Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A030702.533ON23923910451e-145
ZYRO0B02002g2.533ON2941084093e-48
Kpol_1018.332.533ON5891153905e-43
NCAS0A048002.533ON5111163701e-40
KNAG0C058102.533ON5541493684e-40
TBLA0G022302.533ON2161033452e-39
NDAI0K018602.533ON7301393566e-38
KAFR0A018602.533ON4901073436e-37
Smik_13.2492.533ON4731373411e-36
Skud_13.2262.533ON4751493322e-35
SAKL0A09482g2.533ON3881263273e-35
YMR070W (MOT3)2.533ON4901463305e-35
CAGL0K03003g2.533ON6471173302e-34
NCAS0F009002.533ON5251423043e-31
NDAI0H014002.533ON5411483019e-31
Suva_13.2462.533ON419692942e-30
TPHA0G035102.533ON3871332933e-30
Kwal_26.80212.533ON5071152903e-29
KLTH0D06842g2.533ON5061262893e-29
AGL071C2.533ON3961202793e-28
KLLA0E18547g2.533ON4311242779e-28
TBLA0I014802.533ON513712744e-27
Ecym_72552.533ON5441352746e-27
KAFR0J003402.533ON2181002345e-23
KNAG0A070402.533ON352982274e-21
TPHA0C041902.533ON417671951e-16
NCAS0A129102.598ON822511378e-09
Suva_13.2062.598ON709671369e-09
CAGL0F05995g2.598ON597481332e-08
ZYRO0F01012g2.598ON584571332e-08
YMR037C (MSN2)2.598ON704671323e-08
Smik_13.2072.598ON703671323e-08
KLLA0F26961g2.598ON694581314e-08
Kpol_185.32.598ON647571306e-08
Skud_13.1932.598ON704551306e-08
KNAG0H005502.598ON620571296e-08
YKL062W (MSN4)2.598ON630571297e-08
Smik_11.1862.598ON641571297e-08
SAKL0B11330g2.598ON499571297e-08
Skud_11.1672.598ON628571297e-08
Kwal_26.83512.598ON698571298e-08
KLTH0D08734g2.598ON677571289e-08
TDEL0B069102.598ON437571281e-07
Suva_11.1642.598ON639561271e-07
NCAS0H030802.598ON730571271e-07
ABR089C2.598ON571561262e-07
Ecym_23012.598ON767681252e-07
Kpol_1013.212.598ON494571243e-07
TPHA0N014602.598ON519591243e-07
NDAI0B013402.598ON769561235e-07
NDAI0C06260na 1ON582691226e-07
Kwal_26.80112.531ON190591187e-07
KAFR0A023202.598ON443491208e-07
KAFR0F020702.598ON370571191e-06
CAGL0M13189g2.598ON541571201e-06
TBLA0H028302.598ON746561201e-06
TBLA0G019202.598ON523571191e-06
Suva_13.3636.256ON211701161e-06
Skud_13.3486.256ON216561162e-06
Smik_13.3876.256ON212561162e-06
YMR182C (RGM1)6.256ON211561152e-06
NDAI0C005602.598ON972571163e-06
TPHA0C025802.598ON365571154e-06
KLLA0F20636gsingletonON285581127e-06
KNAG0M023102.598ON660561137e-06
SAKL0H24816g8.144ON410541129e-06
KNAG0G012808.144ON472481129e-06
CAGL0L06072g8.144ON300491101e-05
Kwal_47.172418.144ON403531111e-05
NCAS0C040708.144ON289601092e-05
KLTH0H08800g8.117ON168531062e-05
SAKL0F01980g3.518ON385721082e-05
TPHA0B003804.351ON1310731103e-05
Kpol_541.398.116ON291631083e-05
NCAS0B05750singletonON505511093e-05
KAFR0B025508.234ON890641083e-05
Ecym_4128na 2ON312531074e-05
NCAS0F00910singletonON350521065e-05
KLTH0E06688g8.144ON397481065e-05
KAFR0B063608.425ON627551066e-05
AGR186Cna 2ON287531049e-05
Kpol_1052.83.298ON386611031e-04
ADL051Wna 3ON173581001e-04
ZYRO0B11770g8.234ON867551041e-04
KNAG0D021208.144ON402501031e-04
TPHA0A04530singletonON501531022e-04
ZYRO0G19140g8.144ON557481022e-04
YPL230W (USV1)6.256ON391471022e-04
SAKL0G06292g5.586ON517791022e-04
TDEL0A013008.234ON837551022e-04
Kpol_1031.428.144ON359481012e-04
TPHA0C021608.425ON1375541022e-04
Suva_16.766.256ON392481012e-04
TDEL0B046708.144ON312481003e-04
Smik_6.4356.256ON386471013e-04
CAGL0K04631g4.214ON10131031013e-04
Kpol_529.138.425ON1410761013e-04
NCAS0F009202.531ON354521003e-04
CAGL0K02145g8.144ON317481003e-04
KAFR0F012106.256ON311581003e-04
TPHA0G002707.543ON472341003e-04
Skud_16.486.256ON398471003e-04
Kwal_27.114602.303ON531551003e-04
TBLA0F003708.144ON687511003e-04
Kpol_1023.1004.351ON916851003e-04
KNAG0I020702.162ON572481003e-04
NCAS0G012706.256ON27490993e-04
KNAG0M003504.351ON10761001004e-04
Ecym_8388na 3ON22356984e-04
KNAG0G018708.234ON875551004e-04
Ecym_84038.144ON57353994e-04
Ecym_27604.214ON9381021004e-04
SAKL0H17842g8.234ON81456994e-04
ACL057W8.144ON52048995e-04
Kpol_472.104.214ON83066995e-04
KLLA0C17072g8.144ON47448995e-04
NDAI0B022508.234ON115664995e-04
YER130C8.144ON44348985e-04
KLTH0G14454g8.234ON83256995e-04
Smik_4.3378.234ON89464995e-04
Suva_5.2518.144ON44948985e-04
CAGL0M00594g4.351ON102058995e-04
NCAS0B048408.234ON86463995e-04
YDR096W (GIS1)8.234ON89455996e-04
AFR531Wna 4ON27464976e-04
Smik_5.2768.144ON44248986e-04
NDAI0C048608.425ON135055996e-04
Suva_13.704.351ON77757986e-04
Kwal_56.234538.234ON82856986e-04
SAKL0H04070g4.214ON89956986e-04
Skud_4.3548.234ON91664986e-04
NCAS0B028408.425ON115250987e-04
Suva_2.2558.234ON89455987e-04
TPHA0F018102.162ON42556977e-04
Skud_5.2488.144ON44248978e-04
TBLA0E028205.586ON31265968e-04
KNAG0H030108.234ON78456978e-04
KLTH0G10802g2.303ON52655979e-04
NDAI0I009906.256ON40970969e-04
ADR308Cna 5ON27850969e-04
TPHA0A019408.234ON91263970.001
ZYRO0A09416g8.425ON134664970.001
Ecym_33412.303ON56055960.001
TPHA0D010508.144ON43948960.001
KAFR0B068104.351ON115584960.001
SAKL0H20416g8.116ON31750950.001
Skud_13.614.351ON125357960.001
Ecym_1475na 4ON34964950.001
Smik_13.584.351ON125357960.001
YML081W (TDA9)4.351ON125157960.001
Suva_16.5187.543ON42746950.001
ADL198W2.303ON54755950.001
TBLA0G032403.298ON51156950.001
TBLA0F038308.234ON96755960.001
TPHA0H018506.256ON36154950.001
KLLA0F01463g1.326ON78148950.001
NDAI0A075403.298ON37052940.001
Kwal_14.22068.117ON25452940.001
Kpol_1018.352.531ON51759950.001
Kpol_1032.528.234ON82455950.002
AEL278W7.543ON47665940.002
CAGL0M01870g3.298ON31570940.002
AGR117C8.234ON79956950.002
CAGL0L05786g8.116ON34850940.002
NDAI0B019308.144ON43648940.002
CAGL0L11880g8.234ON98055950.002
ZYRO0C13508g3.281ON18965920.002
TBLA0I020603.298ON83362940.002
NCAS0B045008.130ON120756950.002
KAFR0A008001.326ON75348940.002
SAKL0A09438g2.531ON44151940.002
TBLA0H006608.425ON131150940.002
NCAS0A152707.543ON43333940.002
CAGL0E06116g6.256ON61378940.002
ACR264W2.162ON76963940.002
Ecym_35208.234ON81956940.002
NCAS0B046008.144ON54748930.002
NDAI0H011105.586ON45441930.002
Kpol_1001.14.351ON134173940.002
KAFR0A071206.256ON31548920.003
KAFR0C003403.298ON39450930.003
SAKL0E07216g2.303ON54855930.003
ZYRO0B07568g4.214ON616103930.003
KNAG0C060305.586ON31465920.003
TDEL0F055008.425ON120750930.003
TBLA0E04210singletonON45450920.003
KAFR0C031408.117ON37050920.003
YJL056C (ZAP1)1.326ON88095920.003
NCAS0C042308.117ON33850910.003
TBLA0A089104.80ON39056920.003
NCAS0I014603.298ON33058910.003
ZYRO0G20526g1.326ON84954920.003
Kpol_1065.483.298ON36452910.004
KLLA0B03454g7.543ON47258920.004
TPHA0A039103.298ON35152910.004
KLLA0C17710g8.234ON82153920.004
Kwal_23.54007.543ON42952910.004
CAGL0J01595g8.117ON34450910.004
Kpol_1026.84.80ON41256910.004
NCAS0D039106.256ON31672910.004
AEL174W1.326ON66156920.004
KAFR0F041503.518ON41663910.004
Skud_4.4788.425ON132351920.005
Suva_2.2003.281ON23263890.005
AGL207W3.298ON27761900.005
AER159C4.351ON119168910.005
YDR043C (NRG1)3.281ON23163890.005
Smik_8.635.586ON54277910.005
NDAI0B019408.116ON33650900.005
NDAI0G007202.303ON70857910.005
KAFR0B021608.144ON45348900.005
Kwal_47.190453.518ON26650890.006
TDEL0F011708.116ON16250870.006
Skud_4.2973.281ON23163890.006
Ecym_8011na 5ON27654890.006
Kpol_1050.1097.543ON38433900.006
TBLA0B064102.531ON44952900.006
KAFR0C057105.586ON44262900.006
Ecym_28177.543ON43153900.006
AGR172W8.425ON105745900.006
Kpol_1072.582.162ON79454900.006
SAKL0H20394g8.117ON35951890.006
NCAS0I015603.281ON26649890.006
NDAI0G034208.144ON48457900.006
Kwal_47.178882.162ON78650900.007
YPR186C (PZF1)7.543ON42933890.007
SAKL0G18062g4.351ON123857900.007
KLLA0B04477g4.351ON133268900.007
SAKL0D15136gsingletonON27154890.007
NCAS0H028905.586ON53277890.007
TDEL0F026904.80ON35056890.007
Ecym_8379na 6ON30556880.008
TBLA0E042208.234ON51950890.008
SAKL0H12958g8.425ON112945900.008
Ecym_54242.162ON77553890.008
NDAI0B02080singletonON27350880.008
TPHA0K002105.586ON48165890.008
SAKL0D02618g3.298ON32163880.008
Kwal_47.166214.351ON117851890.009
Ecym_62951.326ON66360890.009
TBLA0F013001.326ON98550890.009
KLLA0B07909g4.214ON92297890.009
Kpol_1023.635.586ON55665890.009
TBLA0B060502.303ON76255890.009
KNAG0F017106.256ON41357880.009
KLTH0D18062g4.351ON112851890.009
TDEL0E015904.214ON77087890.009
KAFR0C029808.144ON22548870.009
Smik_16.4507.543ON43233880.009
KLLA0F23782g2.162ON78262890.009
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03070
         (239 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   407   e-145
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   162   3e-48
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   154   5e-43
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   147   1e-40
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   146   4e-40
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   137   2e-39
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   141   6e-38
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   136   6e-37
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   135   1e-36
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   132   2e-35
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   130   3e-35
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   131   5e-35
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   131   2e-34
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   121   3e-31
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   120   9e-31
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   117   2e-30
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   117   3e-30
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   116   3e-29
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   115   3e-29
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   112   3e-28
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   111   9e-28
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   110   4e-27
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   110   6e-27
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       95   5e-23
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    92   4e-21
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    80   1e-16
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    57   8e-09
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    57   9e-09
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    56   2e-08
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    56   2e-08
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    55   3e-08
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    55   3e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    55   4e-08
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    55   6e-08
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    55   6e-08
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    54   6e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    54   7e-08
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    54   7e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    54   7e-08
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    54   7e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    54   8e-08
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    54   9e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    54   1e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    54   1e-07
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    54   1e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    53   2e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    53   2e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    52   3e-07
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    52   3e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     52   5e-07
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             52   6e-07
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    50   7e-07
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    51   8e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    50   1e-06
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    51   1e-06
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    51   1e-06
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    50   1e-06
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    49   1e-06
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    49   2e-06
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    49   2e-06
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    49   2e-06
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     49   3e-06
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    49   4e-06
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    48   7e-06
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    48   7e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    48   9e-06
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    48   9e-06
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    47   1e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    47   1e-05
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      47   2e-05
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    45   2e-05
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    46   2e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    47   3e-05
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    46   3e-05
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    47   3e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    46   3e-05
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    46   4e-05
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               45   5e-05
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    45   5e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    45   6e-05
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    45   9e-05
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    44   1e-04
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    43   1e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    45   1e-04
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    44   1e-04
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             44   2e-04
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    44   2e-04
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    44   2e-04
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    44   2e-04
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    44   2e-04
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    44   2e-04
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    44   2e-04
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    44   2e-04
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    43   3e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    44   3e-04
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    44   3e-04
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    44   3e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     43   3e-04
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    43   3e-04
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    43   3e-04
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    43   3e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    43   3e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    43   3e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    43   3e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    43   3e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    43   3e-04
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      43   3e-04
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    43   4e-04
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    42   4e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    43   4e-04
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    43   4e-04
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    43   4e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    43   4e-04
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    43   5e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    43   5e-04
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    43   5e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    43   5e-04
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    42   5e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    43   5e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    43   5e-04
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    42   5e-04
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    43   5e-04
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     43   5e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    43   6e-04
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    42   6e-04
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    42   6e-04
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    43   6e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    42   6e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    42   6e-04
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    42   6e-04
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    42   6e-04
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    42   7e-04
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    42   7e-04
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    42   7e-04
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    42   8e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    42   8e-04
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    42   8e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    42   9e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    42   9e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    42   9e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    42   0.001
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    42   0.001
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    42   0.001
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    42   0.001
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    42   0.001
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    41   0.001
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    42   0.001
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    41   0.001
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    42   0.001
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    42   0.001
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    41   0.001
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    41   0.001
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     41   0.001
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    42   0.001
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    41   0.001
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    41   0.001
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    41   0.001
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    41   0.001
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    41   0.001
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    41   0.002
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    41   0.002
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    41   0.002
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    41   0.002
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    41   0.002
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     41   0.002
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    41   0.002
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    40   0.002
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     41   0.002
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    41   0.002
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    41   0.002
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    41   0.002
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    41   0.002
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    41   0.002
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    41   0.002
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    41   0.002
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    41   0.002
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    40   0.002
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     40   0.002
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    41   0.002
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    40   0.003
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    40   0.003
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    40   0.003
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    40   0.003
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    40   0.003
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    40   0.003
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             40   0.003
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               40   0.003
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    40   0.003
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               40   0.003
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    40   0.003
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    40   0.003
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    40   0.003
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    40   0.004
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    40   0.004
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    40   0.004
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    40   0.004
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    40   0.004
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    40   0.004
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    40   0.004
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      40   0.004
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    40   0.004
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    40   0.004
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    40   0.005
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    39   0.005
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    39   0.005
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    40   0.005
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    39   0.005
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    40   0.005
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    39   0.005
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    40   0.005
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    39   0.005
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    39   0.006
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    38   0.006
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    39   0.006
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    39   0.006
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    39   0.006
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    39   0.006
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    39   0.006
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    39   0.006
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    39   0.006
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    39   0.006
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    39   0.006
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      39   0.006
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    39   0.006
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    39   0.007
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    39   0.007
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    39   0.007
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    39   0.007
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    39   0.007
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    39   0.007
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    39   0.007
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    39   0.008
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    39   0.008
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    39   0.008
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    39   0.008
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.008
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    39   0.008
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    39   0.008
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    39   0.009
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    39   0.009
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    39   0.009
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    39   0.009
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    39   0.009
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    39   0.009
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    39   0.009
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    39   0.009
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    39   0.009
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    38   0.009
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    39   0.009
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    39   0.009
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    39   0.009
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    39   0.009
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    39   0.009
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    39   0.010
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    39   0.010
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    39   0.010
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    39   0.010
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    39   0.010
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    39   0.010
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    39   0.010
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    38   0.010
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    39   0.010
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    39   0.010
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       36   0.011
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    38   0.011
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    39   0.011
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    39   0.011
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    39   0.011
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    38   0.011
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    39   0.011
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    39   0.011
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    39   0.012
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    39   0.012
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    39   0.012
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    39   0.012
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    38   0.012
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    39   0.012
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    38   0.013
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    38   0.013
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                38   0.014
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    38   0.014
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    38   0.014
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    39   0.014
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    38   0.014
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    38   0.014
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    38   0.015
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     38   0.015
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    38   0.015
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    38   0.015
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    38   0.015
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    38   0.016
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    38   0.016
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    38   0.016
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               38   0.016
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    38   0.016
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    37   0.017
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    38   0.017
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    38   0.017
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    38   0.018
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    38   0.018
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    37   0.019
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    38   0.019
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    36   0.019
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    38   0.019
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    38   0.019
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    38   0.020
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    37   0.020
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    36   0.020
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    37   0.020
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    38   0.021
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    38   0.021
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    38   0.021
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    38   0.022
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    37   0.022
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    37   0.022
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    38   0.023
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    37   0.023
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    37   0.023
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    38   0.025
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    37   0.025
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    37   0.025
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    37   0.025
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    37   0.026
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    37   0.027
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    37   0.028
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      37   0.028
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    37   0.028
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    37   0.028
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    37   0.029
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    37   0.029
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               37   0.029
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    37   0.029
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    37   0.031
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    37   0.031
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      37   0.032
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    37   0.032
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    37   0.032
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    37   0.033
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    37   0.034
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    37   0.034
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    37   0.034
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    37   0.035
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    37   0.035
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    37   0.036
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    37   0.036
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    37   0.036
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    37   0.036
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    37   0.037
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    37   0.038
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    37   0.038
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    37   0.039
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    37   0.039
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    37   0.040
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    36   0.041
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    37   0.043
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    37   0.043
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    37   0.043
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    37   0.044
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    36   0.044
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    37   0.045
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     37   0.046
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    37   0.050
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    37   0.050
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    36   0.051
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    36   0.051
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    37   0.051
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    36   0.053
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    36   0.053
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    36   0.053
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    37   0.053
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    36   0.055
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    37   0.055
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    35   0.058
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    36   0.058
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    36   0.059
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    36   0.060
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    36   0.061
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    35   0.062
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    36   0.063
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    36   0.063
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    36   0.066
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    36   0.070
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               36   0.070
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                35   0.071
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    36   0.072
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    35   0.074
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    35   0.076
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    36   0.076
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    36   0.079
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    35   0.083
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    36   0.087
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    35   0.087
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    36   0.089
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    35   0.090
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    36   0.094
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    35   0.095
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    35   0.095
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.096
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    35   0.097
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    36   0.10 
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    36   0.10 
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    35   0.10 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    35   0.10 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    35   0.10 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    35   0.11 
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    35   0.11 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    35   0.12 
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    35   0.12 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    35   0.12 
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    35   0.12 
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    35   0.12 
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    35   0.13 
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    35   0.13 
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    35   0.13 
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    35   0.13 
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    35   0.13 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    35   0.13 
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    35   0.13 
Suva_13.247 Chr13 (391743..391805) [63 bp, 21 aa] {OFF} YMR070W ...    31   0.14 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    35   0.14 
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    35   0.15 
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    35   0.15 
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    35   0.15 
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    35   0.15 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    35   0.15 
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    35   0.15 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    34   0.16 
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    35   0.16 
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    35   0.16 
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    35   0.16 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    35   0.17 
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    34   0.17 
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    35   0.17 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    34   0.17 
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    35   0.17 
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    35   0.17 
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    35   0.18 
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    35   0.18 
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    35   0.18 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    35   0.19 
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    35   0.19 
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    35   0.19 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    35   0.19 
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    35   0.19 
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    35   0.19 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    35   0.20 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    35   0.20 
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    34   0.20 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    34   0.21 
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    35   0.21 
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    35   0.21 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    34   0.22 
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    34   0.23 
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    34   0.23 
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    35   0.23 
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    34   0.23 
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    34   0.24 
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    34   0.24 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    34   0.24 
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    34   0.25 
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    34   0.25 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    34   0.25 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    34   0.25 
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    33   0.26 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    34   0.26 
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    34   0.27 
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    33   0.27 
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    34   0.27 
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    34   0.27 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    34   0.28 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    34   0.28 
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    34   0.29 
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    34   0.30 
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    33   0.31 
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    34   0.31 
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    34   0.31 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    33   0.31 
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    34   0.31 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    34   0.31 
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    34   0.32 
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    34   0.35 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    34   0.36 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    34   0.36 
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    34   0.36 
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                33   0.37 
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    34   0.37 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                33   0.39 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    33   0.41 
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    33   0.43 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    33   0.43 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    33   0.49 
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    33   0.50 
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    33   0.51 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    33   0.52 
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    33   0.52 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    33   0.52 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    33   0.54 
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    32   0.59 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    33   0.63 
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    33   0.66 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    33   0.67 
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    33   0.68 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      33   0.71 
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    33   0.72 
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    33   0.73 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    32   0.75 
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    32   0.77 
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    33   0.77 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    32   0.78 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    33   0.78 
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    32   0.81 
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    32   0.81 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    33   0.82 
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     33   0.82 
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    33   0.83 
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    33   0.86 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    32   0.86 
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    33   0.88 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    32   0.91 
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    32   0.95 
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 32   1.1  
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    32   1.1  
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    32   1.1  
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    32   1.1  
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    32   1.1  
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    32   1.1  
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    32   1.1  
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    32   1.1  
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    32   1.1  
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    32   1.2  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    32   1.3  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    32   1.4  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    32   1.4  
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    32   1.5  
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    31   1.5  
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    32   1.5  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    32   1.7  
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    32   1.8  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    32   1.9  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    31   2.0  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    32   2.0  
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    31   2.1  
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    31   2.5  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    31   2.6  
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    31   2.8  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    31   2.9  
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    30   3.1  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    31   3.2  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    31   3.2  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    31   3.3  
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    30   3.6  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    30   3.8  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    30   3.9  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    30   4.2  
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    30   4.3  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    30   4.3  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    30   4.4  
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    30   4.4  
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    30   4.5  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    30   4.7  
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    30   4.7  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    30   4.7  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    29   5.6  
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     30   5.7  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    30   5.8  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    30   6.0  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  30   6.0  
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    30   6.7  
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      30   7.1  
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    30   7.1  
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    30   7.2  
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    30   8.1  
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    30   8.3  
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    29   8.5  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    30   8.8  
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    30   9.3  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    29   9.5  

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 209/239 (87%)

Query: 1   MNNWPHQQGRRSGEQDERSQRPMPLNLPPRYSYTQYPHAFPVVNATVPQQYLYVPGSVPP 60
           MNNWPHQQGRRSGEQDERSQRPMPLNLPPRYSYTQYPHAFPVVNATVPQQYLYVPGSVPP
Sbjct: 1   MNNWPHQQGRRSGEQDERSQRPMPLNLPPRYSYTQYPHAFPVVNATVPQQYLYVPGSVPP 60

Query: 61  PPQAQLQFPIXXXXXXXXXXXXXXXXXXRMRLKLEQPPMPMPMSIPGQRXXXXXXXXXXX 120
           PPQAQLQFPI                  RMRLKLEQPPMPMPMSIPGQR           
Sbjct: 61  PPQAQLQFPIYPYYPQPAAGGGAAAPPPRMRLKLEQPPMPMPMSIPGQRAVAVASLSSNS 120

Query: 121 XDDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQH 180
            DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQH
Sbjct: 121 ADDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQH 180

Query: 181 MKLKHTDYVLQELRLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHNNNQ 239
           MKLKHTDYVLQELRLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHNNNQ
Sbjct: 181 MKLKHTDYVLQELRLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHNNNQ 239

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  162 bits (409), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 3/108 (2%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVL 190
           G  H C +C+KSFKRKSWL+RHLLSHSP RHF CPWCLSKHKRKDNLLQHMKLKHT+YVL
Sbjct: 189 GLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVL 248

Query: 191 QELRLNNVYVSTEGSCKN-NIRTLLYEGRLNKDEVKKVLNSLIDRHNN 237
           ++LR  NV +  +G  +N NIRTLL EGRLNK++VKKVLN LID +N 
Sbjct: 249 EKLRNQNVGI--DGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSYNG 294

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  154 bits (390), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (76%), Gaps = 8/115 (6%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV 189
           + + H CH+C K FKRKSWLQRHLLSHS  R+F CPWCLSKHKRKDNLLQHMKLKH + V
Sbjct: 473 KNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENV 532

Query: 190 LQELRLN--------NVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHN 236
           L++LR+N        N   + EG+  +NIRTL+ EG LNKDEVKK+LNSL+ +HN
Sbjct: 533 LEQLRINLKANNPNDNSEPTLEGNGDHNIRTLMGEGILNKDEVKKLLNSLVAQHN 587

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  147 bits (370), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 90/116 (77%), Gaps = 9/116 (7%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           V++CH+C KSF+R SWL+RHLL+HS  RH+SCP C+SKHKRKDNLLQH+KLKHT +VL++
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 193 LRLNNVYVST--------EGSCKN-NIRTLLYEGRLNKDEVKKVLNSLIDRHNNNQ 239
           LR +N+ + T        +G+  N NI+TLL EGRLNK++VKKVLN LID  N  Q
Sbjct: 446 LRQDNIDIKTAKDEGEEDQGTASNTNIKTLLVEGRLNKEDVKKVLNRLIDSANQEQ 501

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  146 bits (368), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 93/149 (62%), Gaps = 16/149 (10%)

Query: 104 SIPGQRXXXXXXXXXXXXDDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFS 163
           +IP ++             + +      ++HKCHLC KSFKR+SWL+RHLLSHS  RH+ 
Sbjct: 406 TIPSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYL 465

Query: 164 CPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNVYV----------------STEGSCK 207
           CPWCLS+HKRKDNLLQHMKLKH++Y+L EL+  NV                  +  G   
Sbjct: 466 CPWCLSRHKRKDNLLQHMKLKHSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPD 525

Query: 208 NNIRTLLYEGRLNKDEVKKVLNSLIDRHN 236
           ++I+ LLY G LNKD+VK+VLN +I+R N
Sbjct: 526 SSIKKLLYRGILNKDDVKRVLNKIIERSN 554

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  137 bits (345), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (78%), Gaps = 3/103 (2%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           HKC  C K FKRKSWL+RH+LSHS  R +SCPWC+S+HKRKDNLLQHMKLKHTD VL++L
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 194 RLNNVYVSTEGS---CKNNIRTLLYEGRLNKDEVKKVLNSLID 233
           ++       +G     ++NIRT+LYEG L+KDEVKKVLN L++
Sbjct: 173 KMTCYLEGDDGEEMMNRDNIRTMLYEGLLDKDEVKKVLNELLE 215

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  141 bits (356), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 90/139 (64%), Gaps = 34/139 (24%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           V +C  C KSFKR SWL+RHLL+HSP RH+SCPWCLSKHKRKDNLLQH+KLKHT+ VLQ+
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 193 LRLNNVYVST----------------------------EGSCKN------NIRTLLYEGR 218
           LRL N+ +ST                            +   KN      NI+TLLY+GR
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGR 678

Query: 219 LNKDEVKKVLNSLIDRHNN 237
           LNK++VKKVLN L+D  N+
Sbjct: 679 LNKEDVKKVLNKLLDGTNS 697

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  136 bits (343), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 81/107 (75%), Gaps = 7/107 (6%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           +H CHLC KSF+RKSWL+RHLLSHS  R F CPWCLS+HKRKDNLLQHMKLKH++Y++ E
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411

Query: 193 LRLNN-VYVSTEGSCK------NNIRTLLYEGRLNKDEVKKVLNSLI 232
           L+ NN V+    G  +      ++IR L+  G +NKD+VKKV+N LI
Sbjct: 412 LKKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  135 bits (341), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 87/137 (63%), Gaps = 32/137 (23%)

Query: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           Y+H+C  C KSFKRKSWL+RHLLSHS  RHF CPWCLS+ KRKDNLLQHMKLKHT+Y+L 
Sbjct: 336 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD 395

Query: 192 ELRLNNVYVS-------------------------------TEGSCKN-NIRTLLYEGRL 219
           EL+ NN+  +                                +G+  + NI+TL+ +G L
Sbjct: 396 ELKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVL 455

Query: 220 NKDEVKKVLNSLIDRHN 236
           NKD+VK+VLN+LI  HN
Sbjct: 456 NKDDVKRVLNNLIVSHN 472

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  132 bits (332), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 87/149 (58%), Gaps = 44/149 (29%)

Query: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           Y+H+C  C KSFKRKSWL+RHLLSHS  RHF CPWCLS+ KRKDNLLQHMKLKHT+Y+L 
Sbjct: 326 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD 385

Query: 192 ELRLNNVYV-------------------------------------------STEGSCKN 208
           EL+ NN+                                             + +GS  +
Sbjct: 386 ELKKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYD 445

Query: 209 -NIRTLLYEGRLNKDEVKKVLNSLIDRHN 236
            NI+TL+ +G LNKD+VK+VLN+LI  HN
Sbjct: 446 PNIKTLINDGVLNKDDVKRVLNNLIVSHN 474

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  130 bits (327), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 84/126 (66%), Gaps = 25/126 (19%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           H+CHLC+KSFKRKSWL+RHLLSHS  + F+CPWC S+HKRKDNLLQHMKLKHT  VLQEL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 194 RLNNVY-----------VSTEG--------------SCKNNIRTLLYEGRLNKDEVKKVL 228
           +   V+            ST G              S   +I+T++ +G LNKD+VK+VL
Sbjct: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377

Query: 229 NSLIDR 234
           N LI+R
Sbjct: 378 NMLINR 383

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  131 bits (330), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 86/146 (58%), Gaps = 41/146 (28%)

Query: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           Y+H+C  C KSFKRKSWL+RHLLSHS  RHF CPWCLS+ KRKDNLLQHMKLKHT+Y+L 
Sbjct: 344 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD 403

Query: 192 ELRLNNVYV----------------------------------------STEGSC-KNNI 210
           EL+ NN+                                          + +G+    NI
Sbjct: 404 ELKKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNI 463

Query: 211 RTLLYEGRLNKDEVKKVLNSLIDRHN 236
           +TL+ +G LNKD+VK+VLN+LI  HN
Sbjct: 464 KTLINDGVLNKDDVKRVLNNLIVSHN 489

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 84/117 (71%), Gaps = 11/117 (9%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVL 190
            + H+CHLC K FKRKSWL+RHLLSHS  RHF CPWC S+HKR+DNLLQHMKLKH   +L
Sbjct: 531 AFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLL 590

Query: 191 QELRLNNVYVS----------TEGSCKN-NIRTLLYEGRLNKDEVKKVLNSLIDRHN 236
           QE+   N+  +           +G+ +  + +TL++EG LNKDE+K +LN++ID+HN
Sbjct: 591 QEINSRNMRFNWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDELKNILNTVIDKHN 647

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  121 bits (304), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 84/142 (59%), Gaps = 32/142 (22%)

Query: 128 EAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           +++  V+ CH+C+K+FKR+SWL+RHLLSHS  RH+ CPWCLS+HKR+DNLLQHMKLKH+ 
Sbjct: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441

Query: 188 YVLQELRLNNVYVSTEG--------------------------------SCKNNIRTLLY 215
            ++ EL+  NV                                      + +  IRTL+ 
Sbjct: 442 NLINELKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVT 501

Query: 216 EGRLNKDEVKKVLNSLIDRHNN 237
            G +NK++VK+VLN L+D + N
Sbjct: 502 NGVVNKEDVKRVLNQLVDENEN 523

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  120 bits (301), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 84/148 (56%), Gaps = 40/148 (27%)

Query: 128 EAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           E+Q Y  +C +C K FKR+SWL+RHLLSHS  RH+ CPWCLS+HKR+DNLLQHMKLKH +
Sbjct: 396 ESQSY--RCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453

Query: 188 YVLQELRLNNVYVS---------------------------TEGSCKNNIRT-------- 212
            ++ EL+L N   S                             G+  N + T        
Sbjct: 454 NLINELKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGIT 513

Query: 213 ---LLYEGRLNKDEVKKVLNSLIDRHNN 237
              L+ EG +NK++VK++LN LID +NN
Sbjct: 514 IKDLISEGLINKEDVKRLLNILIDEYNN 541

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 59/69 (85%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV 189
           Q Y+H+C  C KSFKRKSWL+RHLLSHS  RHF CPWCLS+ KRKDNLLQHMKLKHT+Y+
Sbjct: 323 QKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 382

Query: 190 LQELRLNNV 198
           L EL+ NN+
Sbjct: 383 LDELKKNNI 391

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  117 bits (293), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 79/133 (59%), Gaps = 30/133 (22%)

Query: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           Y+ +C++C K FKRKSWL+RHLLSHS  R +SCPWCLSKHKRKDNLLQHMKLKH   VLQ
Sbjct: 252 YIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQ 311

Query: 192 E--------LRLNN-------------------VYVSTEGSCKNN---IRTLLYEGRLNK 221
           E        L LN+                   +     GS  N+   I  ++  G L K
Sbjct: 312 EMDKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGTLKK 371

Query: 222 DEVKKVLNSLIDR 234
           + VKKVLNS+I+R
Sbjct: 372 ENVKKVLNSIIER 384

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  116 bits (290), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 79/115 (68%), Gaps = 10/115 (8%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
            ++C +C+KSFKR+SW +RHLLSHS  + +SCPWC S+HKR+DNL QHMK KH  +V+QE
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447

Query: 193 -LRLNNV---------YVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHNN 237
            L + +V           S E + + +I+TL+ +G++ K+ VK VLN++I R N 
Sbjct: 448 LLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNG 502

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  115 bits (289), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 10/126 (7%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           ++   +   +++C +C KSFKRKSW QRHLLSHS  + ++CPWC S+HKR+DNL QHMK 
Sbjct: 378 DDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437

Query: 184 KHTDYVLQEL---------RLNNVYVSTEGSCKN-NIRTLLYEGRLNKDEVKKVLNSLID 233
           KH   VLQEL            NV ++ +      +IRTL+ +GR+ K+ VK VLN++I 
Sbjct: 438 KHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIA 497

Query: 234 RHNNNQ 239
           R ++ +
Sbjct: 498 RVHDGE 503

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  112 bits (279), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 77/120 (64%), Gaps = 19/120 (15%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           +HKCH C K+FKRKSWL+RHLLSHS  + +SCPWC S+HKRKDNL QH+KLKH + +L+ 
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 193 LR---------LNNVYVSTEGSCKN----------NIRTLLYEGRLNKDEVKKVLNSLID 233
           L          +N ++ S   +             +I+ ++  G L+K+EVKK LNSLI+
Sbjct: 244 LSSNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNEVKKTLNSLIN 303

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  111 bits (277), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 71/124 (57%), Gaps = 22/124 (17%)

Query: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           + ++CHLC K F+RKSWL+RHLLSHS  + F CPWC S HKRKDNLLQH+KLKHT Y+L 
Sbjct: 304 HSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363

Query: 192 ELRLNNVYVSTEGSCKN----------------------NIRTLLYEGRLNKDEVKKVLN 229
           E  L  + ++      N                       IR +L    L KD+VK+ LN
Sbjct: 364 EFTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLN 423

Query: 230 SLID 233
            ++D
Sbjct: 424 YIVD 427

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  110 bits (274), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV 189
           Q  + +CHLC KSFKRKSWL+RHLLSHS  R+FSCP CLSKHKRKDNL+QH+KLKH DY+
Sbjct: 336 QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYI 395

Query: 190 LQELRLNNVYV 200
           L++L  +++ +
Sbjct: 396 LKKLNKDDLII 406

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 188 YVLQELRLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHN 236
           Y   ELRL NV  +T       ++ L+ + ++NKDE+K+V+N +I   N
Sbjct: 469 YDYNELRLENVKKNTVT-----VKKLINDAKVNKDELKRVINYIISEAN 512

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  110 bits (274), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 77/135 (57%), Gaps = 34/135 (25%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           +HKCH C K+FKRKSWL+RHLLSHS  + +SCPWC S+HKRKDNL QH+KLKH + +L+ 
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 193 LRLN---------------NVYVSTEGSCKN-------------------NIRTLLYEGR 218
           L  N               N  V+   +  +                   +I+ ++  G 
Sbjct: 345 LSSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGM 404

Query: 219 LNKDEVKKVLNSLID 233
           L+K+EVKK LNSLI+
Sbjct: 405 LSKNEVKKTLNSLIN 419

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 94.7 bits (234), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 72/100 (72%), Gaps = 3/100 (3%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           V++C++CNK F+R++WL+RH LSH+  R+F CPWC SKHKR+DNL +H+KLKH + +++ 
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177

Query: 193 LRLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLI 232
           +R    Y  T+   K ++  L+  G L+++++K+V   LI
Sbjct: 178 IR--EYYPLTDFEDK-DLNELMRSGYLHREDIKRVFLHLI 214

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 92.0 bits (227), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 69/98 (70%), Gaps = 3/98 (3%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C  C KSF+R +WL+RH ++H+ +  F C WC S+HKR+DN+ +HMKLKH + +++ +R 
Sbjct: 252 CPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKVIR- 310

Query: 196 NNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLID 233
            N Y   E   K +++ LL +GRL+K++VK+VL  +++
Sbjct: 311 -NYYPLAEFEGK-DLKGLLADGRLHKEDVKRVLVDIVN 346

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%)

Query: 126 QREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           +R  +   ++C +C+K+FKR SWL+RH  SHS  ++FSC WC  K+KRKDNL+QH++ KH
Sbjct: 316 KRAKKIKFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

Query: 186 TDYVLQE 192
            D   +E
Sbjct: 376 RDKTNKE 382

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
             KC  C K+F+R   L+RH+ S HS  R F+CP C  K  R DNL QH+K
Sbjct: 764 TFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           E  +E +     CH+C+KSFKR   L+RH+ S HS  R F+C  C  K  R DNL QH+K
Sbjct: 642 ESAKELEEKPFHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

Query: 183 L--KHTD 187
              KH D
Sbjct: 702 THKKHGD 708

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           CHLC+K+FKR   L+RH+ S HS  R FSC  C  K  R DNL QH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C+K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 528 KCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           E  +E +     CH+C KSFKR   L+RH+ S HS  R F+C  C  K  R DNL QH+K
Sbjct: 637 ESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

Query: 183 L--KHTD 187
              KH D
Sbjct: 697 THKKHGD 703

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           E  +E +     CH+C KSFKR   L+RH+ S HS  R F+C  C  K  R DNL QH+K
Sbjct: 636 ESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

Query: 183 L--KHTD 187
              KH D
Sbjct: 696 THKKHGD 702

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDYV 189
           KC  CNK+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D  
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKKHGDIT 679

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 591 KCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTD 187
           CH+C KSFKR   L+RH+ S HS  R F+C  C  K  R DNL QH+K   KH D
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGD 703

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+FKR   L+RH+ S HS  R F+C  C  K  R DNL QH+K   KH D+
Sbjct: 564 KCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 585 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D+
Sbjct: 443 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 572 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D+
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 698

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D+
Sbjct: 621 KCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           C  C+K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F+C +C  K  R DNL QH+K   KH D+
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTD 187
           KC  C K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGD 560

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (55%), Gaps = 8/68 (11%)

Query: 123 DEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHM 181
           DEE++       KC  C K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+
Sbjct: 692 DEEEKP-----FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHL 746

Query: 182 KL--KHTD 187
           K   KH D
Sbjct: 747 KTHRKHGD 754

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D+
Sbjct: 438 KCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
             KC+ C K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   KH D+
Sbjct: 461 TFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTD 187
           +C  C KSF+R   L+RH+ S HS  R F+C  C  K  R DNL QH+K   KH D
Sbjct: 713 QCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLKTHKKHGD 768

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 122 DDEEQREAQGYVHK-----CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRK 174
           DD+   E  G V +     CH+C KS  R S LQ H+L H+  R F C W  C  +   K
Sbjct: 474 DDDVGEEKSGRVRRRKSRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVK 533

Query: 175 DNLLQHMKL 183
            N+ +H KL
Sbjct: 534 SNMNRHYKL 542

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 129 AQGYVH---KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           AQ  VH   +C LC K F R S LQ HLL+H+ +R F CP+  C      K N+++H+K
Sbjct: 120 AQPAVHPKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           KC  C K+F+R   L+RH+ S HS  R F+C  C  K  R DNL QH+K
Sbjct: 387 KCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K FKR   L+RH  S HS  R F C  C  K  R DNL QH+K   KH D+
Sbjct: 314 KCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           +C  C+K+F+R   L+RH+ S HS  R F C +C  K  R DNL QH+K   +H D+
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLKTHKRHGDF 541

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTD 187
           KC  C K+F+R   L+RH+ S HS  R FSC  CL K  R DNL QH+K   KH D
Sbjct: 690 KCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLKTHKKHGD 745

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH+ S HS  R F C +C  +  R DNL QH+K   KH D+
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 32/70 (45%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNV 198
           CN SF R   L RH+  H+  + F C  CL    R DNL QH    H+D  L  LR    
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDIDLVSLRRLQQ 86

Query: 199 YVSTEGSCKN 208
             S   S +N
Sbjct: 87  LASNTASEQN 96

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 28/56 (50%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           CN SF R   L RH+  H+  + F C  CL    R DNL QH    H+D  L  LR
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLR 82

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 28/56 (50%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           CN SF R   L RH+  H+  + F C  CL    R DNL QH    H+D  L  LR
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLR 82

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 28/56 (50%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           CN SF R   L RH+  H+  + F C  CL    R DNL QH    H+D  L  LR
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLR 82

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC  C K+F+R   L+RH  S HS  R F C +C  +  R DNL QH+K   KH D+
Sbjct: 916 KCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKHGDF 972

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 135 KCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           KC+ C K FKR   L+RH+ S HS  R + C +C     R DNL QH+K   +H D+
Sbjct: 309 KCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLKTHKRHGDF 365

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 128 EAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           +A G    C  C K F R S L+ H+L HS  + F C W  C  K   K NL++H+KL
Sbjct: 226 KANGKADICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKL--KHTDY 188
           C  C K+FKR   L+RH+ S HS  R + C  C  K  R DNL QH+K   +H D+
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLKTHKRHGDF 660

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDY 188
           C  C++ FKR+  L+RH+ S H   + + C  C  K  R DNL QH+K    DY
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKTHGGDY 409

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C + FKR+  L+RH+LS H   + F CP C     R DNL QH+K
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQH 180
           + KC +C + FKR+  L+RH+ S H   R +SC  CL    R DNL QH
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           C  C++ FKR+  L+RH+ S H   + F C  C  K  R DNL QH+K  HTD
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK-THTD 399

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           CHLC K FKR   L+RH  + H   R F C  C  +  R DNL QH+++     +++ +R
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEPIR 284

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKL 183
           +H+CH+C K+F R S L  H L H+  + F C  P C  +   K NL++H K+
Sbjct: 110 LHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKI 162

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           +KC LCNK F R    +RH+ +H+  +  +C  P C+ +  R D L +H+++ HT+   +
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI-HTNTSKR 83

Query: 192 ELRLNNVYVSTE 203
           + R     +S+E
Sbjct: 84  KTRKRRADISSE 95

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C +C + F R+  L+RH +SH+  + F C +C     RKD +L+H    H   + ++  +
Sbjct: 36  CSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPSLISKKEAI 95

Query: 196 NNVYVSTEGSCKN 208
           N+     EG+  N
Sbjct: 96  NDTVSENEGTVNN 108

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQ 179
           + EE ++      +CH+C K   R + L+ HLL H+    F CPW  C      K N+L+
Sbjct: 137 NSEESKKMTLLRKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLR 196

Query: 180 HMK 182
           H+K
Sbjct: 197 HLK 199

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           +C LC K   R S LQ H+L H+  R FSC W  C      K N+ +H+KL
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQH 180
           ++E      G V+ C +C + F     L RH  S HS  + FSCP C  + KR+D++LQH
Sbjct: 769 EEEVVVSKNGKVYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQH 828

Query: 181 MKLK 184
           +  K
Sbjct: 829 LNKK 832

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 132 YVHK-CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           +V K C LC KSF R+S LQ HLL H+  + F C +C  +   K NL +H ++
Sbjct: 168 FVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI 220

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +H C +C KS  R + L+ H+L H+ +R F C W  C +    K N+ +H K
Sbjct: 284 LHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F C  C  K  R DNL QH+K
Sbjct: 342 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVL 190
           C +C K+F R+  L RHL SH+  + F C  C     R+D L++H    H+D  +
Sbjct: 51  CFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLHSDTAI 105

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 132 YVHK-CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           +V K C LC KSF R+S LQ HLL H+  + F C +C  +   K NL +H ++
Sbjct: 164 FVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHERI 216

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQ----HMKLKHTDYV 189
           C +C K FKR S L  H+  H+  + F+CP+  C      K N+L+    H KL   +Y+
Sbjct: 307 CSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFKLSSGNYI 366

Query: 190 L 190
           L
Sbjct: 367 L 367

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 7/58 (12%)

Query: 133 VHK-----CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           VHK     C +C KSF RK+ LQ H+L H+ A+ + CP+  C      K NL +H ++
Sbjct: 110 VHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERI 167

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G V+ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH+  K
Sbjct: 785 GKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           + C  C + FKR+  L+RH+ S H  A+ ++C  C  K  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           +H+C +CN+   R   L  H+L H+  + F C W  C      K NL +HMK+
Sbjct: 425 IHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI 477

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F C  C  K  R DNL QH+K
Sbjct: 505 CEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           C  SF R   L RH+  H+  + F CP CL    R DNL QH +  H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 16/79 (20%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSK----------- 170
           DDEEQR    YV  CH C+  F+ + +L RH+  H+  + + CP+  SK           
Sbjct: 154 DDEEQRGK--YV--CHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTG 209

Query: 171 -HKRKDNLLQHMKLKHTDY 188
              R+D    H+K +H  Y
Sbjct: 210 GFSRRDTYKTHLKSRHFIY 228

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G V+ C  C + F     L RH  S HS  + +SCP C  K KR+D++LQH+  K
Sbjct: 753 GKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + FSC  C  K  R DNL QH+K
Sbjct: 305 CEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (63%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHS 157
           CH+C K F R   L +H+ +HS
Sbjct: 334 CHICEKKFSRSDNLNQHIKTHS 355

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQH-MKLKHTDY 188
           C +C ++F R+  L RH  SH+  + + C  C  K  R+D LL+H  K+ + DY
Sbjct: 46  CSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIHNGDY 99

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           C  SF R   L RH+  H+  + F CP CL    R DNL QH +  H 
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 99

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F+C  C  K  R DNL QH+K
Sbjct: 260 CEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHS 157
           CH+C+K F R   L +H+ +HS
Sbjct: 289 CHICDKKFSRSDNLNQHIKTHS 310

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           C  SF R   L RH+  H+  + F CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 13/103 (12%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           H C  CNK+F R     RH  SH+  + F C  C     R+D L +H++  H   +L++ 
Sbjct: 12  HFCSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRTVHRILLLRD- 70

Query: 194 RLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRHN 236
                   T    + N +    +   N + V K++NS+I  +N
Sbjct: 71  --------TGAPSQENEK----DATFNVNNVDKLINSMIIVNN 101

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHM-KLKHTDYVLQELR 194
           C +C ++F R+  L RH  SH+  + + C  C  K  R+D LL+H  K+   +Y      
Sbjct: 120 CSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRHAHKIHGGNYGDSITI 179

Query: 195 LNNVYVSTEGSCKNNI 210
            +N  VSTE +  N++
Sbjct: 180 TSNGTVSTEKNTPNSL 195

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +HKC +C+K   R + L+ HLL H+  + + C W  C +    K N+ +H K
Sbjct: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + + C  C  K  R DNL QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHS 157
           ++CH+CNK F R   L +H+ +HS
Sbjct: 293 YECHICNKKFSRSDNLNQHIKTHS 316

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLN 196
           C+ +F R   L RH+  H+  + F C  C     R DNL QH +  H +  + E+  N
Sbjct: 26  CHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFIDEMSNN 83

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC 167
           H C +C   F RKS L+RHL+SHS  + F C +C
Sbjct: 108 HSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFC 141

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 139 CNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHM 181
           CNKSF R S L  H  S H   ++ SC  C SK  RK +L +H+
Sbjct: 84  CNKSFARPSTLTEHQQSIHLGIKNHSCDVCGSKFSRKSHLERHL 127

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           C  SF R   L RH+  H+  + F CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           V+ C LC+K F R   L+ HL +H+  R FSC  C     R     QH + +H D
Sbjct: 412 VYACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFAR-----QHDRKRHED 461

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           +  C  CN+ FKR+  L+RH  S H   + F C  C  K  R DNL QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHS 157
           CH+CNK F R   L +H+ +HS
Sbjct: 665 CHICNKKFSRSDNLAQHIKTHS 686

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 41/85 (48%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C  C++ F R+  L+RH  +H+  + F C +C     R+D +++H    H D +      
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLHFDILNSSSSS 102

Query: 196 NNVYVSTEGSCKNNIRTLLYEGRLN 220
           +N   +T GS  N I    Y  ++N
Sbjct: 103 SNNSTATVGSATNTIDPDEYIIKMN 127

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHM 181
           +KC  C K F +   L+ H+  H+  + FSC +C  +  RK NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           H+C++C+K F + + L+ HL SH   + + C WC     +  NL  H++L HT
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL-HT 439

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCP--WCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           C  C+K F RK  L  HL++H   R F C    C+    +  N+  H    H +  L EL
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQN-TLTEL 504

Query: 194 --RLNNV 198
             RL N+
Sbjct: 505 TRRLANL 511

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNV 198
           C+ +F R   L RH+  H+  + F C  CL +  R DNL QH +  H   V    +  NV
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHATVVNAASK--NV 84

Query: 199 YVSTEGSCKNNIRTLLYEGRLNKDEVKKVL 228
            +  +G  +   + +     LN +  KKV+
Sbjct: 85  PLVAKGRVEKPKKII-----LNNENFKKVI 109

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 20/100 (20%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C +C ++F R+  L+RH  SH+  + F C +C     R+D +L+H    H+  +  EL  
Sbjct: 54  CSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTELHH 113

Query: 196 NNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLIDRH 235
            NV                    LN D +K    +L DRH
Sbjct: 114 ENV-----------------NALLNDDNIK---TTLTDRH 133

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           +G    CH+C KSF RK+ LQ H+L H+  + + C +  C      K NL +H ++
Sbjct: 155 KGVGKTCHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERI 210

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G V+ C  C + F     L RH  S HS  + +SCP C  + KR+D++LQH+  K
Sbjct: 757 GKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           C  C + FKR+  L+RH+ S H   + + C  C  K  R DNL QH+K  HT+
Sbjct: 516 CEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK-THTN 567

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 14/102 (13%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           + C  C ++F R     RH  SH+  + FSC  C     R+D L +H++  H   +L EL
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSMLL-EL 66

Query: 194 RLNNVYVSTEGSCKNNIRTLLYEGRLNKD--EVKKVLNSLID 233
           +L  V +  EG           EG L  +  ++++VLNS I+
Sbjct: 67  QLKQVKLG-EGR----------EGVLQGESQQIERVLNSFIN 97

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           +G V+ C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 714 KGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C + FKR+  L+RH+ S H   + + C  C  K  R DNL QH+K
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%)

Query: 127 REAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           + +  + H C  CN++F R     RH  SH+  + + C  CL +  R+D L +H++  H 
Sbjct: 2   KSSTNWKHICSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHK 61

Query: 187 DYVLQE 192
             +L +
Sbjct: 62  SLLLSK 67

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + + C  C  K  R DNL QH+K
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHS 157
           + CHLC K F R   L +HL +H+
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHT 470

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 122  DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQH 180
            +DE      G ++ C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH
Sbjct: 986  EDEIIMSENGKIYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 1045

Query: 181  MKLK 184
            +  K
Sbjct: 1046 LNKK 1049

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F+C  C     R DNL QH+K
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSP 158
           CH+CNK+F R   L +H+ +H+ 
Sbjct: 420 CHICNKNFSRSDNLNQHVKTHAS 442

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           +G V+ C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 735 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQH 180
           ++E      G ++ C  CN+ F     L RH  S HS  +  SCP C  + KR+D++LQH
Sbjct: 816 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 875

Query: 181 MKLK 184
           +  K
Sbjct: 876 LNKK 879

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F+C  C     R DNL QH+K
Sbjct: 397 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (72%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHS 157
           CH+CNK+F R   L +H+ +H+
Sbjct: 426 CHICNKNFSRSDNLNQHVKTHT 447

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           C +C++ F R+  L+RH  SH+  + F C  C     RKD +L+H++  H DY  ++L
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQL 86

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 123 DEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHM 181
           DE      G V+ C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+
Sbjct: 754 DEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 813

Query: 182 KLK 184
             K
Sbjct: 814 NKK 816

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G ++ C  CN+ F     L RH  S HS  +  SCP C  + KR+D++LQH+  K
Sbjct: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW------CLS--KHKRKDNLLQHMKLK 184
           V++C  C  +FK + +L RHL  H P + F CP+      C S  +  RKD    H+K  
Sbjct: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214

Query: 185 HTDY 188
           H  Y
Sbjct: 215 HFVY 218

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F+C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSP 158
           CH+CNK+F R   L +H+ +H+ 
Sbjct: 419 CHICNKNFSRSDNLNQHVKTHAS 441

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVL 190
           C +C ++F R+  L RH  SH+  + ++C  C  K  R+D L++H +  H   V+
Sbjct: 118 CEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVV 172

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           CH+C + F R+  L+RH  +H+  + F C +C     R+D +L+H    H+  V +E
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           +G V+ C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 731 KGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           C  C K+F R     RH  SH+  + F+C  C     R+D L +H++  H  ++LQ
Sbjct: 10  CSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQ 65

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQH 180
           ++E      G ++ C  CN+ F     L RH  S HS  +  SCP C  + KR+D++LQH
Sbjct: 838 ENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQH 897

Query: 181 MKLK 184
           +  K
Sbjct: 898 LNKK 901

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           C +C+++F R+  L RH  SH+  + + C  C  K  R+D LL+H +  H
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G ++ C  CN+ F     L RH  S HS  +  SCP C  + KR+D++LQH+  K
Sbjct: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 127 REAQGYV-HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHM 181
           R   GY  HKC  CN  F +   L+ H   H+  + F C  C  K  RK NL  H+
Sbjct: 271 RSHIGYKPHKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEICNKKFSRKGNLASHI 326

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKLKHTDYVLQE 192
           +C +CNK F RK  L  H+ +H+  R   C +  C    K+    L +MK  H  +  + 
Sbjct: 308 ECEICNKKFSRKGNLASHIATHNRLRLHICKFDHC----KKSFTQLGNMKAHHNKFHRET 363

Query: 193 L-RLNNVY--VSTEGSCKNNIRTLL 214
           + RL+N+   +S E S  ++ + +L
Sbjct: 364 MARLSNILLNISAEDSLSDDDKYML 388

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F+C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 10/21 (47%), Positives = 15/21 (71%)

Query: 136 CHLCNKSFKRKSWLQRHLLSH 156
           CH+CNK+F R   L +H+ +H
Sbjct: 419 CHICNKNFSRSDNLNQHVKTH 439

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSK------------HKRKDNLLQHMKL 183
           CH C+ SF+  S+L RH+  H+  + F CP+   K              RKD    H+K 
Sbjct: 15  CHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHLKC 74

Query: 184 KHTDY 188
           +H  Y
Sbjct: 75  RHFIY 79

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           QG  + C  C ++F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 721 QGKTYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKK 776

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           V+ C LC+K F R   L+ HL +H+  R F+C  C     R     QH + +H D
Sbjct: 407 VYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFAR-----QHDRKRHED 456

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNV 198
           C+  F R+  L RH+  H+  + F C  CL    R DNL QH +  H +     L +N  
Sbjct: 23  CSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVHLEGA-TPLNINKA 81

Query: 199 YVSTEGSCKN 208
             +T   C N
Sbjct: 82  LTTTPTLCLN 91

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKL 183
           C +C +  +R S L+ H+L+H+  R FSC  P C      + N+L+H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 42.0 bits (97), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 123 DEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHM 181
           DE      G V+ C  C + F     L RH  S HS  +  SCP C  + KR+D++LQH+
Sbjct: 766 DEIVISENGKVYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 825

Query: 182 KLK 184
             K
Sbjct: 826 NKK 828

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHM-KLKHTDYVLQELR 194
           C +C ++F R+  L RH  SH+  + + C  C  K  R+D LL+H  K+   +Y    ++
Sbjct: 88  CQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNYGDTIIK 147

Query: 195 LNNV 198
            NNV
Sbjct: 148 QNNV 151

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           ++ C LCNK F R   L+ HL +H+  R F+C  C     R     QH + +H D
Sbjct: 437 IYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNMCGKAFAR-----QHDRKRHED 486

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSC--------PW-CLSKHKRKDNLLQHMK 182
           C++C K+F R+   +RH   HS  + + C         W C  K  R D L +H K
Sbjct: 468 CNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFK 523

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C + FKR+  L+RH+ S H   + ++C  C  K  R DNL QH+K
Sbjct: 388 CDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 16/24 (66%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHS 157
           + CH+C+K F R   L +H+ +H+
Sbjct: 415 YACHICDKKFSRSDNLSQHIKTHT 438

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 41.6 bits (96), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT--------D 187
           C +C + F R+  L+RH  +H+  + F C +C     R+D +L+H    H+        D
Sbjct: 56  CSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLISKSNND 115

Query: 188 YVLQELRLNNVYVSTEGSCKNNIR 211
              ++L  NN  +   G+  + IR
Sbjct: 116 NTFEKLMENNKNLDLNGAMPSTIR 139

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L H+ A  F CPW  C      K N+L+H K
Sbjct: 259 QCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           CH+C + F R+  L+RH  +H+  + F C +C     R+D +L+H    H+  V +E
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW----C----LSKHKRKDNLLQHMKLK 184
           ++KC  C  SFK + +L RHL  H P + F CP+    C      +  RKD    H+K  
Sbjct: 233 IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSI 292

Query: 185 HTDY 188
           H  Y
Sbjct: 293 HFVY 296

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           CH+C + F R+  L+RH  +H+  + F C +C     R+D +L+H    H+  V +E
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           CH+C + F R+  L+RH  +H+  + F C +C     R+D +L+H    H+  V +E
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKE 119

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 6/46 (13%)

Query: 128 EAQGYVH------KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC 167
           E Q  VH      +C  C KSF +KS L+RHL SHS  + F C +C
Sbjct: 68  EHQSTVHQGLRAFRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSYC 113

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPA---RHFSCPWCL-SKHKRKDNLLQHMKLKHTD 187
           KC +CNK    ++ LQ H++ H  +   +++ C  C  +   RK +LL H ++ HTD
Sbjct: 223 KCPICNKPCVGENGLQMHMIIHDESLVTKNWKCHICSNTSFLRKHDLLTHYQMTHTD 279

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           ++ C+LC+K F R   L+ HL +H+  R FSC  C     R     QH + +H D
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFAR-----QHDRKRHED 474

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           + + + C +C+K F+R S L+ H+  H+  + + CP+  C      K N+L+H KL
Sbjct: 411 KNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKL 466

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G ++ C  C + F     L RH  S HS  +  SCP C  + KR+D++LQH+  K
Sbjct: 856 GKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {ON}
           Anc_6.256 YPL230W
          Length = 361

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT-DYVLQ 191
           CN  F R   L RH   H+  + F C  CL    R DNL QH++  H  D V+Q
Sbjct: 42  CNMVFTRSENLTRHRRKHTGEKPFKCHVCLKFFSRIDNLKQHIESVHGKDMVIQ 95

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMK 182
           KCHLC KS+   S L+ H+ +H+  +  SCP C  +     NL +H++
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKHIR 768

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           CNK F +K  L RHL  HS  + F C  C      +D L QH+++
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRV 713

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           + C  CNK FKR S L  H+  H+  + + CP+  C      K N+L+H KL
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKL 183
           H+C +C K+F R S L  H L H+  + ++C  P C  +   K NL++H K+
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI 245

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 127 REAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           +E +   ++C +C KS  R S L  H+  H+ AR + C W  C      K NL +H KL
Sbjct: 451 KEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G V+ C  C + F     L RH  S HS  +  SCP C  + KR+D++LQH+  K
Sbjct: 684 GKVYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 123 DEEQREAQGY-VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHM 181
           + +Q   QG   ++C  C + F +KS L+RHL SHS  + FSC  C      +  L +H 
Sbjct: 138 EHQQTAHQGIRAYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRH- 196

Query: 182 KLKHT 186
           ++ HT
Sbjct: 197 EITHT 201

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 124 EEQREAQGYVHK--------CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKR 173
           +E+  AQ  ++K        C +C K FKR S L  H+  H+  + + CP+  C      
Sbjct: 155 DEKFSAQAEINKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNA 214

Query: 174 KDNLLQHMKL 183
           K N+L+H KL
Sbjct: 215 KSNMLRHYKL 224

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           +G  + C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L H+    F CPW  C      K N+L+H+K
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C + FKR+  L+RH+ S H   + ++C  C     R DNL QH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           G ++ C  C + F     L RH  S HS  +  SCP C  + KR+D++LQH+  K
Sbjct: 899 GKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKLKHTDYVLQ 191
           H C +C K F     L RH   H+  ++  CP+  C  K  R DN +QH +     +V +
Sbjct: 110 HVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRA----HVKR 165

Query: 192 ELRLN 196
           ELR++
Sbjct: 166 ELRVS 170

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHM 181
           EE+ E +   +KC  C K F+R S L+ HL  H+  + F CP   C      + N+L+H 
Sbjct: 704 EEKLENKLTKNKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHY 763

Query: 182 KL 183
           KL
Sbjct: 764 KL 765

>NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8.130
          Length = 1207

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 30/56 (53%), Gaps = 9/56 (16%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPW--------CLSKHKRKDNLLQHMKLKHT 186
           CNKSF R+  L RH L+H P   F CP+        C     RKD L++H K +HT
Sbjct: 49  CNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQK-RHT 103

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMK 182
           KCHLC+KSF   + L+ H+ +H+  +   C  C  +     NL +HMK
Sbjct: 669 KCHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMK 716

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 137 HLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           H CNK F ++  + RHL  HS  + + C  C       + L QH ++
Sbjct: 615 HGCNKEFSQRQKIVRHLKVHSGFKPYKCEVCSKCFSSDETLKQHSRV 661

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           +C  C K F R S LQ H L H+  R F C W  C      K N+++H +L
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 40.8 bits (94), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           C  C ++F R+  L RH  SH+  + F C  C     R+D L++H +  H
Sbjct: 154 CDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa]
           {ON} Anc_7.543
          Length = 433

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC 167
           KC  C+K F RK+ L+RHL+SHS ++ F C  C
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCLHC 121

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 139 CNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           C K+F R S L  H L+ H   + F C  C  +  RK +L +H+ + H+D
Sbjct: 64  CTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL-ISHSD 112

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 4/78 (5%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT-DYVLQELRLNN 197
           C  SF R   L RH+  H+  + F C  CL    R DNL QH    H  D V    + + 
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAKDNVKNNSQHHQ 92

Query: 198 VYVSTEGSCKNNIRTLLY 215
           ++V+  G+  +NI TL Y
Sbjct: 93  IHVN--GAKSSNI-TLKY 107

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           +C  C K F +   L+ H+  H+  R + C  C  +  RK NL  HM L H +Y   + +
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENYKPFQCK 574

Query: 195 LNN 197
           L++
Sbjct: 575 LDD 577

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           HKC  C+K F + + L+ H+ SH   + F C +C  +  +  NL  H++L HT
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HT 538

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           ++C  C K F RK  L  H+L+H   + F C   L    +    L +MK     + LQ L
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCK--LDDCNKSFTQLGNMKAHQNRFHLQTL 600

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           +G  + C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 748 KGKAYICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C + FKR+  L+RH+ S H   + ++C  C     R DNL QH+K
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSH 156
           + CH+CNK+F R   L +H+ +H
Sbjct: 524 YACHICNKNFSRSDNLTQHIKTH 546

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 126 QREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW 166
           +R +Q + + CH CN  F+ K +L RHL  H+  + ++CP+
Sbjct: 92  KRGSQIHQYVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPF 132

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C +C + F R   L+RH +SH+  + F C +C     RKD +L+H    H   V Q+   
Sbjct: 38  CSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPALVSQKDSK 97

Query: 196 NNVYVSTEGSCKN 208
           ++   +  GS  N
Sbjct: 98  DSNSNTNSGSATN 110

>KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {ON}
           Anc_6.256 YPL230W
          Length = 315

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           CN +F R   L RH+  H+  + F C  CL    R DNL QH    H+
Sbjct: 34  CNMAFTRAEHLVRHIRKHTGEKPFQCYICLKFFSRVDNLKQHRDTVHS 81

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           C +C+K FKR S L  H+  H+  + + CP+  C      K N+L+H KL
Sbjct: 280 CKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           ++ C LC+K F R   L+ HL +H+  R F+C  C     R     QH + +H D
Sbjct: 423 IYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFAR-----QHDRKRHED 472

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 4/103 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           + C  C+K+F R     RH  SH+  + F C  C     R+D L +H++  H + +L + 
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELLLMKK 67

Query: 194 RL----NNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLI 232
            +    N   +  E    + I+    EG   + E  ++L+ LI
Sbjct: 68  GMEEGGNKSDLIVELLVNSMIKVTKREGSGLRGEKAEILSRLI 110

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW----------C--LSKHKRKDNLLQHMKL 183
           CH C+  F+ + +L RH+  H+  + F CP+          C       R+D    H+K+
Sbjct: 63  CHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHLKV 122

Query: 184 KHTDY 188
           KH  Y
Sbjct: 123 KHVLY 127

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           C +C ++F R+  L RH  SH+  + +SC  C     R+D LL+H    H
Sbjct: 61  CQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVH 110

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           C+ C +SF     L RH  + H   + FSCP C  + KR+D++LQH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L H+    F CPW  C      K N+L+H K
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK 348

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 16/95 (16%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           +KCH+CNK F   S L+ H+ +H+  +   C  C  +     NL +H+K     Y     
Sbjct: 796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKKY----- 850

Query: 194 RLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVL 228
                       C +  ++    G+LN  +VK  L
Sbjct: 851 -----------KCSDCSKSFDDLGKLNSQKVKCAL 874

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 137 HLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLN 196
           H C+++F ++  L RHL  HS  + + C  C      ++ L+QH +  H+     +  + 
Sbjct: 743 HDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHIC 801

Query: 197 NVYVSTEGSCKNNIRTLLYE 216
           N   +   S K +IRT   E
Sbjct: 802 NKKFAISSSLKIHIRTHTGE 821

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L H+    F CPW  C      K N+L+H+K
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKLKHTD 187
           H C +CN++F R     RH+ +H+  +  SC  P C  K  R D L +H ++ HT+
Sbjct: 72  HVCPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRI-HTN 126

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 128 EAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           E  GY   C +C K F+R S L+ H    S  R + CP+  C      K N+L+H KL
Sbjct: 235 EKLGYF--CDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDY 188
           KCHLC KSF   S L+ H+ +H+  +   C  C  +     NL +H+K     Y
Sbjct: 764 KCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKICGKRFNESSNLNKHLKTHRKKY 817

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 3/79 (3%)

Query: 136 CHL--CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           CH   C + F ++  + RHL  HS  + F C  CL     +D L QHM+  H+     + 
Sbjct: 707 CHWKGCCRKFTQRQKMVRHLKVHSGYKPFKCQVCLKSFSSEDTLNQHMR-THSGEKPFKC 765

Query: 194 RLNNVYVSTEGSCKNNIRT 212
            L     S   S K +IRT
Sbjct: 766 HLCGKSFSVSSSLKIHIRT 784

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMK 182
           KC +C KSF  +  L +H+ +HS  + F C  C        +L  H++
Sbjct: 736 KCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHLCGKSFSVSSSLKIHIR 783

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           + C +C K FKR S L  H   H+  + +SCP   C      K N+L+H KL
Sbjct: 276 YSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKL 327

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC----LSKHKRKDNLLQHMKLKHTDY 188
           KC  C K F +KS L RH+ SH+  + F+C  C     ++ + K + + H K  H  Y
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSICGKGVTTRQQLKRHEITHTKSFHCSY 195

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 139 CNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           CNKSF R S L  H L+ H   + F C  C  +  +K +L +HM   HTD
Sbjct: 113 CNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM-FSHTD 161

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCP--WCLSKHKRKDNLLQHMKL 183
           + C++C K FKR S L  H+  H+  + + CP   C      K N+L+H KL
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           V+ C  C + F     L RH  S HS  +  SCP C  K KR+D++LQH+  K
Sbjct: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           +C +C + F RK+ L+RH+ SHS  + F C +C      K  L +H ++ HT
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRH-EITHT 132

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H+L H+    F C W  C      K NLL+H+K
Sbjct: 285 QCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKLKHTD 187
           H C +CN++F R     RH+ +H+  +   C  P C+ K  R D L +H ++ HT+
Sbjct: 39  HVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHRRI-HTN 93

>NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256
          Length = 316

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYV 189
           QGY   CH+   +F R+  L RH+  H+  + F C  C     R DNL QH    H    
Sbjct: 18  QGY-KDCHM---TFTREEHLARHIRKHTGEKPFQCYICFRFFSRMDNLKQHRDTVHG--- 70

Query: 190 LQELRLNNVYVS 201
               + NN +VS
Sbjct: 71  ----KSNNRFVS 78

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           CH C K F   S L+ H+ +H+  +  SC  C  +     NL +HMK+    Y+ +
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHERKYMCK 629

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           KC +C++ F R     RH+++H+  +   C  P C+ K  R D L +H K  HT    ++
Sbjct: 19  KCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAKT-HTSSTRRK 77

Query: 193 LRL 195
           +++
Sbjct: 78  VKV 80

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 40.0 bits (92), Expect = 0.005,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           C +C ++F R+  L+RH  SH+  + + C  C     R+D L++H +  H+
Sbjct: 106 CEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQ 179
           D+E+  + + Y+  C +C + F     L RH   H+  ++  CP+  C  +  R DN LQ
Sbjct: 165 DEEDLEQRRKYI--CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQ 222

Query: 180 HMK 182
           H +
Sbjct: 223 HYR 225

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 125 EQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           + +  Q YV  C  C K F R S L+ H   H+  R F+CP+  C      + N+L+H K
Sbjct: 176 QNKAPQRYV--CTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHK 233

Query: 183 L 183
           L
Sbjct: 234 L 234

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C +C + F R+  L+RH  SH+  + F C +C     R+D +L+H +  H   + Q+  L
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDKDL 141

Query: 196 NNVYVSTE 203
               V+ +
Sbjct: 142 RESAVTKD 149

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQ 179
           D+E+  + + Y+  C +C + F     L RH   H+  ++  CP+  C  +  R DN LQ
Sbjct: 164 DEEDLEQRRKYI--CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQ 221

Query: 180 HMK 182
           H +
Sbjct: 222 HYR 224

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 14/77 (18%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW------------CLSKH 171
           +E  EA  Y+  CH C+  F+ + +L RH+  H+  + + CP+                 
Sbjct: 196 DESSEALSYI--CHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGF 253

Query: 172 KRKDNLLQHMKLKHTDY 188
            R+D    H+K +H  Y
Sbjct: 254 SRRDTYKTHLKSRHFTY 270

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L HS    F C W  C      K N+L+H K
Sbjct: 256 QCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFK 305

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           GY+  C LCNK+F R   L+ HL +H+  + F C  C     R     QH + +H D
Sbjct: 579 GYI--CELCNKTFTRPYNLKSHLRTHTNEKPFICKICNKAFAR-----QHDRKRHED 628

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSC--------PW-CLSKHKRKDNLLQHMKLK 184
           C +CNK+F R+   +RH   H+  + + C         W C  K  R D L +H K +
Sbjct: 610 CKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTWGCGKKFARSDALGRHFKTE 667

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ FKR+  L+RH+ S H   + F C  C     R DNL QH+K
Sbjct: 400 CEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHS 157
           CH+C+K F R   L +H+ +HS
Sbjct: 429 CHICDKHFSRSDNLNQHIKTHS 450

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMK 182
           KC +C K F R    +RH+ +H+  +  SC  P C+ +  R D L +H++
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L H+    F C W  C      K N+L+H+K
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 122 DDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQ 179
           D+E+  + + Y+  C +C + F     L RH   H+  ++  CP+  C  +  R DN LQ
Sbjct: 164 DEEDLEQRRKYI--CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQ 221

Query: 180 HMK 182
           H +
Sbjct: 222 HYR 224

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKLKHTD 187
           C +C +  +R S L+ H+L+H+  R F C  P C      + N+L+H +L   D
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERLHGRD 268

>Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]
           {ON} complement(246366..247520) [1155 nt, 385 aa]
          Length = 384

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC 167
           KC  C+ +F +KS L+RHL SHS  + F+C  C
Sbjct: 74  KCDQCDSAFSKKSHLERHLFSHSSEKPFTCAVC 106

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL 183
           H+C +C K   R S LQ H+  H+  R F C W  C      K NL +H KL
Sbjct: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 12/62 (19%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW----------CLSK--HKRKDNLLQHMKL 183
           CH C+  FK + +L RH+  H+  + F CP+          C S     R+D    H+K 
Sbjct: 124 CHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTFKIHLKS 183

Query: 184 KH 185
           +H
Sbjct: 184 RH 185

>Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {ON}
           similar to Ashbya gossypii AEL278W
          Length = 431

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           +KC  C+++F +KS L+RH  SHS  + FSC  C      +  L +H ++ HT
Sbjct: 81  YKCTECDRAFVKKSHLERHFFSHSDKKPFSCSKCGKGVTTRQQLARH-EITHT 132

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQH 180
           CH C ++F R+  L RH  SH+  + + C  C  +  R+D LL+H
Sbjct: 51  CHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRH 95

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNL----LQHMKLK 184
           +C  C K F +   L+ H   H+  R +SC  C  K  RK NL    L H KLK
Sbjct: 537 QCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLK 590

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           H+C  C++ F + + L+ H+ SH   + F C +C  +  +  NL  H +L HT
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL-HT 559

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKLKHTDYVLQ 191
           + C LC K F RK  L  H L+H   + + C    C     +  N+  H    H + +++
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNTLME 623

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           ++CH+C K   R S L+ H+L H+  + + C W  C      K N+++H K
Sbjct: 285 NQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYK 335

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQH 180
           H C +C+  F     L RH   H+  ++ SCP+  C  K  R DN LQH
Sbjct: 210 HVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191
           C +C++ F+R+  ++RH+ + H   R ++C  C     R DNL QH++    +Y ++
Sbjct: 415 CTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNYEVK 471

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           H+C  C+K F + + L+ H+ SH   + F C +C  +  +  NL  H++L
Sbjct: 503 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 552

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           +C  C K F +   L+ H+  H+  + + C  C  +  RK NL  H +L H
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH 581

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           ++C  C + F RK  L  H L+H   + F C   L    +    L +MK     + LQ L
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCK--LDGCNKSFTQLGNMKAHQNRFHLQTL 616

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC 167
           +C  C KSF +KS L+RHL +HS  + F C +C
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYC 113

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 139 CNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           C+K+F R S L  H LS H   R F C  C     +K +L +H+   H+D
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL-YTHSD 104

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192
           C +C + F R+  L+RH  SH+  + F C +C     R+D +L+H +  H   + Q+
Sbjct: 75  CPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQD 131

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C +C + F R+  L+RH  SH+  + F C +C     R+D +L+H +  H   + Q+   
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDKDA 144

Query: 196 NNVYVSTE 203
           + V  S +
Sbjct: 145 DIVSASKD 152

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 131 GYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
            Y + C  C K FKR S L+ H++ H     F C W  C  K   K NLL+H +
Sbjct: 213 SYTYCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYR 266

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 12/77 (15%)

Query: 124 EEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW----CLSKHK------- 172
           EE  E       CH C+  F+ + +L RH+  H+  + + CP+     LS+ +       
Sbjct: 173 EEDEETDDGPFICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGF 232

Query: 173 -RKDNLLQHMKLKHTDY 188
            R+D    H+K +H  Y
Sbjct: 233 SRRDTYKTHLKARHFVY 249

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSC--PWCLSKHKRKDNLLQHMKLKHTD 187
           H C +C ++F+R     RHL +H+  +  +C  P C  +  R D L +H ++ HT+
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI-HTN 83

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKLKHTDYV 189
           C +C K FKR S L+ H++ H+  + + C    C  +   K N+L+HM+ KH + V
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR-KHKEVV 305

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLK 184
           C  C +SF     L RH  + H   + FSCP C  + KR+D++LQH+  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQH 180
           C +C ++F R+  L RH  SH+  + + C  C  +  R+D LL+H
Sbjct: 61  CKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRH 105

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           H+C  C+K F + + L+ H+ SH   + F C +C  +  +  NL  H++L HT
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HT 542

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           +C  C K F +   L+ H+  H+  R + C  C  +  RK NL  HM L H ++   + +
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENHKPFQCK 578

Query: 195 LNN 197
           L++
Sbjct: 579 LDD 581

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           ++C  C K F RK  L  H+L+H   + F C   L    +    L +MK     + LQ L
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQCK--LDDCNKSFTQLGNMKAHQNRFHLQTL 604

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMK 182
           +C +C K   R S L+ H L H+    F C W  C      K N+L+HMK
Sbjct: 210 QCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMK 259

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 12/65 (18%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW------------CLSKHKRKDNLLQHMKL 183
           CH C+  F+ + +L RH+  H+  + F CP+                  R+D    H+K+
Sbjct: 101 CHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHLKI 160

Query: 184 KHTDY 188
           +H  Y
Sbjct: 161 RHFMY 165

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPW--CLSKHKRKDNLLQHMKL----KHTD 187
           ++C  C K F R S L  H+  H+  + F CP+  C      K N+L+H KL       D
Sbjct: 235 YECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKLHFKTSSGD 294

Query: 188 YVL 190
           YVL
Sbjct: 295 YVL 297

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           C +C + F R+  L+RH  +H+  + F C +C     R+D +L+H +  H+
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 130

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELR 194
           KC  C+K F   S L+ H+ +H+  +  +C  C  +     NL +HMK+    Y+ +  +
Sbjct: 575 KCQFCDKRFTTSSSLRIHIRTHTGEKPLACNVCGKRFNESSNLSKHMKIHERKYMCKHCK 634

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMK 182
           KC  C+K+F  +  L +H+ +HS  R F C +C  +     +L  H++
Sbjct: 547 KCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIR 594

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 139 CNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C K F ++  L RH+  H+  + F CP C      +D L QH++
Sbjct: 523 CTKHFAQRQKLLRHIKVHTGYKPFKCPHCSKTFSTEDILSQHIR 566

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKL 183
           +KC +C KSF   S L+ H+ +H+  + F C  C  +     N  +HMK+
Sbjct: 928 YKCEICGKSFSISSSLKIHVRTHTGEKPFECKVCGKRFVESSNYSKHMKV 977

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 127 REAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMK 182
           R    Y  K H C+K FK++  + RHL +HS  + F C  C      K+ L+QH +
Sbjct: 865 RGKNSYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCSRCFSSKETLIQHYR 920

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 24/97 (24%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C  C K F R     RH  SH+ ++ FSC  C     R+D L +H++  H          
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVH---------- 59

Query: 196 NNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLI 232
                      K+++ ++L  G  N +E   V+NSLI
Sbjct: 60  -----------KSSLNSMLKTGNKNMEE---VMNSLI 82

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPW------------CLSKHKRKDNLLQHMKL 183
           CH C+ SF+ + +L RH+  H+  + + CP+                  R+D    H+K+
Sbjct: 182 CHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHLKV 241

Query: 184 KHTDY 188
           +H  Y
Sbjct: 242 RHFMY 246

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           ++ C LC+K F R   L+ HL +H+  R F C  C     R     QH + +H D
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFAR-----QHDRKRHED 699

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSC--------PW-CLSKHKRKDNLLQHMKLK 184
           C +CNK+F R+   +RH   H+  + + C         W C  K  R D L +H K +
Sbjct: 681 CSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

>KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.256
           YPL230W
          Length = 413

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           QG+   CH+    F R   L RH+  H+  + F C  CL    R DNL QH +  H+
Sbjct: 46  QGF-EDCHMA---FTRAEHLARHIRKHTGEKPFQCYICLKHFSRVDNLKQHRESVHS 98

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           C +C + F R+  L+RH  +H+  + F C +C     R+D +L+H +  H+
Sbjct: 34  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 84

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 2/87 (2%)

Query: 126 QREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185
           Q + + Y+  C  C K F R     RH  SH+  + F C  C     R+D L +H++  H
Sbjct: 6   QSQQKKYI--CSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIRTVH 63

Query: 186 TDYVLQELRLNNVYVSTEGSCKNNIRT 212
            + +L E  L     S++G     +R 
Sbjct: 64  RELLLVESSLEPAAGSSKGDLMLELRV 90

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 136 CHLCNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMK 182
           C  C++ F+R+  ++RH+ S H   + +SC  C     R DNL QH K
Sbjct: 173 CQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWC 167
           +C  C KSF +KS L+RHL SHS  + F C +C
Sbjct: 84  QCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYC 116

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 139 CNKSFKRKSWLQRHLLS-HSPARHFSCPWCLSKHKRKDNLLQHMKLKHTD 187
           C+K+F R S L  H LS H   R F C  C     +K +L +H+   H+D
Sbjct: 59  CDKAFTRPSILTEHQLSVHQGLRAFQCDKCPKSFVKKSHLERHL-YSHSD 107

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 136 CHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQELRL 195
           C  C K F +   L+ H+  H+  + + C  C  K  RK NL  H KL H +    E +L
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTHDNLKPFECKL 611

Query: 196 NN 197
           ++
Sbjct: 612 DD 613

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 135 KCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHT 186
           +C  C+K F + + L+ H+ SH   + FSC +C  +  +  NL  H++L HT
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL-HT 574

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 134 HKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQEL 193
           ++C  C + F RK  L  H L+H   + F C   L    +    L +MK     + LQ L
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECK--LDDCNKNFTQLGNMKAHQNRFHLQTL 636

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,317,098
Number of extensions: 1035159
Number of successful extensions: 4914
Number of sequences better than 10.0: 637
Number of HSP's gapped: 4673
Number of HSP's successfully gapped: 805
Length of query: 239
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 133
Effective length of database: 41,326,803
Effective search space: 5496464799
Effective search space used: 5496464799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)