Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A030602.532ON24424410831e-151
NCAS0D026402.532ON2602233091e-33
CAGL0K02981g2.532ON2782173092e-33
NDAI0I022702.532ON2772402778e-29
TPHA0C041802.532ON2642352638e-27
KAFR0A018502.532ON2562312541e-25
YMR069W (NAT4)2.532ON2852582421e-23
Smik_13.2482.532ON2552772373e-23
SAKL0A09460g2.532ON2402252331e-22
Kpol_1018.342.532ON2922092141e-19
Skud_13.2252.532ON2542252051e-18
Suva_13.2442.532ON2571792006e-18
KNAG0C058202.532ON2712501991e-17
KLTH0D06820g2.532ON2602431893e-16
Kwal_26.80162.532ON2402221865e-16
ZYRO0B01980g2.532ON1881831512e-11
TBLA0G022202.532ON2782391454e-10
Ecym_72562.532ON243206820.041
Skud_5.365.521ON73445711.4
ADR038C3.465ON19444655.6
NOTE: 2 genes in the same pillar as TDEL0A03060 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532 KLLA0E18569g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03060
         (244 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   421   e-151
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   123   1e-33
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   123   2e-33
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   111   8e-29
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   105   8e-27
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   102   1e-25
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    98   1e-23
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    96   3e-23
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...    94   1e-22
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    87   1e-19
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    84   1e-18
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    82   6e-18
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    81   1e-17
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    77   3e-16
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    76   5e-16
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    63   2e-11
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    60   4e-10
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    36   0.041
Skud_5.36 Chr5 complement(52831..55035) [2205 bp, 734 aa] {ON} Y...    32   1.4  
ADR038C Chr4 complement(773318..773902) [585 bp, 194 aa] {ON} Sy...    30   5.6  

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  421 bits (1083), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 210/244 (86%), Positives = 210/244 (86%)

Query: 1   MEQESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTEEYPVETDQCISYVHSPREAEKL 60
           MEQESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTEEYPVETDQCISYVHSPREAEKL
Sbjct: 1   MEQESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTEEYPVETDQCISYVHSPREAEKL 60

Query: 61  LWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRR 120
           LWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYS        QRR
Sbjct: 61  LWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRR 120

Query: 121 NAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXXXXXXDHLAQC 180
           NA          MLTEEDGLVADDPTEVWTVLYLYELQ                DHLAQC
Sbjct: 121 NAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQC 180

Query: 181 GRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPTVLDTDSLYRLY 240
           GRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPTVLDTDSLYRLY
Sbjct: 181 GRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPTVLDTDSLYRLY 240

Query: 241 VLQL 244
           VLQL
Sbjct: 241 VLQL 244

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  123 bits (309), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 111/223 (49%), Gaps = 26/223 (11%)

Query: 15  QNFPTTINAAGIQLTRKLLAIDTEEYPVETDQCIS--------YVH-SPREAEKLLWQLL 65
           + FP T+    + L  +L  +  +   +E D C S        Y+  S  + +K+L Q L
Sbjct: 13  EEFPLTLE---VTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFL 69

Query: 66  EILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXXX 125
           +ILD NLG+KY   S+ +Y N RPW+VNK  EM +PGLVYV Y                 
Sbjct: 70  DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWD----------EESDE 119

Query: 126 XXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXXXXXXDHLAQCGRQLC 185
                  MLTEEDG   DD  ++ +V+YLYE+Q                +HL     +L 
Sbjct: 120 PMLFLSFMLTEEDGFTEDD--KLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRL- 176

Query: 186 TRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228
            RS  G   +    G+ELTVF+DN  AI+ Y+S+GM+L  DSP
Sbjct: 177 -RSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSP 218

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  123 bits (309), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 113/217 (52%), Gaps = 17/217 (7%)

Query: 16  NFPTTINAAGIQLTRKLLAIDTEEYPVE----TDQCISYVHSPREAEKLLWQLLEILDEN 71
           N P  I    +QL RK+L ID ++Y +     T++ +      +E++ +L  LLE+LD+N
Sbjct: 32  NLPKDI--EDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHIKESKNILSSLLELLDQN 89

Query: 72  LGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXXXXXXXXX 131
           LGQKY  SS+ +Y N +PW+ NK  EM T G++YV Y         +  +          
Sbjct: 90  LGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSY-------WTKVDDEHTVPLLFLS 142

Query: 132 XMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXXXXXXDHLAQCGRQLCTRSRAG 191
            MLTEE+ L  +DP  V +V++LYE+Q                + L QC ++L       
Sbjct: 143 FMLTEEENLTHNDP--VSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLN 200

Query: 192 RFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228
              +  F G+ELTVFADN PAI LY+ LGM    +SP
Sbjct: 201 L--EFPFAGIELTVFADNLPAINLYQKLGMTHTPESP 235

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  111 bits (277), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 113/240 (47%), Gaps = 30/240 (12%)

Query: 15  QNFPTTINAA-GIQLTRKLL----AIDTEEYPVE-TDQCISYVHSPREAEKLLWQLLEIL 68
           + FPT + +A G+   R+ +    + D    P+E + +  +    P++   +L + L IL
Sbjct: 15  EEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRSDVLNKFLNIL 74

Query: 69  DENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXXXXXX 128
           D NLG KY   S+ +Y N + W+ NK  EML+PGL+YV Y                    
Sbjct: 75  DVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSY----------WDEKYQEPLL 124

Query: 129 XXXXMLTEEDGLVA-----DDPTE----VWTVLYLYELQXXXXXXXXXXXXXXXXDHLAQ 179
               MLTE DG +      DD  E    + +V+YLYE+Q                 HL Q
Sbjct: 125 FLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQ 184

Query: 180 CGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPTVLDTDSLYRL 239
           C   L T+     F      G+ELTVF+DN  AI  Y+S+GM+L  DSP    TD +Y++
Sbjct: 185 CCSSLVTK-YGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSP----TDEVYQI 239

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  105 bits (263), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 113/235 (48%), Gaps = 29/235 (12%)

Query: 6   LNDVVKYA---NQNFPTTI--NAAGIQLTRKLLAIDTEEYPVETD------QCISYVHSP 54
           ++D+VK+    + ++P  I  N    +L +K++ +D+E   ++        + ++Y  + 
Sbjct: 1   MDDIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK 60

Query: 55  REAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXX 114
            E E    ++L ILD NLG  Y   ++ LY N++PW+ NK +EM T GL+YV+Y      
Sbjct: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVY------ 114

Query: 115 XXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWT-VLYLYELQXXXXXXXXXXXXXXX 173
                 +            LT+E G + D   +V++ V+YLYE+Q               
Sbjct: 115 ---HLEDEKKTVSLYLSFTLTKESGFLPD--IDVFSPVIYLYEIQLTPEVRNNGLGTKLI 169

Query: 174 XDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228
             +L  C   +               G+ELTVF+DN  AIR YE++GM+L  DSP
Sbjct: 170 AGYLKDCLVDVHENIHKD------IIGIELTVFSDNTNAIRFYETIGMKLTPDSP 218

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  102 bits (254), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 103/231 (44%), Gaps = 21/231 (9%)

Query: 4   ESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTE-EYPVETDQCISYVHSPRE-----A 57
           E  N  +K  +  FP  +   G  L RK+L I +E E   E+D  I+      +      
Sbjct: 5   EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 64

Query: 58  EKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXX 117
            KLL   LEILD NLG KY   SR +Y N   W+ NK  EM +PGL+YV Y         
Sbjct: 65  SKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSY--------W 116

Query: 118 QRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXXXXXXDHL 177
           +              MLTEED +V  D    ++V+YLYE+Q                  L
Sbjct: 117 KEEAEKKTCALFLSFMLTEEDFVV--DDIRKFSVIYLYEIQLIEKYRGCQLGT-----RL 169

Query: 178 AQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228
            +    +C  ++          G++LTVF+DN  AI+ YE +GM+    SP
Sbjct: 170 IKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSP 220

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 97.8 bits (242), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 114/258 (44%), Gaps = 54/258 (20%)

Query: 13  ANQNFPTTINAAGIQLTRKLLAI---DTEEY-PVETDQCISYVHSPREAEKLLWQLLEIL 68
            N NF T I      L R+++ I   DT+    V++ +CI+Y       +++L   ++++
Sbjct: 55  GNGNFTTAI------LEREIIYIPEDDTDSIDSVDSLKCINYKLHKSRGDQVLDACVQLI 108

Query: 69  DENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXXXXXX 128
           D++LG KY  +SR +Y N +PW+ NK  EM + GLVYV Y                    
Sbjct: 109 DKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWDNGVLGAFT---------- 158

Query: 129 XXXXMLTEEDGLVADDPTEVWT--VLYLYELQXXXXXXXXXXXX----XXXXDHLAQCGR 182
               MLTEE GLV  D     +  V+YLYE+                     D +A+  R
Sbjct: 159 --SFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTR 216

Query: 183 QLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP-------------- 228
           ++C            FFG+ LTVF+DN  A RLYE+LG   A  SP              
Sbjct: 217 RMC----------DNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGG 266

Query: 229 --TVLDTDSLYRLYVLQL 244
              V+  D LY +Y L +
Sbjct: 267 GRVVVPCDPLYYVYCLHM 284

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 95.9 bits (237), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 113/277 (40%), Gaps = 62/277 (22%)

Query: 6   LNDVVKYANQNFPTTI----------NAAGIQLTRKLLAI----DTEEYPVETDQCISYV 51
            +  +K   Q+FP T+           A    L R++L I       +  +E   C++Y 
Sbjct: 2   FHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNYR 61

Query: 52  HSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXX 111
                   +L   ++++DE+LG KY  +SR +Y N +PW+ NK  EM +P LVYV Y   
Sbjct: 62  LHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWD- 120

Query: 112 XXXXXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWT--VLYLYELQXXXXXXXXXXX 169
                                MLTEE GLV  D     +  V+YLYE+            
Sbjct: 121 -----------NGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGI- 168

Query: 170 XXXXXDHLAQCGRQLCTR------SRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQL 223
                      GR+L  R      +R  R     FFG+ LTVF+DN  A RLYE+LG   
Sbjct: 169 -----------GRRLLERALCEGVARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYR 217

Query: 224 AADSP----------------TVLDTDSLYRLYVLQL 244
           A  SP                 V+  D LY +Y L +
Sbjct: 218 APGSPAAGAPTTRPTRHGGERVVVPRDPLYYVYCLHM 254

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score = 94.4 bits (233), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 102/225 (45%), Gaps = 25/225 (11%)

Query: 7   NDVVKYANQNFPTTINAA-GIQLTRKLLAIDTEEYPV-ETDQCISYVHSPREAEKLLWQL 64
           N ++ Y   +FPT+I    G   TRK+L ID     +  + Q  ++    + +  LL Q 
Sbjct: 7   NVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSNSLLIQF 66

Query: 65  LEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXX 124
           L++LD NLG KY   S  LY NTR W  NK  EM T GLVYV Y                
Sbjct: 67  LKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQ------------GV 114

Query: 125 XXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXXXXXXDHLAQCGRQL 184
                   +LT+E   +  DP +   V+YLYE+Q                 +L      L
Sbjct: 115 SPLMFLSFLLTDEPDFLP-DPVK---VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSL 170

Query: 185 CTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPT 229
              SR     K    G+ELTVF+DN  A+ LY S+GM LA  SPT
Sbjct: 171 ---SRLDPLLK----GIELTVFSDNDAALHLYYSIGMALAPGSPT 208

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 87.0 bits (214), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 98/209 (46%), Gaps = 24/209 (11%)

Query: 28  LTRKLLAIDTEEYPVET-DQCISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHN 86
           L R+L+AID++   ++  +  +SY     + + +L +LL+ILD NLG  Y   S  +Y N
Sbjct: 35  LHRQLIAIDSKNNQIDVRNNVLSYYKDNVKCDVVLNKLLDILDNNLGPIYLEKSSKIYCN 94

Query: 87  TRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXXXXXXXXXXMLTEEDGLVA---D 143
            +PW+ NK  EM + GL+YVIY+           +           M+T++  LV    +
Sbjct: 95  EKPWKENKIVEMKSEGLLYVIYND----------DITKEPLLFMSFMITDDPSLVVPTDN 144

Query: 144 DPTEVWT----VLYLYELQXXXXXXXXXXXXXXXXDHLAQCGRQLCTRSRAGRFSKTRFF 199
           D  E+      V+YLYE+Q                ++L +    L       +  +    
Sbjct: 145 DSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIEIL------NKDYQKNII 198

Query: 200 GLELTVFADNAPAIRLYESLGMQLAADSP 228
            LELTVF++N  AI  Y+ +GM    DSP
Sbjct: 199 ALELTVFSNNINAINFYKKIGMLYTPDSP 227

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 83.6 bits (205), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 99/225 (44%), Gaps = 36/225 (16%)

Query: 8   DVVKYANQNFPTTINAAGIQLTRKLLAIDTEEYPVET---DQCISYVHSPREAEKLLWQL 64
           + ++Y   N   T+    + L R+++ I  E   V++    QC +Y       + +L   
Sbjct: 15  ETLEYTESNENATVVTTTV-LKREIMYIPEENGEVDSIDGPQCTNYNLHKSHGDHVLDSC 73

Query: 65  LEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXX 124
           ++++DE+LG KY  +SR +Y N  PW+ NK  EM + GL+YV Y                
Sbjct: 74  VQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYW------------GNG 121

Query: 125 XXXXXXXXMLTEEDGLVADDPTEVWT--VLYLYELQXXXXXXXXXXXXXXXXDHLAQCGR 182
                   MLTEE GLV  D     +  V+YLYE+                       GR
Sbjct: 122 ALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGL------------GR 169

Query: 183 QLCTRSRAGRFSKTR------FFGLELTVFADNAPAIRLYESLGM 221
           +L  R+     ++        FFG+ LTVF DN  A RLYE++G 
Sbjct: 170 RLLERALCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 81.6 bits (200), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 82/179 (45%), Gaps = 21/179 (11%)

Query: 44  TDQCISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGL 103
           T +C++Y     + ++ L   ++++DE+LG KY  +SR +Y N  PW+ NK  EM + GL
Sbjct: 53  TPECMNYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGL 112

Query: 104 VYVIYSXXXXXXXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWT--VLYLYELQXXX 161
           VYV Y                        MLTEE GLV  D     +  V+YLYE+    
Sbjct: 113 VYVCY-------WGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXH 165

Query: 162 XXXXXXXXXXXXXDHLAQCGRQLCTRSRAGRFSKT--RFFGLELTVFADNAPAIRLYES 218
                               + LC    A R  +T    FG+ LTVF DN  A RLYES
Sbjct: 166 RGRGLGRRLL---------AKALC-EGVAARVRRTCDDLFGVALTVFGDNTRARRLYES 214

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 81.3 bits (199), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 103/250 (41%), Gaps = 47/250 (18%)

Query: 1   MEQESLNDVVKYANQNFPTTI----NAAGIQLTRKLLAIDT--EEYPVETDQCISY---- 50
           M++  L   ++  ++ FPT I    N   + L R++  I+   ++     ++ +SY    
Sbjct: 1   MDENDLTLFLQTVDRQFPTVIGCDLNGTAVSLKRRIHYIEGVGDDDDESHNKIMSYPGGL 60

Query: 51  ------------VHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREM 98
                              E+ L   LEILD NLG  YA  SR +Y N++ WR NKW EM
Sbjct: 61  PPLPPTTDDNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEM 120

Query: 99  LTPGLVYVIYSXXXXXXXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQ 158
           L+  LVYV Y             +          MLTEE+G+ + + T+   V+YLYE+Q
Sbjct: 121 LSAQLVYVSYWV-----------SDSEPVLYTSFMLTEENGISSIESTD--RVVYLYEIQ 167

Query: 159 XXXXXXXXXXXXXXXXDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYES 218
                            +L +C                    + LTVF+DN  A++ YE 
Sbjct: 168 LIEAIRRQKLGQAIVS-YLTECA-----------LESPEVAAVALTVFSDNEKALKFYER 215

Query: 219 LGMQLAADSP 228
           L      DSP
Sbjct: 216 LNFTYTIDSP 225

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 101/243 (41%), Gaps = 45/243 (18%)

Query: 7   NDVVKYANQNFPT--TINAAGIQLTRKLLAIDT------------------EEYPVETDQ 46
           +++  +  Q FP   T+     QLTR +  I +                  E  P    +
Sbjct: 7   SELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASE 66

Query: 47  CISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTR-PWRVNKWREMLTPGLVY 105
           C S    PR    LL QLL ++  NLG  Y   +RA+Y   R  W   K  EM TPGLVY
Sbjct: 67  CDSV---PRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVY 123

Query: 106 VIYSXXXXXXXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXX 165
           V+YS           ++          +LT+E  L  +       VLYL+E+        
Sbjct: 124 VVYS-----------DSHSQPLVFMSLLLTDEPELGQE---LAARVLYLFEIHVSDIIRG 169

Query: 166 XXXXXXXXXDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAA 225
                    D L   G  L + SRA         G ELTVF++N  A+RLY +LGM +AA
Sbjct: 170 QGLGTHLLRDCL---GGTLASLSRA----SPSVLGAELTVFSENQRALRLYLALGMHVAA 222

Query: 226 DSP 228
            SP
Sbjct: 223 WSP 225

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 76.3 bits (186), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 102/222 (45%), Gaps = 27/222 (12%)

Query: 9   VVKYANQNFPTTIN-AAGIQLTRKLLAIDTEEYPVETDQCISYVHSPREAEKLLWQLLEI 67
           +V +   +FPTT+  A+G ++ R +  +     P++T +  + +  P     LL QLL +
Sbjct: 9   LVPHVTDSFPTTLTLASGQRIQRAVYGV-----PMDTVRSRAEIPDP----CLLEQLLAL 59

Query: 68  LDENLGQKYAGSSRALYHN-TRPWRVNKWREMLTPGLVYVIYSXXXXXXXXQRRNAXXXX 126
           +D NLG  YA  ++ALY +    W+  K +EM+TPGLVYV+Y         +        
Sbjct: 60  VDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYR-----AVDEETGKEGLP 114

Query: 127 XXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXXXXXXDHLAQCGRQLCT 186
                 +LT+E  L    P     V+YL E+                 + +A        
Sbjct: 115 LAFLSLLLTDEPEL---GPAPA-AVVYLMEIHVADIIRGLGLGGTLLREGVAGT------ 164

Query: 187 RSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228
             R  R +     G ELTVF DN  A+RLY  LGMQ+AA SP
Sbjct: 165 -VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSP 205

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 78/183 (42%), Gaps = 31/183 (16%)

Query: 47  CISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYV 106
           CIS        +K+L + L++++ NLG  Y   ++ +Y N + W+ NKW+EM +  L +V
Sbjct: 12  CIS-----NSNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHV 66

Query: 107 IYSXXXXXXXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXX 166
            Y            N           ++  E+ +V     E+  ++YLYE+         
Sbjct: 67  SY-----------WNVESNELVCFCSIMPCEESIVEG---EMSNIIYLYEIHVAPEWRN- 111

Query: 167 XXXXXXXXDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAAD 226
                       + G+ +    +     K    G+ELTVF+ N  AI  Y + G  L+ D
Sbjct: 112 -----------QKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYD 160

Query: 227 SPT 229
           SP+
Sbjct: 161 SPS 163

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 101/239 (42%), Gaps = 40/239 (16%)

Query: 9   VVKYANQNFPTTINAA-GIQLTRKLLAI-DTEEYPVETDQCISYVHSPREAEKLLW---- 62
           +V+  +  FP +I+   GI L RK+  I D+E   + +DQ     ++    +++ W    
Sbjct: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQ-----NNNSNDDEIYWYFKD 60

Query: 63  ------------QLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSX 110
                       Q+ +++DENLG+ Y   S+ +Y N   W +NK  EM T  ++Y+ Y  
Sbjct: 61  RKNPTVENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYW- 119

Query: 111 XXXXXXXQRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLYELQXXXXXXXXXXXX 170
                     +           +L+ E+  + ++  +   VLYLYE+             
Sbjct: 120 ----------DCKQNSVALFLSILSCEETYILEN-NDQGEVLYLYEIHITKEYQRQGIGE 168

Query: 171 XXXXDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLY-ESLGMQLAADSP 228
               D+L +   +L    +  R     F GLELTVF++N  A   Y   + MQ    SP
Sbjct: 169 RLIKDYLIE---KLIKPLKIER-QDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSP 223

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 67/206 (32%), Gaps = 30/206 (14%)

Query: 58  EKLLWQLLEILDENLGQKYAGSSRALYHN---TRPWRVNKWREMLTPGLVYVIYSXXXXX 114
           +K   QL  I++  LG  Y   +  LY     +RPW+ +K  E+   G  +V+Y      
Sbjct: 44  QKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPG 103

Query: 115 XXX-------------------QRRNAXXXXXXXXXXMLTEEDGLVADDPTEVWTVLYLY 155
                                  R  A            + E       P     V+Y+ 
Sbjct: 104 GAIAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVM 163

Query: 156 ELQXXXXXXXXXXXXXXXXDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRL 215
           E+                   +  C RQL    +    S  +  GLELTVF  N  A+ L
Sbjct: 164 EIHVSPSFQNQGLGSC-----MLLCARQLVQHMQP---SFPQLKGLELTVFTGNRQALAL 215

Query: 216 YESLGMQLAADSPTVLDTDSLYRLYV 241
           Y   G + A ++   L    L  +Y 
Sbjct: 216 YRRQGFKTATNTEFFLSNSELTVMYC 241

>Skud_5.36 Chr5 complement(52831..55035) [2205 bp, 734 aa] {ON}
           YEL053C (REAL)
          Length = 734

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 187 RSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPTVL 231
           R+  GRFS T F+ L +  F+   P+ +L  ++G +L  +S  +L
Sbjct: 350 RTVLGRFSFTHFYSLHVKEFSAQTPS-KLLSNIGSELIQESSNIL 393

>ADR038C Chr4 complement(773318..773902) [585 bp, 194 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR131C
           (NAT3)
          Length = 194

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 201 LELTVFADNAPAIRLYESLGMQLAADSPTVLDTDSLYRLYVLQL 244
           ++L V  +NA AIRLYE LG  +        +T   YRL+ L++
Sbjct: 113 IDLFVKCNNALAIRLYEKLGYSVYRRVVGYYNTAEEYRLHSLKV 156

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,736,284
Number of extensions: 751256
Number of successful extensions: 1557
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1552
Number of HSP's successfully gapped: 22
Length of query: 244
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 137
Effective length of database: 41,212,137
Effective search space: 5646062769
Effective search space used: 5646062769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)