRD 178

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYAYEYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDIQL+TELIDN
Sbjct: 179 ASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDN 238

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVLNVVSNPS YS+ V VCPNLYGDI                   NIGH+VSIFEAVHGS
Sbjct: 239 TVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGS 298

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGL  HA KIEKAVL+TIA+GPE RTGDLAG A+T
Sbjct: 299 APDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATT 358

Query: 361 SSFTEAVISRL 371
           SSFT+AVI RL
Sbjct: 359 SSFTDAVIGRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 320/371 (86%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR+   R T  R LA  T KQPSIG+YTGKP+P TGKYTVSFIEGDG+GPEISKSVK I
Sbjct: 1   MLRNTFFRNTSRRFLA--TVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI 58

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AA VPI WESC V+P+ VNG+TTIP+ A +SI +NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 59  FSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS+EGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITR+
Sbjct: 119 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PD+ L+TELIDN
Sbjct: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDN 238

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           +VL VV+NPS Y+D V VCPNLYGDI                   NIGHK+SIFEAVHGS
Sbjct: 239 SVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGS 298

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQ+KANPTALLLSSVMMLNHMGL  HA +I+ AVL+TIA+GPE+RTGDLAG+A+T
Sbjct: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATT 358

Query: 361 SSFTEAVISRL 371
           SSFTEAVI RL
Sbjct: 359 SSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/371 (75%), Positives = 318/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLRS + R T  R LA  T KQPSIG++TGKP+P TG+YTVSFIEGDG+GPEISKSVK I
Sbjct: 1   MLRSNLFRNTSRRFLA--TVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI 58

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F AA VPI WESC V P+ VNG+TTIP+ A +SI  NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 59  FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTL 118

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKSVEGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITR+
Sbjct: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDI L+TELIDN
Sbjct: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDN 238

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           +VL VV+NPS Y++ V VCPNLYGDI                   NIGHK+SIFEAVHGS
Sbjct: 239 SVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGS 298

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQ+KANPTALLLSSVMMLNHMGL  HA +I+ AVL+TIA+GPE+RTGDLAG+A+T
Sbjct: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATT 358

Query: 361 SSFTEAVISRL 371
           SSFTEAVI RL
Sbjct: 359 SSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/371 (75%), Positives = 317/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR+   R T  R L+  T KQPSIG+YTGKPDP TG+YTVSFIEGDG+GPEISKSVK I
Sbjct: 1   MLRNTFLRNTSRRFLS--TVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKI 58

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AA VPI WE C V P+ VNG+TTIP+ A +SI +NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 59  FSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS+EGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITRE
Sbjct: 119 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRE 178

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDI  +TELIDN
Sbjct: 179 ASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDN 238

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
            VLNVV+NPS Y++ V VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 239 KVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGS 298

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAG++KANPTALLLSSVMMLNHMGL  HA +I+ AVL+TIA+GPE+RTGDLAG+A+T
Sbjct: 299 APDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATT 358

Query: 361 SSFTEAVISRL 371
           SSFTEAVI RL
Sbjct: 359 SSFTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 318/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR+   R T  R LA  T KQPSIGKYTGKP+P TGKYTVSFIEGDG+GPEISKSVK I
Sbjct: 1   MLRNTFFRNTSRRFLA--TVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI 58

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AA VPI WE C V P+ VNG+TTIP+ A +SI +NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 59  FSAANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKSVEGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITR+
Sbjct: 119 RKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRD 178

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDI L+TELIDN
Sbjct: 179 ASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDN 238

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           +VL VV+NPS Y++ V VCPNLYGDI                   NIGHK+SIFEAVHGS
Sbjct: 239 SVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGS 298

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQ+KANPTALLLSSVMMLNHMGL  +A +I+ AVL+TIA+GPE+RTGDLAG+A+T
Sbjct: 299 APDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATT 358

Query: 361 SSFTEAVISRL 371
           SSFTEAVI RL
Sbjct: 359 SSFTEAVIKRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 318/371 (85%), Gaps = 1/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M +  I + +  R LASA+ KQPSIG++TGKP+PKTGKYTVSFIEGDG+GPEIS+SVKDI
Sbjct: 1   MFKQSIFKGS-RRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDI 59

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AAKVP+ WE C VTP+ +NG+TTIP+ A +SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 60  FSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 119

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS+EGFKTTYE+VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITR+
Sbjct: 120 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRD 179

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARAVGRPK+VVVHKSTIQRLADGLFV VA+E+  E+PDI+LQ ELIDN
Sbjct: 180 ASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDN 239

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVLNVVS P KYSD V VCPNLYGDI                   NIGH VSIFEAVHGS
Sbjct: 240 TVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGS 299

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQN ANPTALLLSSVMMLNHMGL EHA +IE AVL T+A+  ++RT DLAG+A+T
Sbjct: 300 APDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATT 359

Query: 361 SSFTEAVISRL 371
           SSFT+AVI RL
Sbjct: 360 SSFTKAVIERL 370

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 314/371 (84%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           ML  +  R    R LA+A   QPSIG++TGKP+P TGK+TVSFIEGDG+GPEIS SVK I
Sbjct: 1   MLGIRSFRLNARRFLATA---QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F AA VP+ WE+C VTP+ VNG+TTIP+ A +SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 58  FQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTF LFANVRPAKS+EGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITR+
Sbjct: 118 RKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRD 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYAYEYARA+GRP+L+VVHKSTIQRLADGLFV VAKELA E+PDIQL+TELIDN
Sbjct: 178 ASERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDN 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           T LNVVSNPS Y+D V VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 238 TCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMG+ EHA +IEKAVL TIA G E RTGDL GSAST
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSAST 357

Query: 361 SSFTEAVISRL 371
           +SFT+A+I +L
Sbjct: 358 TSFTDAIIKKL 368

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/371 (76%), Positives = 319/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M RS I R T  R+L S  H QPSIGKYTGKP+P TGKYTVSFIEGDG+GPEIS SVK I
Sbjct: 54  MFRSSILRTTTRRLL-SVKH-QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQI 111

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AAKVPI WE+C VTPL ++G+TTIPE A +SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 112 FSAAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 171

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPA+SV+GFKTTY +VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITRE
Sbjct: 172 RKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRE 231

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EY RA+GRP+LVVVHKSTIQRL+DGLFV VAKEL+ E+PDIQ +TELIDN
Sbjct: 232 ASERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDN 291

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVL VVSNPS Y+D V VCPNLYGDI                   NIG+++SIFEAVHGS
Sbjct: 292 TVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGS 351

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAG+N ANPTALLLSSVMMLNHMGL +HA +IE AVL+TIA+GPESRTGDLAG+A+T
Sbjct: 352 APDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATT 411

Query: 361 SSFTEAVISRL 371
           S+FT+AVI +L
Sbjct: 412 STFTDAVIKKL 422

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/371 (76%), Positives = 316/371 (85%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M R  I +++  R LA  T KQPSIG+YTGKP+PKTGKYTVSFIEGDGVGPEISKSVK I
Sbjct: 1   MFRQSIVKQSC-RFLA--TKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AAKVPI WESC V+P+ VNG+TTIP+ A  SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 58  FSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS+EG+KTTYE+V+LVLIRENTEGEY+GIEHV+ PGVVQSIKLIT++
Sbjct: 118 RKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYARAV R K++VVHKSTIQRLADGLFV VAK+L+ E+PDI+LQTEL+DN
Sbjct: 178 ASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDN 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVL  V +P  Y DVV VCPNLYGDI                   NIGH VSIFEAVHGS
Sbjct: 238 TVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGL EHA KIEKAVLTTIA+  ++RTGDL GSAST
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAST 357

Query: 361 SSFTEAVISRL 371
           SSFT+AVI RL
Sbjct: 358 SSFTDAVIERL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/373 (73%), Positives = 318/373 (85%), Gaps = 2/373 (0%)

Query: 1   MLRSQICRR--TVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK 58
           MLR+ + R   T  R LA++   QPSIG++TGKP+P TGK+ VSFIEGDG+GPEIS+SVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 59  DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNL 118
           DIF AA+VPI WE C VTP+ VNG+TTIP+ A  SIN+NL+ALKGPLATPIGKGHRS+NL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
           TLRKTF LFANVRPAKS+EGFKTTY DVDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELI 238
           R+ASERVIRYA+EYA+A+GRP++VVVHKSTIQRLADGLFV VAKEL+ E+P+I+L+TELI
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 239 DNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVH 298
           DNTVLNVVSNP+ Y+D V VCPNLYGDI                   NIG+++SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 299 GSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSA 358
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + AS+IE+AVLTTIA+  ++RTGDL GSA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 359 STSSFTEAVISRL 371
           +TSSFT+AVI  L
Sbjct: 361 TTSSFTDAVIKNL 373

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 314/371 (84%), Gaps = 4/371 (1%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR ++ + +  R LAS   +QPSIG+Y GKP+   GKYTVSFIEGDGVGPEIS+SVKDI
Sbjct: 1   MLRQKLFQGS-RRWLASV--RQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDI 56

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AA VP+ WE C VTPLLVNG+TTIPE A  SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 57  FSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTL 116

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTFGLFANVRPAKS+EG+KTTY DVDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITRE
Sbjct: 117 RKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRE 176

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EYAR VGRPK+VVVHKSTIQRLADGLFV VA+EL  E+PDI+LQTEL+DN
Sbjct: 177 ASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDN 236

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           TVLNVV+ P  Y DVV VCPNLYGDI                   NIGH+VSIFEAVHGS
Sbjct: 237 TVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGS 296

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAVL+TIA+  E+RT DLAG+AST
Sbjct: 297 APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTAST 356

Query: 361 SSFTEAVISRL 371
           SSFT AVI RL
Sbjct: 357 SSFTNAVIERL 367

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/371 (74%), Positives = 318/371 (85%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR+ I R +  RM+   T  QP+IG++TGKP+P TGKYTV FIEGDGVGPEISKSVKDI
Sbjct: 1   MLRNTIYRGSFARMM---TTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           FAAAKVPI WE C V P+ VNG+TTIP+ A +SIN++LVALKGPLATPIGKGHRS+NLTL
Sbjct: 58  FAAAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTF LFANVRPA+SV  +KTTY++VDLVLIRENTEGEY+GIEHVI PGV+QSIKLIT++
Sbjct: 118 RKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKD 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           ASERVIRYA+EY RA+GRP+LVVVHKSTIQR+ADGLFV VAKELA E+PDI+LQTELIDN
Sbjct: 178 ASERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDN 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           T+LNVV++P  Y+D V VCPNLYGDI                   NIG KVSIFEAVHGS
Sbjct: 238 TILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMMLNHMGL EHA+KIE A+L+TIA+G E+RTGDLAG+A+T
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATT 357

Query: 361 SSFTEAVISRL 371
           SSFTEAVI++L
Sbjct: 358 SSFTEAVINKL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/378 (71%), Positives = 311/378 (82%), Gaps = 7/378 (1%)

Query: 1   MLRSQICRRT-----VNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISK 55
           MLR  +  R        R L+    +QPSIG++TGKPD  TGKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 56  SVKDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRS 115
           SVKDIF AA VPI WE+C V+P+LV+G+TTIP++A +SIN+NLV LKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 116 MNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIK 175
           +NLTLRKTF LFANVRPAKSV GFKTTY++VDLVLIRENTEGEY+GIEHV+ PGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 176 LITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHE--FPDIQL 233
           LITR+ASERVIRYA+EYA+A+GRPK++VVHKSTIQRL+DGLFV VAKEL  E  F +I+L
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 234 QTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSI 293
            TELIDNTVLNVV NPSKYSD V+VCPNLYGDI                   NIG K+SI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 294 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGD 353
           FEAVHGSAPDIAGQNKANPTALLLSSVMML+HMGL E+  KIE AVL TIAA  ++RTGD
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 354 LAGSASTSSFTEAVISRL 371
           L G+A+T+SFTEAVI  L
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/371 (71%), Positives = 309/371 (83%), Gaps = 3/371 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M  S++  RTV+R L++    QPSIG++TGKPDP TGK+TV FIEGDGVGPEIS+SVK I
Sbjct: 1   MFNSRLQLRTVSRFLSTG---QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKI 57

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F+AAKVPI W  C V P+ VNG TTIPE A E IN++L+ALKGPLATPIGKGHRS+NLTL
Sbjct: 58  FSAAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTL 117

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RKTF LFANVRPA+S+  +K+TYE+VDLVLIRENTEGEY+GIEHVI PGV+QSIKLITRE
Sbjct: 118 RKTFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITRE 177

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240
           A+ERV+RYA+EY +A+GRP+L+V+HKSTIQR+ADGLFV VA+ELA E+PDI+L+TE+ID 
Sbjct: 178 ATERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDK 237

Query: 241 TVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS 300
           ++LNVVS P  YSD V VCPNLYGDI                   NIG KVSIFEAVHGS
Sbjct: 238 SILNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGS 297

Query: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360
           APDIAGQNKANPTALLLSSVMML HMGL EHA+KIE AVLTTIA+G E+RT DL+G+AST
Sbjct: 298 APDIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTAST 357

Query: 361 SSFTEAVISRL 371
           SSFTE VI RL
Sbjct: 358 SSFTEEVIQRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/373 (69%), Positives = 314/373 (84%), Gaps = 2/373 (0%)

Query: 1   MLRSQICRRTVNRMLASATHKQPS--IGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK 58
           MLR+   +++  R+ ++++  + S  +GKY G P+P TG++TV FIEGDGVGPEISKSVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 59  DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNL 118
           DIF AA+VP+ WE C V+PLL+NG+TTIPE A + IN++ +ALKGPLATPIGKGHRS+NL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
           TLRKTFGLFANVRPA+S+ G++TTY++VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELI 238
           R+ASERVIRYAYEYARA+GRP+LVVVHKSTIQ+LADGLFV +AKELA EFPDI+L+TELI
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 239 DNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVH 298
           DNTVLNVV +P  Y+D V VCPNLYGDI                   NIG++VSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 299 GSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSA 358
           GSAPDIAGQNKANPTALLLSS MMLN+MGL  +++KIE A+L TIA+G E+RTGDLAG+A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 359 STSSFTEAVISRL 371
           +TSSFTE+VI  L
Sbjct: 361 TTSSFTESVIKNL 373

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 295/350 (84%), Gaps = 1/350 (0%)

Query: 22  QPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVN 81
           QP+IG++TGK +  +G YTV FIEGDGVGPEISKSVKDIF+AA VPI W+ C V P+ VN
Sbjct: 28  QPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPIFVN 86

Query: 82  GVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTLRKTFGLFANVRPAKSVEGFKT 141
           G+TTIPE A ++I  +LVALKGPLATP+GKGHRS+NLTLRKTF LFANVRPAKSV  +K+
Sbjct: 87  GLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPNYKS 146

Query: 142 TYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKL 201
           TYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITREASE+VIRYAYEYA AVGRP+L
Sbjct: 147 TYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGRPRL 206

Query: 202 VVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPN 261
           +VVHKSTIQRL DGLFV +A EL  E+P I+L+T+++DNTVLNVVSNP+ Y D V VCPN
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVCPN 266

Query: 262 LYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 321
           LYGDI                   NIG KVSIFEAVHGSAPDIAGQNKANPTALLLSSVM
Sbjct: 267 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 326

Query: 322 MLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           MLNHMGL EHAS+IE AVL+TIA+GPESRTGDL GSA+TSSFTE VI +L
Sbjct: 327 MLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  489 bits (1259), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/348 (67%), Positives = 280/348 (80%), Gaps = 1/348 (0%)

Query: 24  SIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVNGV 83
           SIG + GKP+P+TG YTV FIEGDGVGPEISKSV+ IF AAKVPI W +C + PLL+NG 
Sbjct: 30  SIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNCDIGPLLINGE 89

Query: 84  TTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTLRKTFGLFANVRPAKSVEGFKTTY 143
           TTIP+ A + IN +L+ALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPAKS+    +TY
Sbjct: 90  TTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPAKSIPNLASTY 149

Query: 144 EDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVV 203
           E+VDL++IRENTEGEY+GIEH IVPGVVQSIKLITR+ASE+VI+YA+EY R++GR  L+V
Sbjct: 150 ENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYTRSIGRSNLIV 209

Query: 204 VHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLY 263
           VHK+TIQR  DGLFV  A+E+A ++PD+ L+ ELIDNTVLN + NP KY+D V VCPNLY
Sbjct: 210 VHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVCPNLY 269

Query: 264 GDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMML 323
           GDI                   NIG  V ++EAVHGSAPDIAGQ+KANPTALLLSSVMML
Sbjct: 270 GDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPTALLLSSVMML 328

Query: 324 NHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           NHMGL ++A  IE AVLTTI +G E RT DL GSA+T+SFT+AVI  L
Sbjct: 329 NHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  270 bits (690), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/375 (41%), Positives = 227/375 (60%), Gaps = 22/375 (5%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           ML   I +RT    LA+A   + ++ K  G      G++TV+ I GDGVG EI+ SVK I
Sbjct: 1   MLNRTIAKRT----LATAAQAERALPKKYG------GRFTVTLIPGDGVGKEITDSVKTI 50

Query: 61  FAAAKVPIVWESCPVTPL-LVNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNL 118
           F A K+P+ WE+  +       GV     +A ES+ RN + LKG   TP  + GH S+N+
Sbjct: 51  FEAEKIPVDWETVNIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNV 106

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
            LRK   ++ANV   KS++G KT   D+DL++IRENTEGE++G+EH  VPGVV+S+K++T
Sbjct: 107 ALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMT 166

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH-EFPDIQLQTEL 237
           R  +ER+ R+A+++A+   R  +  VHK+ I +L DGLF  +  E+   E+PDI + + +
Sbjct: 167 RPKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSII 226

Query: 238 IDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-A 296
           +DN  +  V+ P ++   V V P++YG I                   N G   ++FE  
Sbjct: 227 VDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPG 283

Query: 297 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAG 356
                 DI GQN ANPTA++LSSV+MLNH+GL E+A++I KAV  TIA G  + T D+ G
Sbjct: 284 SRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHT-TKDIGG 342

Query: 357 SASTSSFTEAVISRL 371
           S+ST+ FT  +I++L
Sbjct: 343 SSSTTDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  266 bits (680), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 153/375 (40%), Positives = 227/375 (60%), Gaps = 22/375 (5%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           ML   I +RT    LA+A   + ++ K  G      G++TV+ I GDGVG EI+ SV+ I
Sbjct: 1   MLNRTIAKRT----LATAAQAERTLPKKYG------GRFTVTLIPGDGVGKEITDSVRTI 50

Query: 61  FAAAKVPIVWESCPVTPL-LVNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNL 118
           F A ++P+ WE+  +       GV     +A ES+ RN + LKG   TP  + GH S+N+
Sbjct: 51  FEAERIPVDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNV 106

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
            LRK   ++ANV   KS++G KT   D+DL++IRENTEGE++G+EH  VPGVV+S+K++T
Sbjct: 107 ALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMT 166

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH-EFPDIQLQTEL 237
           +  +ER+ R+A+++A+   R  +  VHK+ I +L DGLF  +  E+   E+PDI + + +
Sbjct: 167 KPKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTEYPDIDVSSII 226

Query: 238 IDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-A 296
           +DN  +  V+ P ++   V V P++YG I                   N G   ++FE  
Sbjct: 227 VDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPG 283

Query: 297 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAG 356
                 DI GQN ANPTA++LSSV+MLNH+GL E+A++I KAV  TIA G  + T D+ G
Sbjct: 284 SRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHT-TRDIGG 342

Query: 357 SASTSSFTEAVISRL 371
           S+ST+ FT  VI++L
Sbjct: 343 SSSTTDFTNEVINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  266 bits (679), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 153/375 (40%), Positives = 225/375 (60%), Gaps = 22/375 (5%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           ML   I +RT    LA+A   + ++ K  G      G++TV+ I GDGVG EI+ SV+ I
Sbjct: 1   MLNRTIAKRT----LATAAQAERTLPKKYG------GRFTVTLIPGDGVGKEITDSVRTI 50

Query: 61  FAAAKVPIVWESCPVTPL-LVNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNL 118
           F A  +PI WE+  +       GV     +A ES+ RN + LKG   TP  + GH S+N+
Sbjct: 51  FEAENIPIDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNV 106

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
            LRK   ++ANV   KS++G KT   D+DL++IRENTEGE++G+EH  VPGVV+S+K++T
Sbjct: 107 ALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMT 166

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH-EFPDIQLQTEL 237
           R  +ER+ R+A+++A+   R  +  VHK+ I +L DGLF  +  E+   E+PDI + + +
Sbjct: 167 RPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSII 226

Query: 238 IDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-A 296
           +DN  +  V+ P ++   V V P++YG I                   N G   ++FE  
Sbjct: 227 VDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPG 283

Query: 297 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAG 356
                 DI GQN ANPTA++LSS +MLNH+GL E+A++I KAV  TIA G  + T D+ G
Sbjct: 284 SRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHT-TRDIGG 342

Query: 357 SASTSSFTEAVISRL 371
           S+ST+ FT  +I++L
Sbjct: 343 SSSTTDFTNEIINKL 357

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  265 bits (676), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 148/345 (42%), Positives = 212/345 (61%), Gaps = 13/345 (3%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVN--GVTTIPEQ 89
           P    G+YTV+ I GDGVG E++ SV +IF A  VPI WES  ++ L  N  GV    ++
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAENVPIDWESVELSGLEENMEGV----QK 78

Query: 90  AQESINRNLVALKGPLATPIGK-GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDL 148
           A ES+ RN V LKG  +TP  + GH S+N+  RK   +FANV   KS  G KT  +DVDL
Sbjct: 79  AVESLKRNKVGLKGIWSTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDL 138

Query: 149 VLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKST 208
           V+IRENTEGEY+G+EH  VPGVV+S+K++T+  SER+ R+A+++A    R  +  VHK+ 
Sbjct: 139 VIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRRSVCAVHKAN 198

Query: 209 IQRLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIX 267
           I +L DGLF     E+ A E+P++++++ ++DN  +  V+ P ++   V V PNLYG I 
Sbjct: 199 IMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 255

Query: 268 XXXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 326
                             N G + ++FE        DI GQ+ ANPTA++LSS +ML H+
Sbjct: 256 LGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHL 315

Query: 327 GLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           GL ++A +I KA    IA G  + T D+ G AST+ FT+A++ +L
Sbjct: 316 GLNDYADRISKATYEVIAEGKHT-TKDIGGHASTTQFTKAIVDKL 359

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  265 bits (676), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 151/362 (41%), Positives = 216/362 (59%), Gaps = 13/362 (3%)

Query: 15  LASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCP 74
           L+  T +  + G+    P    G+YTV+ I GDG+G E++ SV  IF A  VP+ WES  
Sbjct: 6   LSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDWESVE 65

Query: 75  VTPLLVN--GVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNLTLRKTFGLFANVR 131
           ++ L  N  GV    ++A ES+ RN V LKG   TP  + GH S+N+  RK   +FANV 
Sbjct: 66  LSALEENHEGV----QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVA 121

Query: 132 PAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYE 191
             KS  G KT  +DVDLV+IRENTEGEY+G+EH  VPGVV+S+K++T+  SER+ R+A++
Sbjct: 122 LFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFD 181

Query: 192 YARAVGRPKLVVVHKSTIQRLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPS 250
           +A    R  +  VHK+ I +L DGLF     E+ A E+P++ + + ++DN  +  V+ P 
Sbjct: 182 FALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQAVAKPH 241

Query: 251 KYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNK 309
           ++   V V PNLYG I                   N G + ++FE        DI GQ+ 
Sbjct: 242 QFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDV 298

Query: 310 ANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVIS 369
           ANPTA++LSS +ML H+GL E+A +I +A   TIA G  + T D+ G+A+T+ FT AVI 
Sbjct: 299 ANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRT-TKDIGGTATTTEFTNAVID 357

Query: 370 RL 371
           +L
Sbjct: 358 KL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  261 bits (668), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/343 (42%), Positives = 207/343 (60%), Gaps = 10/343 (2%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQ 91
           P    G+YTV+ I GDGVG E++ SV  IF    +PI WE+  ++ L     T   ++A 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGL---ENTENVQRAV 79

Query: 92  ESINRNLVALKGPLATPIGK-GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVL 150
           ES+ RN V LKG   TP  + GH S+N+ LRK   +FANV   KS+ G KT   ++D+V+
Sbjct: 80  ESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 151 IRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTIQ 210
           IRENTEGEY+G+EH  VPGVV+S+K++TR  SER+ R+A+++A    R  +  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 211 RLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXX 269
           +L DGLF     E+ A+E+P++ ++  ++DN  +  V+ P ++   V V PNLYG I   
Sbjct: 200 KLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 256

Query: 270 XXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 328
                           N G + ++FE        DI GQN ANPTA++LSS +ML H+GL
Sbjct: 257 NIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGL 316

Query: 329 FEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
             +A +I KA    I+ G +S T D+ GSASTS FT AVI +L
Sbjct: 317 NAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  257 bits (657), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 153/377 (40%), Positives = 225/377 (59%), Gaps = 25/377 (6%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M R  + +RT    LA+    +  + K  G      G+YTV+ I GDGVG E++ SV  I
Sbjct: 1   MFRHSLTKRT----LATVATTEKMLPKKYG------GRYTVTLIPGDGVGKEVTDSVVSI 50

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPE--QAQESINRNLVALKGPLAT-PIGK-GHRSM 116
           F A  VP+ W+   ++     GV    +   A ES+ RN + LKG   T P  + GH S+
Sbjct: 51  FKAENVPVDWDRVDIS-----GVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSL 105

Query: 117 NLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKL 176
           N+ LRK   ++ANV   KS+ G +    DVDLV+IRENTEGE++G+EH  VPGVV+S+K+
Sbjct: 106 NVALRKELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKI 165

Query: 177 ITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH-EFPDIQLQT 235
           +T++  ER+ R+A++YA+   R ++V VHK+ I ++ DGLF  + +E+   E+P++Q+  
Sbjct: 166 MTQDNIERIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGN 225

Query: 236 ELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE 295
            ++DN  +  V+NP ++   V V P++YG I                   N G  V++FE
Sbjct: 226 IIVDNASMQTVANPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFE 282

Query: 296 -AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDL 354
                   DI GQN ANPTA++LSSV++LNH+GL   A +I KAV   IA G +S T D+
Sbjct: 283 PGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG-KSVTRDI 341

Query: 355 AGSASTSSFTEAVISRL 371
            G+AST+ FTEAVI++L
Sbjct: 342 GGTASTTEFTEAVINKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  256 bits (655), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 220/354 (62%), Gaps = 16/354 (4%)

Query: 24  SIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPL-LVNG 82
           ++ K T  P    G++TV+ + GDGVG EI+ SV  IF +  VPI WE+  ++ L    G
Sbjct: 13  TLAKETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGLDHTEG 72

Query: 83  VTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNLTLRKTFGLFANVRPAKSVEGFKT 141
           V    + A +S+ RN + LKG   TP  + GH S+N+  RK   ++ANV   KS+EG KT
Sbjct: 73  V----KAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKT 128

Query: 142 TYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKL 201
              +VDLV+IRENTEGEY+G+EH  VPGVV+S+K+IT+  SER+ R+A+++A+   R  +
Sbjct: 129 KIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSV 188

Query: 202 VVVHKSTIQRLADGLFV-TVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCP 260
             VHK+ I +L+DGLF  TV+K    E+P+IQ  + ++DN  +  V+ P ++   V V P
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQFD--VMVTP 246

Query: 261 NLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGS---APDIAGQNKANPTALLL 317
           ++YG I                   N G   ++FE   GS     DI GQN ANPTA+LL
Sbjct: 247 SMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEP--GSRHVGLDIKGQNVANPTAMLL 303

Query: 318 SSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           S+ ++L+H+GL + A++I+ AV   IA G ++ T D+ GSAST+ FT+AVI++L
Sbjct: 304 SATLLLDHLGLEKSANRIKSAVYDVIAEG-KATTQDIGGSASTTEFTQAVINKL 356

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  256 bits (653), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 221/375 (58%), Gaps = 21/375 (5%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLRS +      R LA+   +Q    KY G+       YTV+ I GDGVG E++ SV  I
Sbjct: 1   MLRSGLG--VSKRSLATMAAEQLLPKKYGGR-------YTVTLIPGDGVGKEVTDSVVSI 51

Query: 61  FAAAKVPIVWESCPVTPLL-VNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNL 118
           F +  +PI WE+  ++ L    GV    ++A ES+ RN V LKG   TP  + GH S+N+
Sbjct: 52  FESENIPIDWETVEISGLDNQEGV----QKAVESLKRNKVGLKGIWHTPSDQTGHGSLNV 107

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
            LRK   +FANV   KSV G  + + +VD+V+IRENTEGEY+G+EH  VPGVV+S+K++T
Sbjct: 108 ALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPGVVESLKIMT 167

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKEL-AHEFPDIQLQTEL 237
           +  SER+ R+A+++A    R  +  VHK+ I +L DGLF     E+ A E+P+I ++  +
Sbjct: 168 KAKSERIGRFAFDFAVKNNRKSVCAVHKANIMKLGDGLFRNCINEVGAKEYPEIDVKNII 227

Query: 238 IDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-A 296
           +DN  +  V+ P ++   V V PNLYG I                   N G + ++FE  
Sbjct: 228 VDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPG 284

Query: 297 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAG 356
                 DI GQN ANPTA++LSS +ML H+GL  +A +I KA    IA   ++ T D+ G
Sbjct: 285 SRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEA-KTTTQDIGG 343

Query: 357 SASTSSFTEAVISRL 371
           SAST+ FTEA+IS+L
Sbjct: 344 SASTTEFTEAIISKL 358

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  254 bits (649), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 207/345 (60%), Gaps = 14/345 (4%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVNGVTTIP--EQ 89
           P    G+YTV+ I GDGVG E++ SV  IF A  VPI WE+  +T     GV +    ++
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINIT-----GVDSEEGVQK 77

Query: 90  AQESINRNLVALKGPLATPIGK-GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDL 148
           A ES+ RN + LKG   TP  + GH S+N+  RK   +FANV   K+V G KT   ++DL
Sbjct: 78  AVESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDL 137

Query: 149 VLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKST 208
           V+IRENTEGEY+G+EH  VPGVV+S+K+IT+  SER+ R+A+++A    R  +  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 209 IQRLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIX 267
           I +L DGLF     E+ A E+P+I ++  ++DN  +  V+ P ++   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEVGASEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 268 XXXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 326
                             N G + ++FE        DI G++ ANPTA++LSS +ML H+
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHL 314

Query: 327 GLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           GL  +A +I KA    IA G  + T D+ GS+ST+ FT++VI +L
Sbjct: 315 GLNGYADRISKATYDVIAEGKHT-TKDIGGSSSTTEFTKSVIDKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  253 bits (645), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 144/344 (41%), Positives = 208/344 (60%), Gaps = 12/344 (3%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLL-VNGVTTIPEQA 90
           P    G+YTV+ I GDGVG E++ SV  IF +  VPI WE+  ++ L    GV    ++A
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEISGLDNEEGV----QKA 77

Query: 91  QESINRNLVALKGPLATPIGK-GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLV 149
            +S+ RN V LKG   TP  + GH S+N+ LRK   +FANV   K+V G  + + +VDLV
Sbjct: 78  VDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLV 137

Query: 150 LIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTI 209
           +IRENTEGEY+G+EH  VPGVV+S+K++T+  S+R+ R+A+++A    R  +  VHK+ I
Sbjct: 138 VIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKANI 197

Query: 210 QRLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXX 268
            +L DGLF     E+ A E+P+I+++  ++DN  +  V+ P ++   V V PNLYG I  
Sbjct: 198 MKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-L 254

Query: 269 XXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 327
                            N G + ++FE        DI GQN ANPTA++LSS +ML H+G
Sbjct: 255 GNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLG 314

Query: 328 LFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           L  +A +I KA    IA    + T D+ GSAST+ FT+A+I +L
Sbjct: 315 LNSYADRISKATYDVIAEAKNT-TKDIGGSASTTDFTQAIIEKL 357

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  251 bits (642), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/366 (40%), Positives = 214/366 (58%), Gaps = 16/366 (4%)

Query: 9   RTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPI 68
           RTV R   ++  K+  + K  G      G+YTV+ I GDGVG EI+ SV  IF A  +P+
Sbjct: 3   RTVQRRGMASMAKELVLPKKYG------GRYTVTLIPGDGVGKEITDSVVSIFEAENIPV 56

Query: 69  VWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIG-KGHRSMNLTLRKTFGLF 127
            WE   ++    + +  +  QA ES+ RN + LKG   T      H S N+ LRK   +F
Sbjct: 57  DWERVDIST--SDNIQDV-SQAVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMF 113

Query: 128 ANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIR 187
           A+V   KSV G KT   +VDLV+IRENTEGEY+G+EH  VPGVV+S+K+IT+  SER+ R
Sbjct: 114 AHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIAR 173

Query: 188 YAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVV 246
           +A+++A+   R  +  VHK+ I ++ DGLF     E+ A+E+PDIQ  + ++DN  +  V
Sbjct: 174 FAFDFAKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAV 233

Query: 247 SNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIA 305
           + P ++   V V P++YG I                   + G + ++FE        DI 
Sbjct: 234 AKPHQFD--VMVTPSMYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIK 290

Query: 306 GQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365
           G+N ANPTA++LSS +ML H+GL E A +I KA    I+ G +  T D+ GSAST+ FTE
Sbjct: 291 GKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFTE 349

Query: 366 AVISRL 371
           A+I RL
Sbjct: 350 AIIKRL 355

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  249 bits (637), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 204/344 (59%), Gaps = 12/344 (3%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPL-LVNGVTTIPEQA 90
           P    G+YTV+ I GDGVG E++ SV  IF A  +PI WE   ++ L    GV    E A
Sbjct: 27  PKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPIDWERVDISGLDHEEGV----EAA 82

Query: 91  QESINRNLVALKGPLATPIGKG-HRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLV 149
             S+ RN + LKG   T  G+  H S+N+ LRK   ++ANV   K++ G KT   DVDLV
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 150 LIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTI 209
           +IRENTEGEY+G+EH  VPGVV+S+K+IT+E SER+ R+A+++A+   R  +  VHK+ I
Sbjct: 143 IIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIARFAFDFAKRFDRKLVTAVHKANI 202

Query: 210 QRLADGLFVTVAKELAH-EFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXX 268
            +L DGLF      +   E+PDI++ + ++DN  +  V+ P ++   V V P++YG I  
Sbjct: 203 MKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQSVAKPHQFD--VLVTPSMYGTI-L 259

Query: 269 XXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMG 327
                            N G + ++FE        DI GQN ANPTA++LSS ++L H+G
Sbjct: 260 GNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLKHLG 319

Query: 328 LFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           L   A KIE AV  TIA G +  T D+ GSAST+ FT  +I +L
Sbjct: 320 LNNEAKKIEDAVYKTIAEG-KVTTRDIGGSASTTEFTNEIIKKL 362

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  249 bits (636), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 222/374 (59%), Gaps = 20/374 (5%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR  + +R++    AS T     + K  G      G+YTV+ I GDG+G E++ SV  I
Sbjct: 1   MLRQVVSKRSI----ASFTKNHNIVPKKYG------GRYTVTLIPGDGIGKEVTDSVVKI 50

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNLT 119
           FA+  +PI WE   V P + N      ++A ES+ RN + LKG   T   + G+ S+N+ 
Sbjct: 51  FASQGLPIDWERIDV-PGMSN--ENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVA 107

Query: 120 LRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITR 179
           LRK   +FANV   KS++G KT   DVDLV+IRENTEGEY+G+EH  VPGVV+S+K+IT+
Sbjct: 108 LRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITK 167

Query: 180 EASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFV-TVAKELAHEFPDIQLQTELI 238
             +ER+ R+A+++A    R  +  VHK+ I +L+DGLF  TVA+    E+PDI++ T ++
Sbjct: 168 PKTERIARFAFDFALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIV 227

Query: 239 DNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-AV 297
           DN  +  V+ P ++   V V P++YG I                   N G + ++FE   
Sbjct: 228 DNASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGS 284

Query: 298 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGS 357
                DI  QN ANPTA++LS+ +MLN +GL E + +I  AV   I  G ++ T D+ G+
Sbjct: 285 RHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEG-KTTTKDIGGN 343

Query: 358 ASTSSFTEAVISRL 371
           AST+ FT+AVI +L
Sbjct: 344 ASTTEFTDAVIDKL 357

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  246 bits (628), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 202/343 (58%), Gaps = 11/343 (3%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQ 91
           P    G+YTV+ + GDGVG EI+ SV  IF A  +PI WE   ++ L    V T    A 
Sbjct: 22  PKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDWERVELSGLEQEDVHT----AV 77

Query: 92  ESINRNLVALKGPLATPIG-KGHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVL 150
           ES+ RN + LKG   T     GH S N+ LRK   ++ANV   KS +G  T   DVDLV+
Sbjct: 78  ESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVI 137

Query: 151 IRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTIQ 210
           IRENTEGEY+G+EH  VPGVV+S+K++T + +ER+ R+A++YA    R  +  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRKSVTAVHKANIM 197

Query: 211 RLADGLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXX 269
           +L DGLF  +  E+ A E+P++ + + ++DN  +  V+ P ++   V V P++YG I   
Sbjct: 198 KLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQFD--VMVAPSMYGTI-LG 254

Query: 270 XXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 328
                           N G   ++FE        DI  QN ANPTA++LS+ +MLNH+G 
Sbjct: 255 NIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGF 314

Query: 329 FEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
              A++I KAV   IA G ++ T D+ GSA+T+ FT AVI++L
Sbjct: 315 RNDAARISKAVHEVIAEG-KTTTRDIGGSATTTEFTNAVIAKL 356

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  244 bits (623), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/376 (39%), Positives = 217/376 (57%), Gaps = 25/376 (6%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M R  I +RT    LA+   K+  + K  G      G+ TV+ + GDGVG EI+ SV  I
Sbjct: 1   MFRQTIAKRT----LATFIPKETILPKKYG------GRMTVTLLPGDGVGKEITDSVVSI 50

Query: 61  FAAAKVPIVWESCPVTPL-LVNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNL 118
           F A  VPI WE+  ++ L   +GV      A ES+ RN + LKG   T   + GH S+N+
Sbjct: 51  FQAENVPIDWETVDISQLDHEDGVNA----AVESLKRNKIGLKGIWHTSADQVGHGSLNV 106

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
             RK   ++ANV   KS+ G KT   +VDLV+IRENTEGEY+G+EH  VPGVV+S+K++T
Sbjct: 107 AFRKQLDIYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVT 166

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELI 238
           +  SER+ ++A+++A    R  +  VHK+ I +L+DGLF      +   +P I+  + ++
Sbjct: 167 KVNSERIAKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIV 226

Query: 239 DNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVH 298
           DN  +  V+ P ++   V V P++YG I                   N G + ++FE   
Sbjct: 227 DNASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEP-- 281

Query: 299 GS---APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLA 355
           GS     DI GQN ANPTA++LSS ++L H+GL + AS+I KAV   I  G  + T D+ 
Sbjct: 282 GSRHVGLDIKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEG-NATTKDIG 340

Query: 356 GSASTSSFTEAVISRL 371
           G+AST+ FT+AVI +L
Sbjct: 341 GNASTTEFTKAVIDKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  241 bits (615), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 151/380 (39%), Positives = 221/380 (58%), Gaps = 31/380 (8%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLRS + +R    M AS    +  + K  G      G++ V+ I GDGVG E++ SV  I
Sbjct: 1   MLRSAVGKR----MFASVAAAEKVLPKKYG------GRFVVTLIPGDGVGKEVTDSVVSI 50

Query: 61  FAAAKVPIVWESCPVTPL-LVNGVTTIPEQAQESINRNLVALKG----PLATPIGKGHRS 115
           F A  +PI W+   ++ L    GV    + A +S+ RN + LKG      A   GKG  S
Sbjct: 51  FEAENLPIDWDRVDISGLDHEEGV----QAAVDSLKRNKIGLKGIWHTSAADQAGKG--S 104

Query: 116 MNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIK 175
           +N+ LRK   ++ANV   KSV G KT   +VDLV+IRENTEGEY+G+EH  VPGVV+S+K
Sbjct: 105 LNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLK 164

Query: 176 LITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELA-HEFPDIQLQ 234
           ++T + +ER+ R+A+++A+   R  +  VHK+ I +L DGLF  V   +   E+PD+++ 
Sbjct: 165 IMTEDKTERIARFAFDFAKKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQEYPDVKVG 224

Query: 235 TELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIF 294
           + ++DN  +  V+ P ++   V V P++YG I                   N G + ++F
Sbjct: 225 SIIVDNASMQTVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGREYAVF 281

Query: 295 EAVHGS---APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRT 351
           E   GS     DI  +N ANPTA++LS+ +ML+H+GL   A+KI  AV   IA G +S T
Sbjct: 282 EP--GSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEG-KSTT 338

Query: 352 GDLAGSASTSSFTEAVISRL 371
            D+ GSAST+ FT+AVI +L
Sbjct: 339 PDIGGSASTTEFTQAVIEKL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  241 bits (614), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 140/345 (40%), Positives = 199/345 (57%), Gaps = 13/345 (3%)

Query: 32  PDPKTGKYTVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPVTPL-LVNGVTTIPEQA 90
           P+   G+YTV+ + GDGVG E + SV  +F A  +PI WE   ++ L    GV      A
Sbjct: 20  PNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIVNISGLDHKEGVAA----A 75

Query: 91  QESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDL 148
            +S+ RN + LKG   T      GH S+N+  RK   ++ANV   KS++G KT   DVDL
Sbjct: 76  VQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDL 135

Query: 149 VLIRENTEGEYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKST 208
           V+IRENTEGE++G+EH  V GVV+S+K+ T   +ER+ R+A+ YA+  GR  +  VHK+ 
Sbjct: 136 VVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAFNYAQKNGRKAVCAVHKAN 195

Query: 209 IQRLADGLFVTVAKELAH-EFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIX 267
           I +L DGLF      +   E+PDI+  + ++DN  +  V+ P ++   V V P++YG I 
Sbjct: 196 IMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 252

Query: 268 XXXXXXXXXXXXXXXXXXNIGHKVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 326
                             N G + ++FE        DI GQN ANPTA+LLSS +MLNH+
Sbjct: 253 IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHL 312

Query: 327 GLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           GL +   +I  AV   IA G + RT D+ G A+T+ FT+AVI +L
Sbjct: 313 GLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVIEKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  224 bits (572), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 138/375 (36%), Positives = 212/375 (56%), Gaps = 33/375 (8%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR+ + RR+++                T  P    G++ ++ I G+G+G E++ SV+ I
Sbjct: 1   MLRNTLLRRSIS----------------TISPKKYGGRFQITLIPGNGIGKEVTDSVRSI 44

Query: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120
           F A  +PI WE   +     +G+ T    A +SI RN +ALKG  ++    G  S+N+ L
Sbjct: 45  FQAENLPIDWEIVNIESHR-DGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNVAL 97

Query: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180
           RK   +FANV   KS +   T   +VDLV+IRENTEGE++G+EH  V GVV+S+K++T+ 
Sbjct: 98  RKQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKP 157

Query: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELA-HEFPDIQLQTELID 239
            +ER+ R+A+++A+   R  +  VHK+ I +L DGLF  +   +  +E+P+I+  + ++D
Sbjct: 158 KTERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVD 217

Query: 240 NTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHG 299
           N  +  V+ P ++   V V P++YG I                   N G   ++FE   G
Sbjct: 218 NASMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEP--G 272

Query: 300 S---APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAG 356
           S     DI GQN ANPTA++LS+  ML H+GL   A +I  AV   IA G  + T D+ G
Sbjct: 273 SRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQG-TTVTKDIGG 331

Query: 357 SASTSSFTEAVISRL 371
           +AST+ FT+AVI+ L
Sbjct: 332 TASTTEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  204 bits (519), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 180/317 (56%), Gaps = 21/317 (6%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           ML   I +R+    LA+A   +  + K  G      G++TV+ I GDGVG E++ SVK I
Sbjct: 1   MLNRTIAKRS----LATAAQVEHILPKKYG------GRFTVTLIPGDGVGKEVTDSVKTI 50

Query: 61  FAAAKVPIVWESCPVTPL-LVNGVTTIPEQAQESINRNLVALKGPLATPIGK-GHRSMNL 118
           F A  +PI WE+  +       GV     +A ES+ RN + LKG   TP  + GH S+N+
Sbjct: 51  FEAENIPIDWETINIKQTDHKEGVN----EAVESLRRNKIGLKGLWHTPADQTGHGSLNV 106

Query: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178
            LRK   ++ANV   KS++G KT   D+DL++IRENTEGE++G+EH  VPGVV+S+K++T
Sbjct: 107 ALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMT 166

Query: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH-EFPDIQLQTEL 237
           +  +ER+ R+A+++A+   R  +  VHK+ I +L DGLF  +  E+   E+PDI + + +
Sbjct: 167 KPKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSII 226

Query: 238 IDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFE-A 296
           +DN  +  V+ P ++   V V P++YG I                   N G   ++FE  
Sbjct: 227 VDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPG 283

Query: 297 VHGSAPDIAGQNKANPT 313
                 DI GQN ANPT
Sbjct: 284 SRHVGLDIKGQNVANPT 300

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  155 bits (391), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 187/398 (46%), Gaps = 53/398 (13%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR    R T  R  +S    Q ++              T+  I GDG+G E+  + K I
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKAL--------------TIGLIPGDGIGKEVIPAGKQI 46

Query: 61  -----------FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLV-ALKGPLATP 108
                      F    +   WE+        N    +P++  E + R+   AL G + +P
Sbjct: 47  LEKVGPKFDLDFKFIDLHAGWET------FQNTGKALPDETVEVLRRDCQGALFGAVQSP 100

Query: 109 IGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVI 166
             K  G+ S  + LRK  GLFANVRP K+VEG  T    VD+V++RENTE  Y  IE   
Sbjct: 101 TTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTY 158

Query: 167 V-PG----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLF 217
             P     V ++ K I+  A+ R+   A + A    ++ G   L V HKS +   +DGLF
Sbjct: 159 TDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLF 218

Query: 218 VTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXX 273
             + K++     D    IQ   +++D+ V  +   P  + DVV V PNLYGDI       
Sbjct: 219 REICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECF-DVV-VAPNLYGDILSDGAAA 276

Query: 274 XXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHAS 333
                       N+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A 
Sbjct: 277 LVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQ 335

Query: 334 KIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            I KAV + I    + +T DL G ++T    + ++S++
Sbjct: 336 PIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  149 bits (376), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 128/403 (31%), Positives = 183/403 (45%), Gaps = 64/403 (15%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK-- 58
           M RS   R +  R LAS   ++                 T+  I GDG+G E+  + K  
Sbjct: 1   MFRSVATRLSACRGLASNAARK---------------SLTIGLIPGDGIGKEVIPAGKQV 45

Query: 59  ---------------DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKG 103
                          D++A  +     E+    P     V  + EQ Q        AL G
Sbjct: 46  LENLNSKHGLSFNFIDLYAGFQT--FQETGKALP--DETVKVLKEQCQG-------ALFG 94

Query: 104 PLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAG 161
            + +P  K  G+ S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  
Sbjct: 95  AVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIVRENTEDLYIK 152

Query: 162 IEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRL 212
           IE   +       V  + K I+  A+ R+   A + A    +  G+  L V HKS +   
Sbjct: 153 IEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQ 212

Query: 213 ADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXX 268
           +DGLF  + KE+      ++  I+   +++D+ V  +   P  +   V V PNLYGDI  
Sbjct: 213 SDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDI-L 269

Query: 269 XXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 328
                            N+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G 
Sbjct: 270 SDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGH 329

Query: 329 FEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            E A  I KAV   +  G   +T DL G AST    + V+SRL
Sbjct: 330 NEAAQDIYKAVDANLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 128/403 (31%), Positives = 182/403 (45%), Gaps = 64/403 (15%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK-- 58
           MLRS   R +  R LA+   ++                 T+  I GDG+G E+  + K  
Sbjct: 1   MLRSVATRLSTCRGLATNAARK---------------SLTIGLIPGDGIGKEVIPAGKQV 45

Query: 59  ---------------DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKG 103
                          D++A  +     E+    P     V  + EQ Q        AL G
Sbjct: 46  LENLNSKHGLSFNFIDLYAGFQT--FQETGKALP--DETVKVLKEQCQG-------ALFG 94

Query: 104 PLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAG 161
            + +P  K  G+ S  + LR+  GLFANVRP KSVEG K   + +D+V++RENTE  Y  
Sbjct: 95  AVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIK 152

Query: 162 IEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRL 212
           IE   +       V  + K I+  A+ R+   A + A    +  G   L V HKS +   
Sbjct: 153 IEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQ 212

Query: 213 ADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXX 268
           +DGLF  + KE+      ++  I+   +++D+ V  +   P  +   V V PNLYGDI  
Sbjct: 213 SDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDI-L 269

Query: 269 XXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGL 328
                            N+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G 
Sbjct: 270 SDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGH 329

Query: 329 FEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
              A  I KAV   +  G   +T DL G AST    E V+SRL
Sbjct: 330 NNAAQDIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 172/359 (47%), Gaps = 39/359 (10%)

Query: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88
           T+  I GDG+G E+  + K I           F    +   WE+        N    +P+
Sbjct: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75

Query: 89  QAQESI-NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYED 145
           +  + + N+   AL G + +P  K  G+ S  + LRK  GLFANVRP KSV+G K     
Sbjct: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RK 133

Query: 146 VDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYARAV---- 196
           VDLV++RENTE  Y  +E   +       V  + K IT  A++ +   A + A+      
Sbjct: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193

Query: 197 GRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKY 252
           G   L V HKS +   +DGLF  V +E      D    +Q   +++D+ V  +   P  +
Sbjct: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253

Query: 253 SDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANP 312
            DVV V PNLYGDI                   N+G  + I E  HGSAPDIAG+  +NP
Sbjct: 254 -DVV-VAPNLYGDILSDGAAALVGSLGVVPSA-NVGPNIVIGEPCHGSAPDIAGKGISNP 310

Query: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            A + S+ +ML  +G  E A  I KAV   I  G +  T DL G+++T    E V+S+L
Sbjct: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  148 bits (373), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 176/358 (49%), Gaps = 38/358 (10%)

Query: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88
           T+  I GDG+G E+  + + +           F+   +   W++   T   + G T   E
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATV--E 79

Query: 89  QAQESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDV 146
             +E   R   AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + V
Sbjct: 80  ALRE---RCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPV 133

Query: 147 DLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERV----IRYAYEYARAVG 197
           DLV++RENTE  Y   E   V       V ++IK I+  A+ER+    +R A +  R  G
Sbjct: 134 DLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGG 193

Query: 198 RPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYS 253
           R  L V HKS +    DGLF  V +E+       +  I+   +++D+ V  +   P  + 
Sbjct: 194 RGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF- 252

Query: 254 DVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPT 313
           DVV V PNLYGD+                   N+G+ + I E  HGSAPDIAG+  ANP 
Sbjct: 253 DVV-VAPNLYGDLLSDGAAALVGSLGLVPSV-NVGNNIIIGEPCHGSAPDIAGRGIANPI 310

Query: 314 ALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           A + S  +ML  +GL E AS I++AV   +    +  + DL G  +T    + +++R+
Sbjct: 311 ATIRSVSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  148 bits (373), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 182/396 (45%), Gaps = 50/396 (12%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           M RS   R +  R LAS   ++                 T+  I GDG+G E+  + K I
Sbjct: 1   MFRSVATRISACRGLASNAARK---------------SLTIGLIPGDGIGKEVIPAGKQI 45

Query: 61  FA--AAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALK--------GPLATPIG 110
                +K  + +        L  G  T  E  +   +  +  LK        G + +P  
Sbjct: 46  LENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTT 101

Query: 111 K--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVP 168
           K  G+ S  + LR+  GL+ANVRP KSVEG K   + +D+V++RENTE  Y  IE   + 
Sbjct: 102 KVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYID 159

Query: 169 G-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLFVT 219
                 V  +IK I+  A+ R+ + A + A    +  G   L V HKS +   +DGLF  
Sbjct: 160 KATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFRE 219

Query: 220 VAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXX 275
           + K++      ++  I+   +++D+ V  +   P  +   V V PNLYGDI         
Sbjct: 220 ICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDI-LSDGAAAL 276

Query: 276 XXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKI 335
                     N+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I
Sbjct: 277 VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDI 336

Query: 336 EKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            KAV   +  G  + T DL G AST    + V+SRL
Sbjct: 337 YKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/359 (30%), Positives = 172/359 (47%), Gaps = 39/359 (10%)

Query: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88
           T+  I GDG+G E+  + K +           F    +   W++       ++    +P+
Sbjct: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQT------FLDTGKALPD 75

Query: 89  QAQESINRNLV-ALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYED 145
           +  E +  +   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV+G  T    
Sbjct: 76  ETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRP 133

Query: 146 VDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAV 196
           VD++++RENTE  Y   E   +       V ++IK I+  A+  + + A E +    +A 
Sbjct: 134 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKAN 193

Query: 197 GRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKY 252
           G+  L V HKS +   +DGLF  V K +       +  I    +++D+ V  +   P  +
Sbjct: 194 GKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECF 253

Query: 253 SDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANP 312
              V V PNLYGDI                   N+GH   + E  HGSAPDIAG+  +NP
Sbjct: 254 D--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGHDFIVGEPCHGSAPDIAGKGISNP 310

Query: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            A + S+ +ML  MG  E A  I KAV T I    + +T DL G ++T    + ++S++
Sbjct: 311 IATIRSTALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 170/359 (47%), Gaps = 38/359 (10%)

Query: 39  YTVSFIEGDGVGPEI----SKSVKDI-------FAAAKVPIVWESCPVTPLLVNGVTTIP 87
           +T+  I GDG+G E+     K ++ I       F    +   W++       ++    +P
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT------FLDTGKALP 73

Query: 88  EQAQESINRNLV-ALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYE 144
           +   E +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV+G  T   
Sbjct: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDR 131

Query: 145 DVDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RA 195
            VDLV+ RENTE  Y   E   +       V ++IK I+  A+  +   A E A    + 
Sbjct: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191

Query: 196 VGRPKLVVVHKSTIQRLADGLFVTVAKELAH---EFPDIQLQTELIDNTVLNVVSNPSKY 252
            G   L V HKS +   +DGLF  + K +     +F ++Q   +++D+ V  +   P  +
Sbjct: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF 251

Query: 253 SDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANP 312
              V V PNLYGDI                   N+G  + I E  HGSAPDI GQ  ANP
Sbjct: 252 D--VIVAPNLYGDILSDGAAALVGSLGVVPSV-NVGPNIVIGEPCHGSAPDIVGQGIANP 308

Query: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            A + S+ ++L  +GL E A  IEK V   I    + +T DL G+++       ++SR+
Sbjct: 309 IATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVANDILSRI 366

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  147 bits (370), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 167/353 (47%), Gaps = 27/353 (7%)

Query: 40  TVSFIEGDGVGPEISKSVKDIFA------AAKVPIVWESCPVTPLLVNGVTTIPEQAQES 93
           T+  I GDG+G E+  + K +          K   +         L  G     E  Q  
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 94  INRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP KSV G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144

Query: 152 RENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLV 202
           RENTE  Y  IE   +       V ++ K I+  A+ R+   A + A    +  G+  L 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 203 VVHKSTIQRLADGLFVTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKYSDVVYV 258
           V HKS +   +DGLF  + K++     D    I    +++D+ V  +   P  +   V V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 259 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 318
            PNLYGDI                   N+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 319 SVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           + +ML  +G  + A  I +AV   +    + +T DL G+++T   TE V++RL
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  147 bits (370), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 177/360 (49%), Gaps = 41/360 (11%)

Query: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVT--PLLVNGVTTI 86
           T+  I GDG+G E+  + K +           F    +   W++   T   L    V+ +
Sbjct: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83

Query: 87  PEQAQESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYE 144
            +Q Q        AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV G  T   
Sbjct: 84  KQQCQG-------ALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDR 134

Query: 145 DVDLVLIRENTEGEYAGIEHVIVP-----GVVQSIKLITREASERVIRYAYEYA----RA 195
            VD+V++RENTE  Y   E   +       V ++ K I+  A+ ++ + A + A    + 
Sbjct: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194

Query: 196 VGRPKLVVVHKSTIQRLADGLFVTVAKELAHE----FPDIQLQTELIDNTVLNVVSNPSK 251
            G+  L V HKS +   +DGLF  V +++  +    + ++    +++D+ V  +   P  
Sbjct: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254

Query: 252 YSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKAN 311
           + DVV V PNLYGDI                   N+G  + I E  HGSAPDI+GQ  +N
Sbjct: 255 F-DVV-VAPNLYGDILSDGAAALVGSLGVVPSA-NVGPDIIIGEPCHGSAPDISGQGISN 311

Query: 312 PTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           P A + S+ +ML  +G  E A  I+ AV   I +G + +T DL G +ST+  T+ ++S+L
Sbjct: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 168/353 (47%), Gaps = 27/353 (7%)

Query: 40  TVSFIEGDGVGPEISKSVKDIFAA------AKVPIVWESCPVTPLLVNGVTTIPEQAQES 93
           T+  I GDG+G E+  + K +  +           +            G     E  Q  
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQIL 85

Query: 94  INRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151
             +   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSVEG  +    VD++++
Sbjct: 86  KEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIV 143

Query: 152 RENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLV 202
           RENTE  Y  IE   +       V ++ K I+  A++R+   A + A    +  G+  L 
Sbjct: 144 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQNNGKATLT 203

Query: 203 VVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYV 258
           V HKS +   +DGLF  V +E+      ++  I    +++D+ V  +   P  +   V V
Sbjct: 204 VTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIV 261

Query: 259 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 318
            PNLYGDI                   N+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 262 APNLYGDI-LSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 320

Query: 319 SVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           + +ML  +G  E A  I KAV   +  G   +T DL G+A+T +  + +++RL
Sbjct: 321 TALMLEFLGHNEAAQDIHKAVDANLRDGL-VKTADLGGNATTQNVVDDILARL 372

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  144 bits (364), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 181/398 (45%), Gaps = 54/398 (13%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLR  +  R   R + + + K                  T+  I GDG+G E+  S + +
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKS---------------NLTIGLIPGDGIGKEVIPSGRQV 45

Query: 61  -----------FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLV-ALKGPLATP 108
                      F    +   W++       ++    +P +  +++  N   AL G + +P
Sbjct: 46  LETIGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSP 99

Query: 109 IGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVI 166
             K  G+ S  + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y  +E   
Sbjct: 100 TTKVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTY 157

Query: 167 VPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLF 217
           +       V  + K I+  A+ R+ + A + A    +  G  +L V HKS +   +DGLF
Sbjct: 158 IDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLF 217

Query: 218 VTVAKELAHE----FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXX 273
             V KE+       + DIQ   ++ID+ V  +   P  +   V V PNLYGDI       
Sbjct: 218 REVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAA 275

Query: 274 XXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHAS 333
                       N+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A 
Sbjct: 276 LVGSLGVVPSA-NVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQ 334

Query: 334 KIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            I+ AV + +    + +T DL G  STS     VI RL
Sbjct: 335 DIQTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  144 bits (363), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 169/353 (47%), Gaps = 27/353 (7%)

Query: 40  TVSFIEGDGVGPEISKSVKDIFAA--AKVPIVWESCPVTP---LLVNGVTTIPEQAQESI 94
           T+  I GDG+G E+  + K +      K  + +E   +       ++    +P    + +
Sbjct: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82

Query: 95  -NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151
            N+   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T  + +DLV++
Sbjct: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140

Query: 152 RENTEGEYAGIEHVIV-----PGVVQSIKLITREASERVIRYAYEYA----RAVGRPKLV 202
           RENTE  Y  IE           + ++ K IT  A++R+ + A + A    +  G   L 
Sbjct: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200

Query: 203 VVHKSTIQRLADGLFVTVAKELAHE----FPDIQLQTELIDNTVLNVVSNPSKYSDVVYV 258
           V HKS +   +DGLF  V KE+       +  +    +++D+ V  +   P  +   V V
Sbjct: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258

Query: 259 CPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 318
            PNLYGDI                   N+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 259 APNLYGDILSDGAAALVGSLGLVPSA-NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317

Query: 319 SVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           +  ML ++G    A  I KAV   I    + +T DL G ++T    + ++ +L
Sbjct: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  144 bits (362), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 186/398 (46%), Gaps = 56/398 (14%)

Query: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60
           MLRS I R    R  ASA               PK+    +  I GDG+G E+  + K +
Sbjct: 1   MLRSAIGRLATRRAYASA---------------PKS--MVIGLIPGDGIGKEVIPAGKQV 43

Query: 61  -----------FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESI-NRNLVALKGPLATP 108
                      F    +   W +   T         +PEQ  + + N+   AL G + +P
Sbjct: 44  LENLSGKHGLNFDFIDLQAGWGTFQETG------KALPEQTVQVLKNQCQGALFGAVQSP 97

Query: 109 IGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVI 166
             K  G+ S  + LRK  GL+ANVRP KSVEG K     VD+V++RENTE  Y  +E   
Sbjct: 98  TTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTY 155

Query: 167 VPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLF 217
           V       V ++ K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF
Sbjct: 156 VDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLF 215

Query: 218 VTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXX 273
             + K++      ++  +    +++D+ V  +   P  + DVV V PNLYGDI       
Sbjct: 216 REICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECF-DVV-VAPNLYGDILSDGAAA 273

Query: 274 XXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHAS 333
                       N+G ++ I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A 
Sbjct: 274 LVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQ 332

Query: 334 KIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            I +AV   +    + +T DL G+++T    E ++S+L
Sbjct: 333 DIYRAVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  144 bits (362), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 114/354 (32%), Positives = 169/354 (47%), Gaps = 28/354 (7%)

Query: 40  TVSFIEGDGVGPEISKSVKDIFA------AAKVPIVWESCPVTPLLVNGVTTIPEQAQES 93
           T+  I GDG+G E+  + K +              +         L  G     E  Q  
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 94  INRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVEG  TT + VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 152 RENTEG------EYAGIEHVIVPGVVQSIKLITREASERVIRYAYEYA----RAVGRPKL 201
           RENT        E   I+      V ++ K I+  A+ R+   A + A    +  G+  L
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 202 VVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVY 257
            V HKS +   +DGLF  + K++      ++  I    +++D+ V  +   P  + DVV 
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCF-DVV- 260

Query: 258 VCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 317
           V PNLYGDI                   N+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 318 SSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           S+ +ML  +G  E A  I +AV   +    + +T DL G ++T   TE V++RL
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 117/357 (32%), Positives = 171/357 (47%), Gaps = 35/357 (9%)

Query: 40  TVSFIEGDGVGPEISKSVKDIFA--AAKVPIVWESCPVTPLLVNGVTTIPEQAQ----ES 93
           T+  I GDG+G E+  + K +     +K  + +        L  G  T  E  +    E+
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80

Query: 94  IN----RNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVD 147
           +N    +   AL G + +P  K  G+ S  + LR+  GLFANVRP KSVEG +   + +D
Sbjct: 81  VNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--KPID 138

Query: 148 LVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAVGR 198
           +V++RENTE  Y  IE   +       V  + K I+  A+ R+   A + A    +  G 
Sbjct: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGE 198

Query: 199 PKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSD 254
             L V HKS +    DGLF  + KE+      ++  I+   +++D+ V  +   P  +  
Sbjct: 199 ATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257

Query: 255 VVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTA 314
            V V PNLYGDI                   N+G ++ I E  HGSAPDIAG+  ANP A
Sbjct: 258 -VIVAPNLYGDI-LSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIA 315

Query: 315 LLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            + S+ +ML  +G    A  I KAV   +  G  + T DL G AST    + V+SRL
Sbjct: 316 TIRSTALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  141 bits (356), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 178/366 (48%), Gaps = 43/366 (11%)

Query: 34  PKTGKYTVSFIEGDGVGPEISKSVKDIFAAA-----------KVPIVWESCPVT--PLLV 80
           PK+ K  +  I GDG+G E+  + K +  A             +   WE+       L  
Sbjct: 18  PKSMK--IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPD 75

Query: 81  NGVTTIPEQAQESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEG 138
           + V  + EQ Q        AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVE 
Sbjct: 76  DTVKVLKEQCQG-------ALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE- 127

Query: 139 FKTTYEDVDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA 193
            K    +VD++++RENTE  Y   E   V       V ++IK I+  A+ ++   A + +
Sbjct: 128 -KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS 186

Query: 194 ----RAVGRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNV 245
               ++ G   L V HKS +   +DGLF  + K++      ++ +++   +++D+ V  +
Sbjct: 187 LQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRM 246

Query: 246 VSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIA 305
              P  + DVV V PNLYGDI                   N+G ++ I E  HGSAPDIA
Sbjct: 247 FREPECF-DVV-VAPNLYGDILSDGAAALVGSLGVVPSA-NVGPEIVIGEPCHGSAPDIA 303

Query: 306 GQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365
           G+  +NP A + S+ +ML  +G  E A  I KAV   +  G +  T DL G A+T    +
Sbjct: 304 GKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVD 362

Query: 366 AVISRL 371
            ++S++
Sbjct: 363 DILSKI 368

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  137 bits (344), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 167/359 (46%), Gaps = 40/359 (11%)

Query: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88
           T+  I GDG+G E+  + + +           F    +   W++   T         +P+
Sbjct: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETG------KALPD 75

Query: 89  QAQESI-NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYED 145
           +  + + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV         
Sbjct: 76  ETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LPQERP 132

Query: 146 VDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RAV 196
           VD++++RENTE  Y   E   +       V ++IK I+  A++ +   A E A    +  
Sbjct: 133 VDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVN 192

Query: 197 GRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKY 252
           G   L V HKS +   +DGLF  V +++      +F  I+   +++D+ V  +   P  +
Sbjct: 193 GEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECF 252

Query: 253 SDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANP 312
              V V PNLYGDI                   N+G    + E  HGSAPDIAG+  +NP
Sbjct: 253 D--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGFDFVVGEPCHGSAPDIAGKGISNP 309

Query: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            A + S+ +ML  MG  E A  I KAV   +      +T DL G ++T    E V+SR+
Sbjct: 310 VATIRSTALMLEFMGHPEAAQDIHKAVDANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  134 bits (337), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/363 (29%), Positives = 168/363 (46%), Gaps = 40/363 (11%)

Query: 36  TGKYTVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVT 84
           T   T+  I GDG+G E+  + K +           F    +   W++       ++   
Sbjct: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQT------FLDTGK 71

Query: 85  TIPEQAQESI-NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKT 141
            +P++  + + N    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV    +
Sbjct: 72  ALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LS 128

Query: 142 TYEDVDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA--- 193
             + +D+V++RENTE  Y   E   +       V ++IK I+  A+  +   A E A   
Sbjct: 129 QEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQR 188

Query: 194 -RAVGRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSN 248
            +  G   L V HKS +   +DGLF  + +++      +F  I    +++D+ V  +   
Sbjct: 189 QKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFRE 248

Query: 249 PSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQN 308
           P  +   V V PNLYGDI                   N+G    + E  HGSAPDIAG+ 
Sbjct: 249 PECFD--VIVAPNLYGDILSDGAAALVGSLGVVPSA-NVGFDFVVGEPCHGSAPDIAGKG 305

Query: 309 KANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVI 368
            +NP A + S+ +ML  MG  E A  I KAV   +      +T DL G ++T    + V+
Sbjct: 306 ISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNT-VKTPDLGGKSTTQQVVDDVL 364

Query: 369 SRL 371
           SR+
Sbjct: 365 SRM 367

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 179/379 (47%), Gaps = 29/379 (7%)

Query: 14  MLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFA------AAKVP 67
           ML S   K  +I   + K   K+   T+  I GDG+G E+  + K +             
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKS--LTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFN 58

Query: 68  IVWESCPVTPLLVNGVTTIPEQAQESINRNLVA-LKGPLATPIGK--GHRSMNLTLRKTF 124
            +         L  G   +P++  + +       L G + +P  +   + S  + LRK  
Sbjct: 59  FIDLEAGFQTFLDTG-KALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKEL 117

Query: 125 GLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPG----VVQSIKLITRE 180
            L+AN+RP KSV G  +  + VD+V++RENTE  Y  IE          V ++ K IT  
Sbjct: 118 QLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEV 176

Query: 181 ASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH----EFPDIQ 232
           A+ ++ + A + A    +  G+  L V HKS +   +DGLF  + K++      ++  I 
Sbjct: 177 ATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGIN 236

Query: 233 LQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXXXXXXXXXXNIGHKVS 292
              ++ID+ V  +   P +Y DV+ V PNLYGDI                   N+G  + 
Sbjct: 237 YNEQIIDSMVYRMFREP-EYFDVI-VAPNLYGDILSDGAAALVGSLGVVPSA-NVGPDIV 293

Query: 293 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTG 352
           + E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV + +    + +T 
Sbjct: 294 MGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMREN-KIKTP 352

Query: 353 DLAGSASTSSFTEAVISRL 371
           DL G++ST +  + V+ +L
Sbjct: 353 DLGGNSSTQNVVDDVLEKL 371

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 135/310 (43%), Gaps = 36/310 (11%)

Query: 84  TTIPEQAQESINRNLVALKGPLATPIGKGH----RSMNLTLRKTFGLFANVRP----AKS 135
           + +P++A  +       L G +  P  +G         L LR+  G++AN+RP    A S
Sbjct: 56  SALPDEALGAAKEADAVLLGAVGGPKWQGGAVRPEQGLLKLRQELGVYANLRPCNFAADS 115

Query: 136 VEGFK----TTYEDVDLVLIRENTEGEYAGIEHVIV-PGVVQSIKLITREASERVIRYAY 190
           +            D D++++RE   G Y G  H     GV       T +  +R+ R A 
Sbjct: 116 LLELSPLRPEIARDTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAG 175

Query: 191 EYARAVGRP-------KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVL 243
             A     P       K  V+  S + R       TV +    EFP++QLQ +LID+  +
Sbjct: 176 FLALQHDPPLPVWSLDKANVLASSRLWR------KTVEETFQSEFPNVQLQHQLIDSAAM 229

Query: 244 NVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVH 298
            +V NP  ++ VV V  N++GDI                        +      ++E  H
Sbjct: 230 ILVKNPRAFNGVV-VTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCH 288

Query: 299 GSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGS 357
           GSAPD+    KANP   +LS+ MML   + +      +E+AV   + +G   RTGDL GS
Sbjct: 289 GSAPDLPA-GKANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG--VRTGDLLGS 345

Query: 358 ASTSSFTEAV 367
           +STS   +A+
Sbjct: 346 SSTSEVGDAI 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 87/304 (28%), Positives = 137/304 (45%), Gaps = 24/304 (7%)

Query: 84  TTIPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK----- 134
           T +P++A E+  +    L G +  P  G G        L +RK  GL+AN+RP       
Sbjct: 54  TPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASDS 113

Query: 135 --SVEGFKTTY-EDVDLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAY 190
              +   K  Y +  D V++RE   G Y G  +     GV    +  +    +R+ R A 
Sbjct: 114 LLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAA 173

Query: 191 EYARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNP 249
             A     P  +  + K+ +   +     TV + +  EFP + +Q +LID+  + +V +P
Sbjct: 174 FLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSP 233

Query: 250 SKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDI 304
           +K + VV +  N++GDI                        +      ++E  HGSAPD+
Sbjct: 234 TKLNGVV-ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDL 292

Query: 305 AGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSF 363
              NK NP A +LS+ MML   + L E    +E+AV   + AG   RTGDL GS ST+  
Sbjct: 293 PA-NKVNPIATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG--VRTGDLGGSNSTTEV 349

Query: 364 TEAV 367
            +A+
Sbjct: 350 GDAI 353

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 125/270 (46%), Gaps = 20/270 (7%)

Query: 118 LTLRKTFGLFANVRP----AKSVEGFKTTYEDV----DLVLIRENTEGEYAG-IEHVIVP 168
           L +RK  GL+AN+RP    +KS+ G      ++    D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHE 227
           GV    +  T    ER+ R     A     P  L    K+ +   +     TV + +  E
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRTVNETIKRE 213

Query: 228 FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXX 282
           FP + +Q +LID+  + ++ NP K++ +V +  N++GDI                     
Sbjct: 214 FPQLSVQHQLIDSAAMIMIKNPRKFNGIV-ITSNIFGDIISDAASVIPGSLGLLPSASLA 272

Query: 283 XXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLT 341
              +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    IE AV  
Sbjct: 273 SEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQ 331

Query: 342 TIAAGPESRTGDLAGSASTSSFTEAVISRL 371
            I +G   RTGDL G+ +T+   +AV   L
Sbjct: 332 VIESG--IRTGDLGGNNTTTEVGDAVTHAL 359

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 138/306 (45%), Gaps = 25/306 (8%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAKSVE---- 137
           +P++  E+  ++   L G +  P  G G        L +RK  GL+ N+RP K +     
Sbjct: 58  LPDETLEAAKQSDAVLLGAVGGPKWGTGKVRPEQGLLKIRKELGLYGNLRPCKFISDKLI 117

Query: 138 GFKTTYEDV----DLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAYEY 192
           G     E+V    D V++RE   G Y G  +     GV    +  + E  +R+ + A  +
Sbjct: 118 GLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMAA-F 176

Query: 193 ARAVGRPKLVVVHKSTIQRLADG-LFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSK 251
                 P L +        LA   L+     E   EFP++++Q +LID+  + +V NP++
Sbjct: 177 LSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVKNPTQ 236

Query: 252 YSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIAG 306
            + ++ +  N++GDI                        +      ++E  HGSAPD+A 
Sbjct: 237 LNGII-LTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDLA- 294

Query: 307 QNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365
           + K NP A +LS+ MML   + + +    IE+AV   +  G   RT DL G+++TS   +
Sbjct: 295 RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRG--IRTADLGGNSTTSELGD 352

Query: 366 AVISRL 371
           AV   L
Sbjct: 353 AVAQEL 358

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 134/303 (44%), Gaps = 26/303 (8%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK------- 134
           +P++A E+  +    L G +  P  G G        L +RK   L+AN+RP         
Sbjct: 58  LPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 135 SVEGFKTTY-EDVDLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAYEY 192
            +   K  + +  D V++RE   G Y G  +     GV    +  T    +R+ R A  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAA-F 176

Query: 193 ARAVGRPKLVVVHKSTIQRLADGLFV--TVAKELAHEFPDIQLQTELIDNTVLNVVSNPS 250
                 P L +        LA       TV + + +EFP +++Q +LID+  + +V NP+
Sbjct: 177 MALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT 236

Query: 251 KYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIA 305
             + ++ +  N++GDI                        +      ++E  HGSAPD+ 
Sbjct: 237 HLNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 306 GQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFT 364
            +NK NP A +LS+ MML   + L E    IE AV   + AG   RTGDL GS ST+   
Sbjct: 296 -KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG--IRTGDLGGSNSTTEVG 352

Query: 365 EAV 367
           +AV
Sbjct: 353 DAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 140/302 (46%), Gaps = 24/302 (7%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRP----AKSVE 137
           +P++A E+   +   L G +  P  G G        L +RK  GL+AN+RP    ++S+ 
Sbjct: 57  LPDEALEASKNSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASESLL 116

Query: 138 GFKTTYEDV----DLVLIRENTEGEYAGI-EHVIVPGVVQSIKLITREASERVIRYAYEY 192
           G      ++    D +++RE   G Y G  +     GV    +  +    +R+ R A   
Sbjct: 117 GLSPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFL 176

Query: 193 ARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSK 251
           A     P  +  + K+ +   +     TV + + +EFP + +Q +LID+  + +V NP++
Sbjct: 177 ALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNPTQ 236

Query: 252 YSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIAG 306
            + ++ +  N++GDI                        +      ++E  HGSAPD+  
Sbjct: 237 LNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP- 294

Query: 307 QNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365
           + K NP A +LS+ MML   + L +    IE+AV   + AG   RTGDL GS ST+   +
Sbjct: 295 KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG--IRTGDLGGSNSTTEVGD 352

Query: 366 AV 367
           A+
Sbjct: 353 AI 354

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 134/302 (44%), Gaps = 24/302 (7%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK------- 134
           +P++A E+  +    L G +  P  G G        L +RK   L+AN+RP         
Sbjct: 56  LPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASDSLL 115

Query: 135 SVEGFKTTY-EDVDLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAYEY 192
            +   K  Y +  D V++RE   G Y G  +     GV    +  +    +R+ R A   
Sbjct: 116 ELSPLKAQYAQGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFL 175

Query: 193 ARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSK 251
           A     P  +  + K+ +   +     TV K +  EFP + +  +LID+  + +V NP++
Sbjct: 176 ALQHNPPLPIWSLDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPTQ 235

Query: 252 YSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIAG 306
            + ++ +  N++GDI                        +      ++E  HGSAPD+A 
Sbjct: 236 LNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA- 293

Query: 307 QNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365
           + K NP A +LS+ MML   + + E    IEKAV   +  G   RTGDL GS STS   +
Sbjct: 294 KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG--IRTGDLGGSNSTSEVGD 351

Query: 366 AV 367
           AV
Sbjct: 352 AV 353

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 152/352 (43%), Gaps = 34/352 (9%)

Query: 44  IEGDGVGPEIS-------KSVKDIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINR 96
           + GD VG EI+       K++ D+ +  K            +   GV  +P++A E+  +
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVP-LPDEALEASKK 68

Query: 97  NLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK-------SVEGFKTTY-E 144
               L G +  P  G G        L +RK   L+AN+RP          +   K  + +
Sbjct: 69  ADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAK 128

Query: 145 DVDLVLIRENTEGEYAGI-EHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRPKLVV 203
             D V++RE   G Y G  +     GV    +  T    +R+ R A  +      P L +
Sbjct: 129 GTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAA-FMALQHEPPLPI 187

Query: 204 VHKSTIQRLADGLFV--TVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPN 261
                   LA       TV + + +EFP +++Q +LID+  + +V NP+  + ++ +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTHLNGII-ITSN 246

Query: 262 LYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALL 316
           ++GDI                        +      ++E  HGSAPD+  +NK NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATI 305

Query: 317 LSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAV 367
           LS+ MML   + L E    IE AV   + AG   RTGDL GS ST+   +AV
Sbjct: 306 LSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 134/303 (44%), Gaps = 26/303 (8%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK------- 134
           +P++A E+  +    L G +  P  G G        L +RK   L+AN+RP         
Sbjct: 58  LPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 117

Query: 135 SVEGFKTTY-EDVDLVLIRENTEGEYAGI-EHVIVPGVVQSIKLITREASERVIRYAYEY 192
            +   K  + +  D V++RE   G Y G  +     GV    +  T    +R+ R A  +
Sbjct: 118 DLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAA-F 176

Query: 193 ARAVGRPKLVVVHKSTIQRLADGLFV--TVAKELAHEFPDIQLQTELIDNTVLNVVSNPS 250
                 P L +        LA       TV + + +EFP +++Q +LID+  + +V NP+
Sbjct: 177 MALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT 236

Query: 251 KYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIA 305
             + ++ +  N++GDI                        +      ++E  HGSAPD+ 
Sbjct: 237 HLNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 306 GQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFT 364
            +NK NP A +LS+ MML   + L E    IE AV   + AG   RTGDL GS ST+   
Sbjct: 296 -KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVG 352

Query: 365 EAV 367
           +AV
Sbjct: 353 DAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 123/266 (46%), Gaps = 20/266 (7%)

Query: 118 LTLRKTFGLFANVRPAK-------SVEGFKTTY-EDVDLVLIRENTEGEYAG-IEHVIVP 168
           L +RK   L+AN+RP          +   K  + +  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHE 227
           GV    +  T+   +R+ R A   A     P  +  + K+ +   +     TV + + +E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 228 FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXX 282
           FP ++L  +LID+  + +V +P++ + +V    NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQLNGIVLTS-NLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 283 XXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLT 341
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L +    +EKAV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 342 TIAAGPESRTGDLAGSASTSSFTEAV 367
            + +G   RTGDL GS STS   +A+
Sbjct: 330 VLDSG--VRTGDLGGSNSTSEVGDAI 353

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 124/266 (46%), Gaps = 20/266 (7%)

Query: 118 LTLRKTFGLFANVRP----AKSVEGFKTTYEDV----DLVLIRENTEGEYAG-IEHVIVP 168
           L +RK  GL+AN+RP    ++ + G      ++    D +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHE 227
           GV    +  +    ER+ R A   A     P  +  + K+ +   +     TV   + +E
Sbjct: 155 GVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEATIKNE 214

Query: 228 FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXX 282
           FP + +Q +LID+  + +V NP++ + ++ +  N++GDI                     
Sbjct: 215 FPTLTVQNQLIDSAAMILVKNPTQLNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLA 273

Query: 283 XXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLT 341
              +      ++E  HGSAPD+  +NK NP A +LS+ MML   + + +    +E+AV  
Sbjct: 274 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRR 332

Query: 342 TIAAGPESRTGDLAGSASTSSFTEAV 367
            + AG   RTGDL GS ST    +A+
Sbjct: 333 VLDAG--VRTGDLGGSNSTQEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 123/267 (46%), Gaps = 20/267 (7%)

Query: 118 LTLRKTFGLFANVRPAK-------SVEGFKTTY-EDVDLVLIRENTEGEYAG-IEHVIVP 168
           L +RK   L+AN+RP          +   K  Y +  D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHE 227
           GV    +  +    +R+ R A   A     P  +  + K+ +   +     TV + + +E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 228 FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXX 282
           FP + +Q +LID+  + +V +P+K + +V +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKLNGIV-ITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 283 XXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLT 341
              +      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E  + +E+AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 342 TIAAGPESRTGDLAGSASTSSFTEAVI 368
            + AG   RT DL G  STS   +AV+
Sbjct: 332 VLDAG--IRTADLRGENSTSEVGDAVV 356

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/307 (27%), Positives = 136/307 (44%), Gaps = 26/307 (8%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK------- 134
           +P+ + E+  ++   L G +  P  G G        L +RK   L+AN+RP         
Sbjct: 58  LPDASLEAAKKSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 135 SVEGFK-TTYEDVDLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAYEY 192
            +   K       D V++RE   G Y G  +     GV    +  +    +R+ R A  +
Sbjct: 118 DLSPLKPECARGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAA-F 176

Query: 193 ARAVGRPKLVVVHKSTIQRLADGLFV--TVAKELAHEFPDIQLQTELIDNTVLNVVSNPS 250
                 P L V        LA       TV + + +EFP + +Q +LID+  + +V NP+
Sbjct: 177 LALQHSPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT 236

Query: 251 KYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIA 305
           + + V+ +  N++GDI                        +      ++E  HGSAPD+ 
Sbjct: 237 QLNGVI-ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP 295

Query: 306 GQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFT 364
            + K NP A +LS+ MML   + +FE  + +E+AV   + +G   RT DL G+++TS   
Sbjct: 296 -KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG--VRTADLKGTSTTSEVG 352

Query: 365 EAVISRL 371
           EAV+  L
Sbjct: 353 EAVVKAL 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 121/266 (45%), Gaps = 20/266 (7%)

Query: 118 LTLRKTFGLFANVRPAKSVEGF--------KTTYEDVDLVLIRENTEGEYAG-IEHVIVP 168
           L +RK  G++AN+RP + V           +   +  D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGVYANLRPCQFVSETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD 153

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRPKLVV-VHKSTIQRLADGLFVTVAKELAHE 227
           GV    +  +    +R+ R A   A     P  V  + K+ +   +     TV + + +E
Sbjct: 154 GVAWDKESYSVPEIQRITRMAAFLALQHNPPLPVWSLDKANVLATSRLWRKTVEETIKNE 213

Query: 228 FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXX 282
           FP + +   LID+  + +V NP+K + VV +  N++GDI                     
Sbjct: 214 FPTLTINHHLIDSAAMTLVQNPTKLNGVV-ITTNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 283 XXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLT 341
              +    + ++E  HGSAPD+   + ANP A +LS+ MM    + L +  + IE+AV  
Sbjct: 273 SLPDKNDALGLYEPCHGSAPDLPA-DHANPIATILSAAMMCKLSLNLTKEGNAIEEAVKR 331

Query: 342 TIAAGPESRTGDLAGSASTSSFTEAV 367
           TI AG   +TGDL G  +T+    AV
Sbjct: 332 TIDAG--IKTGDLGGKNTTTEVGNAV 355

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 138/304 (45%), Gaps = 24/304 (7%)

Query: 84  TTIPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRP----AKS 135
           T +P++A ++   +   L G +  P  G G        L +RK   L+AN+RP    + S
Sbjct: 56  TPLPDEALDAAKNSDAVLLGAVGGPKWGTGDVRPEQGLLKIRKELQLYANLRPCNFVSDS 115

Query: 136 VEGFKTTYEDV----DLVLIRENTEGEYAGI-EHVIVPGVVQSIKLITREASERVIRYAY 190
           + G     E++    D  ++RE   G Y G  +     G     +  T    +R+ R A 
Sbjct: 116 LLGLSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAA 175

Query: 191 EYARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNP 249
             A     P  +  + K+ +   +     TV + + +EFP++++Q +LID+  + +V +P
Sbjct: 176 FLALQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKSP 235

Query: 250 SKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDI 304
            + + ++ +  N++GDI                        +      ++E  HGSAPD+
Sbjct: 236 RQLNGII-ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDL 294

Query: 305 AGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSF 363
             + K NP A +LS+ MML   + L +    IE+AV   + AG   RT DL GS STS  
Sbjct: 295 P-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNSTSEV 351

Query: 364 TEAV 367
            +AV
Sbjct: 352 GDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 120/267 (44%), Gaps = 22/267 (8%)

Query: 118 LTLRKTFGLFANVRPAK-------SVEGFKTTY-EDVDLVLIRENTEGEYAG-IEHVIVP 168
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFV--TVAKELAH 226
           GV    +  +    +R+ R A  +      P L V        LA       TV + + +
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAA-FLALQHNPPLPVWSLDKANVLASSRLWRKTVEETIKN 212

Query: 227 EFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXX 281
           EFP + +Q +LID+  + +V NP++ + V+ +  N++GDI                    
Sbjct: 213 EFPTLTVQHQLIDSAAMIMVKNPTQLNGVI-ITNNMFGDIISDEASVIPGSLGLLPSASL 271

Query: 282 XXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVL 340
               +      ++E  HGSAPD+  + K NP A +LS+ MML   + +FE  + +E+AV 
Sbjct: 272 ASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVR 330

Query: 341 TTIAAGPESRTGDLAGSASTSSFTEAV 367
             + +G   RTGDL GS ST    +AV
Sbjct: 331 RVLDSG--IRTGDLRGSNSTQEVGDAV 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 119/267 (44%), Gaps = 22/267 (8%)

Query: 118 LTLRKTFGLFANVRPAK-------SVEGFKTTY-EDVDLVLIRENTEGEYAGI-EHVIVP 168
           L +RK   L+AN+RP          +   K  +    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLELSPIKPQFARGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 169 GVVQSIKLITREASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFV--TVAKELAH 226
           GV    +  T    +R+ R A  +     +P L +        LA       TV + + +
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAA-FMALQHQPPLPIWSLDKANVLASSRLWRKTVEETIKN 212

Query: 227 EFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXX 281
           EFP +++Q +LID+  + +V NP++ + ++ +  N++GDI                    
Sbjct: 213 EFPTLKVQHQLIDSAAMILVKNPTQLNGII-ITSNMFGDIISDEASCIPGSLGLLPSASL 271

Query: 282 XXXXNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVL 340
               +      ++E  HGSAPD+  +NK NP A +LS+ MML   + +      IE AV 
Sbjct: 272 ASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVK 330

Query: 341 TTIAAGPESRTGDLAGSASTSSFTEAV 367
             + AG   RTGDL GS ST    +AV
Sbjct: 331 KVLDAG--IRTGDLGGSNSTIEVGDAV 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 91/355 (25%), Positives = 156/355 (43%), Gaps = 31/355 (8%)

Query: 40  TVSFIEGDGVGPEISKSVKDIFAA------AKVPIVWESCPVTPLLVNGV-TTIPEQAQE 92
           T+  + GD VG EI++    +  A       KV   ++   +    ++     +P++A E
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 93  SINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRP----AKSVEGFKTTYE 144
           +  +    L G +  P  G G        L +RK   L+AN+RP    + S+        
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 125

Query: 145 DV----DLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAYEYARAVGRP 199
           ++    D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 126 EIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNPP 185

Query: 200 -KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYV 258
             +  + K+ +   +     TV + + +EFP + +Q +LID+  + +V NP+  + ++ +
Sbjct: 186 LPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPTHLNGII-I 244

Query: 259 CPNLYGDIXXXXXXXX-----XXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAGQNKANPT 313
             N++GDI                        +      ++E  HGSAPD+  + K NP 
Sbjct: 245 TNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVNPV 303

Query: 314 ALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAV 367
           A +LS+ MML   + LFE    IE+AV   + +G   RT DL G+ ST+   +AV
Sbjct: 304 ATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG--IRTADLKGTNSTTEVGDAV 356

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 132/303 (43%), Gaps = 26/303 (8%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRP----AKSVE 137
           +P++A E+  +    L G +  P  G G        L +RK   L+AN+RP    + S+ 
Sbjct: 141 LPDEALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 200

Query: 138 GFKTTYEDV----DLVLIRENTEGEYAG-IEHVIVPGVVQSIKLITREASERVIRYAYEY 192
                  ++    D+ ++RE   G Y G  +     GV    +  +    +R+ R A  +
Sbjct: 201 DLSPLKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMA-GF 259

Query: 193 ARAVGRPKLVVVHKSTIQRLADGLFV--TVAKELAHEFPDIQLQTELIDNTVLNVVSNPS 250
                 P L V        LA       TV + + +EFP + +Q +LID+  + +V NP+
Sbjct: 260 LALQHNPPLPVWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT 319

Query: 251 KYSDVVYVCPNLYGDIXXXXXXXXXXX-----XXXXXXXXNIGHKVSIFEAVHGSAPDIA 305
             + VV +  N++GDI                        +      ++E  HGSAPD+ 
Sbjct: 320 HLNGVV-IANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP 378

Query: 306 GQNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFT 364
            + K NP A +LS  MML   + + E    +EKAV   + +G   RT DL GS STS   
Sbjct: 379 -KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG--VRTADLRGSNSTSEVG 435

Query: 365 EAV 367
           +A+
Sbjct: 436 DAI 438

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 130/302 (43%), Gaps = 24/302 (7%)

Query: 86  IPEQAQESINRNLVALKGPLATP-IGKGH---RSMNLTLRKTFGLFANVRPAK------- 134
           +P+++ E+  R    L G +  P  G G        L +RK   L+AN+RP         
Sbjct: 59  LPDESLEASKRADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 118

Query: 135 SVEGFKTTY-EDVDLVLIRENTEGEYAGI-EHVIVPGVVQSIKLITREASERVIRYAYEY 192
            +   K  Y +  D  ++RE   G Y G  +     GV    +  +    +R+ R A   
Sbjct: 119 DLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFL 178

Query: 193 ARAVGRP-KLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDNTVLNVVSNPSK 251
           A     P  +  + K+ +   +     TV + + +EFP +++  +LID+  + +V NP++
Sbjct: 179 AMQHNPPLPIWSLDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKNPTQ 238

Query: 252 YSDVVYVCPNLYGDIXXXXXX-----XXXXXXXXXXXXXNIGHKVSIFEAVHGSAPDIAG 306
            + ++ +  N++GDI                        +      ++E  HGSAPD+  
Sbjct: 239 LNGII-ITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP- 296

Query: 307 QNKANPTALLLSSVMMLN-HMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365
           + K NP   +LS  MML   + L E    +E+AV   +      RT DL GS STS   +
Sbjct: 297 KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVLDN--NIRTADLGGSNSTSDIGD 354

Query: 366 AV 367
           AV
Sbjct: 355 AV 356

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%), Gaps = 1/51 (1%)

Query: 321 MMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371
           +MLNH+GL E A++I KAV  TIA G  + T D+ GS+ST+ FT  +I++L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEIINKL 50

>Kwal_26.7784 s26 (509503..510006) [504 bp, 167 aa] {OFF} [contig
           55] FULL
          Length = 167

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 7   CRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGD-GVGPEISKSVKDIFAA 63
           CR    R   +   ++P +  +  K    +  Y+V+ ++   G GP ++KS+KD+ AA
Sbjct: 65  CRLATTR--CTTLSRRPPLAPWRDKEPTSSLSYSVTMLKASLGTGPSLAKSIKDLMAA 120

>KNAG0C01850 Chr3 complement(363995..365491) [1497 bp, 498 aa] {ON}
           Anc_1.339 YBR263W
          Length = 498

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 198 RPKLVVVHKSTIQRLAD-GLFVTVAKEL-AHEFPDIQLQTELIDNTVLNVVSNPSKYSDV 255
           RPK++V   S   RL D G    +AK   A+   D+   + L+     NVV +P K+SD+
Sbjct: 211 RPKIIVAGTSAYSRLIDYGRMANIAKNCGAYLLSDMAHISGLV---AANVVESPFKHSDI 267

Query: 256 V 256
           V
Sbjct: 268 V 268

>KLLA0C16874g Chr3 (1473776..1473800,1474263..1475578) [1341 bp, 446
           aa] {ON} highly similar to uniprot|P09733 Saccharomyces
           cerevisiae YML085C TUB1 Alpha-tubulin associates with
           beta- tubulin (Tub2p) to form tubulin dimer which
           polymerizes to form microtubules
          Length = 446

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 31  KPDPKTGKY--TVSFIEGDGVGPEISKSVKDIFAAAKVPIVWESCPV---TPLLVNGVTT 85
           K DP+TGKY  T     GD V  ++  +V  I     V +V + CP      +     T 
Sbjct: 305 KCDPRTGKYMATCLLYRGDVVTRDVQNAVAQIKTKKTVQLV-DWCPTGFKIGICYQAPTA 363

Query: 86  IPEQAQESINRNLVALKGPLA 106
            P     S+NR +  L    A
Sbjct: 364 TPNSQLSSVNRAVCMLSNTTA 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,166,076
Number of extensions: 1254523
Number of successful extensions: 3696
Number of sequences better than 10.0: 87
Number of HSP's gapped: 3494
Number of HSP's successfully gapped: 92
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)