Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0A030502.530ON35535515770.0
CAGL0K02959g2.530ON4643819111e-120
KAFR0A018302.530ON4423778991e-118
YHR004C (NEM1)2.530ON4463888981e-118
Suva_8.582.530ON4523848961e-117
Skud_8.492.530ON4473808871e-116
NCAS0F009302.530ON4223588701e-114
ZYRO0B01958g2.530ON3362778541e-113
KNAG0C058502.530ON4433348611e-112
Smik_8.532.530ON4463768601e-112
SAKL0A09416g2.530ON3853858501e-111
NDAI0H014202.530ON4483498421e-109
Kpol_348.82.530ON4224198331e-108
TPHA0G035002.530ON3922648191e-107
Kwal_26.80012.530ON4134118031e-104
KLTH0D06776g2.530ON4092117801e-101
TBLA0I014602.530ON3932257414e-95
AGL070W2.530ON3433657253e-93
Ecym_72572.530ON3523667237e-93
KLLA0E18613g2.530ON3743235794e-71
SAKL0G12870g5.202ON3991812479e-23
YLR019W (PSR2)5.202ON3971612479e-23
Skud_12.875.202ON3921592461e-22
Suva_10.995.202ON3851642434e-22
Smik_12.825.202ON3921782434e-22
NDAI0I021705.202ON3911922434e-22
Kpol_2002.1005.202ON4771502383e-21
Smik_12.535.202ON4142022364e-21
Kpol_478.165.202ON3501782335e-21
NDAI0D018605.202ON5141592366e-21
ZYRO0B10428g5.202ON4821592358e-21
TPHA0E030705.202ON4941592359e-21
CAGL0D05610g5.202ON4471672321e-20
KNAG0M017405.202ON4811592322e-20
NCAS0D027405.202ON3981802293e-20
TBLA0C060905.202ON4841592303e-20
CAGL0D03234g5.202ON4101782284e-20
YLL010C (PSR1)5.202ON4272022284e-20
Suva_10.655.202ON4151902267e-20
Ecym_71045.202ON4921612287e-20
Kwal_33.151405.202ON4101482267e-20
KLTH0B03388g5.202ON4091592267e-20
Skud_12.575.202ON4151902269e-20
TBLA0H019905.202ON6882362271e-19
KLLA0F15620g5.202ON4141902251e-19
KAFR0J009905.202ON4831602252e-19
TPHA0N006705.202ON4521492232e-19
TDEL0E042705.202ON4531592223e-19
AAL158W5.202ON4781902215e-19
NCAS0A068005.202ON4731502153e-18
TDEL0B031908.527ON4771321737e-13
YPL063W (TIM50)8.527ON4761321737e-13
SAKL0H10296g8.527ON4781321683e-12
Smik_16.1728.527ON4771321657e-12
Kpol_457.58.527ON4891321658e-12
ZYRO0F09130g8.527ON4891331658e-12
Suva_16.2498.527ON4801321648e-12
Kwal_27.119908.527ON4741321612e-11
KLTH0E12254g8.527ON4761011594e-11
Skud_16.2188.527ON4801321577e-11
NCAS0C022108.527ON4911321568e-11
KLLA0E23101g8.527ON4801451561e-10
NDAI0E029108.527ON4411011522e-10
CAGL0H05159g8.527ON4851321498e-10
TBLA0A005408.527ON4851331481e-09
Ecym_11778.527ON4901321461e-09
TPHA0I020008.527ON4781011452e-09
ADR045W8.527ON4761001372e-08
KAFR0E010208.527ON4481011283e-07
KNAG0A020608.527ON4501071248e-07
NCAS0C004208.839ON725106900.015
TPHA0I002408.839ON732183890.017
CAGL0M02959g8.839ON758103870.033
Kpol_1068.98.839ON745100830.11
Kwal_27.102638.839ON743124790.26
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0A03050
         (355 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   612   0.0  
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   355   e-120
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   350   e-118
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   350   e-118
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   349   e-117
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   346   e-116
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   339   e-114
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   333   e-113
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   336   e-112
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   335   e-112
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   332   e-111
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    328   e-109
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   325   e-108
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   320   e-107
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   313   e-104
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   305   e-101
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   290   4e-95
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   283   3e-93
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   283   7e-93
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   227   4e-71
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   100   9e-23
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   100   9e-23
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    99   1e-22
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    98   4e-22
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    98   4e-22
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     98   4e-22
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    96   3e-21
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    96   4e-21
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    94   5e-21
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     96   6e-21
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    95   8e-21
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    95   9e-21
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    94   1e-20
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    94   2e-20
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    93   3e-20
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    93   3e-20
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    92   4e-20
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    92   4e-20
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    92   7e-20
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    92   7e-20
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    92   7e-20
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    92   7e-20
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    92   9e-20
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    92   1e-19
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    91   1e-19
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    91   2e-19
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    91   2e-19
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    90   3e-19
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    90   5e-19
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    87   3e-18
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    71   7e-13
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    71   7e-13
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    69   3e-12
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    68   7e-12
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    68   8e-12
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    68   8e-12
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    68   8e-12
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    67   2e-11
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    66   4e-11
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    65   7e-11
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     65   8e-11
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    65   1e-10
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    63   2e-10
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    62   8e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    62   1e-09
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    61   1e-09
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    60   2e-09
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    57   2e-08
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    54   3e-07
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    52   8e-07
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    39   0.015
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    39   0.017
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...    38   0.033
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...    37   0.11 
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...    35   0.26 

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/355 (86%), Positives = 307/355 (86%)

Query: 1   MNAVSYISDQLSKRDKNGKTEDVEDKVAVQKREKIVRRRSKFTSYAWAVILFFPQWLIIK 60
           MNAVSYISDQLSKRDKNGKTEDVEDKVAVQKREKIVRRRSKFTSYAWAVILFFPQWLIIK
Sbjct: 1   MNAVSYISDQLSKRDKNGKTEDVEDKVAVQKREKIVRRRSKFTSYAWAVILFFPQWLIIK 60

Query: 61  PTQXXXXXXXXXXXXXEYGLKSRLQRKSTKRSTGTLQSISXXXXXXXXXXXXIFLQRDAV 120
           PTQ             EYGLKSRLQRKSTKRSTGTLQSIS            IFLQRDAV
Sbjct: 61  PTQLIWWIISLPLLLIEYGLKSRLQRKSTKRSTGTLQSISELEEDDLAGGDEIFLQRDAV 120

Query: 121 KGSLAPAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLI 180
           KGSLAPAKY          TVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLI
Sbjct: 121 KGSLAPAKYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLI 180

Query: 181 HSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMR 240
           HSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMR
Sbjct: 181 HSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMR 240

Query: 241 EYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPI 300
           EYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPI
Sbjct: 241 EYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPI 300

Query: 301 SYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAFLS 355
           SYAMNVDNAIQVEGWI             FLEALRYTTDVRDILALKNSEQAFLS
Sbjct: 301 SYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAFLS 355

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/381 (48%), Positives = 242/381 (63%), Gaps = 39/381 (10%)

Query: 12  SKRDKNGKTEDVEDK------VAVQKREKIV----RRRSKFTSYAWAVILFFPQWLIIKP 61
           +++D++ KT +V +       V+ +  EK +     R  KF    W++I FFP +++IKP
Sbjct: 81  AQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVVWSIITFFPNYILIKP 140

Query: 62  TQXXXXXXXXXXXXXEYGLKSR---------LQRKSTKRSTGT---LQSISXXXXXXXXX 109
           T              E+ ++ R          Q  +T +       L  I          
Sbjct: 141 TLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPSKRLNVIEEAIEDDLIS 200

Query: 110 XXXIFLQRDAVKGSLAPA------------KYXXXXXXXXXXTVMLGTKRMGRFLFPKKL 157
              + LQ+DA+KGSL P             +           + +LGTK MGRF FPKKL
Sbjct: 201 GEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKL 260

Query: 158 IPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRP 217
           IPRS+L++EK+K LV+DLDETLIHS SR T+HSNS+Q H++E+RFAISGVSTLYYVHKRP
Sbjct: 261 IPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRP 320

Query: 218 HCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIK 277
           +CDLFLSKV KWY+L++FTASM+EYADPVIDWLE SFSG F++R+YRN+CI RDGVGYIK
Sbjct: 321 YCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIK 380

Query: 278 DLSIVCGP-----TVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE 332
           DL  +  P     T+ L +V+++DNSP+SYAM+VDNAIQVEGWI             FLE
Sbjct: 381 DLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLE 440

Query: 333 ALRYTTDVRDILALKNSEQAF 353
           ALRYTTDVR++LALKNSE+AF
Sbjct: 441 ALRYTTDVRNVLALKNSEKAF 461

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  350 bits (899), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 236/377 (62%), Gaps = 41/377 (10%)

Query: 16  KNGKTEDVEDKVAVQKREKIVRRR-------SKFTSYAW--AVILFFPQWLIIKPTQXXX 66
           K+   ++VE   A+  +++I R+R        KF  ++    +ILF P++L + P     
Sbjct: 65  KDAHNQNVEG--AIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIYVW 122

Query: 67  XXXXXXXXXXEYGLKSRLQRKSTK--------RSTGTLQSISXXXXXXXXXXXXIFLQRD 118
                     E G+K R ++K  +             L+SIS             FLQRD
Sbjct: 123 FILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQRD 182

Query: 119 AVKGSLAPA-----------KYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEK 167
            +KGSL  A           K           T + GTK+MGRFLFPKKLIPRS+L  E+
Sbjct: 183 TIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCNER 242

Query: 168 RKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVS 227
           +K LVVDLDETLIHS SR T+H NS+QGH+VE++F+I+G+STLYYVHKRP CDLFLSKVS
Sbjct: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVS 302

Query: 228 KWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCG--- 284
           KWY++V+FTASM+EYADPVIDWLEGSF G F+KRLYR+NC+LRDGVGYIKDLS++     
Sbjct: 303 KWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANH 362

Query: 285 --------PTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRY 336
                   P   L EVI++DNSP+SYA+NVDNAIQVEGWI              LEALRY
Sbjct: 363 AQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLNLLPILEALRY 422

Query: 337 TTDVRDILALKNSEQAF 353
           TTDVR++LALKN E+ F
Sbjct: 423 TTDVRNVLALKNGEKMF 439

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  350 bits (898), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/388 (48%), Positives = 237/388 (61%), Gaps = 47/388 (12%)

Query: 8   SDQLSKRDKNGKTEDVEDKVAVQKREKIVRRR--SKFTSYAWAVILFFPQWLIIKPTQXX 65
           S  L + D+N      E K +V K+ K +R     K  S  WA++LF P +LIIKP    
Sbjct: 61  SSHLKESDQNQ-----ERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSL 115

Query: 66  XXXXXXXXXXXEYGLKSRLQR----------------------KSTKRSTGTLQSISXXX 103
                      E  +K   +R                      + T      L +I    
Sbjct: 116 WFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAV 175

Query: 104 XXXXXXXXXIFLQRDAVKGSLAPA-----------KYXXXXXXXXXXTVMLGTKRMGRFL 152
                    I LQRD VKGSL  A           K             + GTKRMGRFL
Sbjct: 176 EDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFL 235

Query: 153 FPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYY 212
           FPKKLIP+SVL+ +K+K+LV+DLDETLIHSASR+T+HSNS+QGH+VE++F +SG+ TLY+
Sbjct: 236 FPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYF 295

Query: 213 VHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDG 272
           +HKRP+CDLFL+KVSKWYDL++FTASM+EYADPVIDWLE SF   FSKR YR++C+LRDG
Sbjct: 296 IHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDG 355

Query: 273 VGYIKDLSIV-------CGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXX 325
           VGYIKDLSIV        G + +L +VI++DNSP+SYAMNVDNAIQVEGWI         
Sbjct: 356 VGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLL 415

Query: 326 XXXXFLEALRYTTDVRDILALKNSEQAF 353
               FLEA+RY+TDVR+ILALK+ E+AF
Sbjct: 416 NLLPFLEAMRYSTDVRNILALKHGEKAF 443

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  349 bits (896), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/384 (47%), Positives = 234/384 (60%), Gaps = 47/384 (12%)

Query: 17  NGKTEDVEDKVAVQKREKIVRR--RSKFTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXX 74
           N   +D E   +V  + K +    + K  S  WA++LF P +LIIKP             
Sbjct: 66  NEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVFTFPLN 125

Query: 75  XXEYGLKSRLQRKSTKRSTG----------------------TLQSISXXXXXXXXXXXX 112
             E  +K   +R      +G                       L +I             
Sbjct: 126 VIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDLNASDE 185

Query: 113 IFLQRDAVKGSLAPA---------------KYXXXXXXXXXXTVMLGTKRMGRFLFPKKL 157
           I LQRD VKGSL  A               K             + GTKRMGRFLFPKKL
Sbjct: 186 IILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFLFPKKL 245

Query: 158 IPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRP 217
           IP+S+L+ +K+K+LV+DLDETLIHSASR T+HSNS+QGH+VE++F ISG+STLY++HKRP
Sbjct: 246 IPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRP 305

Query: 218 HCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIK 277
           +CDLFL+K SKWYDL++FTASM+EYADPVIDWLEGSF+  FSKR YR++C+LRDGVGYIK
Sbjct: 306 YCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIK 365

Query: 278 DLSIV-------CGPTV-TLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXX 329
           DLSI+        G ++ +L +VI++DNSP+SYAMNVDNAIQVEGWI             
Sbjct: 366 DLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLP 425

Query: 330 FLEALRYTTDVRDILALKNSEQAF 353
           FLEA+RY+TDVR+ILALK+ E+AF
Sbjct: 426 FLEAMRYSTDVRNILALKHGEKAF 449

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  346 bits (887), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 232/380 (61%), Gaps = 45/380 (11%)

Query: 18  GKTEDVEDKVAVQKREKIVRR--RSKFTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXXX 75
           G  ++ ++  +V  + K +R   R K  S  W ++LF P +LIIKP              
Sbjct: 66  GSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSV 125

Query: 76  XEYGLKSRLQR----------------------KSTKRSTGTLQSISXXXXXXXXXXXXI 113
            E  +K   +R                      +      G L +I             I
Sbjct: 126 IERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPETVDDDLNASDEI 185

Query: 114 FLQRDAVKGSLAPAK-----------YXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSV 162
            LQRD VKGSL  A+                        + GTKRMGRFLFPKKLIP+S+
Sbjct: 186 ILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKLIPKSI 245

Query: 163 LHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLF 222
           L+ +K+K+LV+DLDETLIHSASR+T+HSNS+QGH+VE++F ISG+ TLY++HKRP+CD F
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTLYFIHKRPYCDFF 305

Query: 223 LSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIV 282
           L+KVS+WYDL++FTASM+EYADPVIDWLE SF   FSKR YR++C+LRDGVGYIKDLSI+
Sbjct: 306 LTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSII 365

Query: 283 ---------CGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEA 333
                      P+ +L +VI++DNSP+SYAMNVDNAIQVEGWI             FLEA
Sbjct: 366 KSSEENGKGSSPS-SLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEA 424

Query: 334 LRYTTDVRDILALKNSEQAF 353
           +RY+TDVR+ILALK+ E+AF
Sbjct: 425 MRYSTDVRNILALKHGEKAF 444

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  339 bits (870), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 179/358 (50%), Positives = 228/358 (63%), Gaps = 31/358 (8%)

Query: 23  VEDKVAVQKREKIVRRRSKFTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXXXXEYG--- 79
           +E  +AV   ++ +R    F+   W  +LFFP++LI+KP               E G   
Sbjct: 66  IEKSIAVYGSDRALR----FSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKH 121

Query: 80  ---LKSRLQRKSTKR------STGTLQSISXXXXXXXXXXXXIFLQRDAVKGSLAPAKYX 130
              LK++L   S K       ++  L  I             I+LQRD +KGSL  A   
Sbjct: 122 RTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATSA 181

Query: 131 XXXXXX------XXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSAS 184
                               +KRMG+FLFPKKLIPRS++   +RK+LV+DLDETLIHS S
Sbjct: 182 KQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMS 241

Query: 185 RTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYAD 244
           R T+HSNS+QGH+VE++F++SGVSTLYYVHKRP+CD FLSKVSKWYDL++FTASM+EYAD
Sbjct: 242 RGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYAD 301

Query: 245 PVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPT---------VTLGEVILV 295
           PVIDWLE S   +FS+RLYR +CILRDGVGYIKDLS++   +          +LGE+I++
Sbjct: 302 PVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIII 361

Query: 296 DNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
           DNSPISYAMNV+NAIQVEGWI              LEALR+TTDVR++LALKN E+AF
Sbjct: 362 DNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  333 bits (854), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 171/277 (61%), Positives = 200/277 (72%), Gaps = 20/277 (7%)

Query: 77  EYGLKSRLQRKSTKRSTGTLQSISXXXXXXXXXXXXIFLQRDAVKGSLAPAKYXXXXXXX 136
           EYGLKS+ + +ST R     + I             +FLQRD VKG L    +       
Sbjct: 79  EYGLKSKQKVESTSRKG---EIIRKKEVDDDLAEDEMFLQRDTVKGGLRGKAF------- 128

Query: 137 XXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGH 196
                  GTK+MGRFLFPKKL+P+S+L AE++KRLVVDLDETLIHSA+R+ SHSNSAQGH
Sbjct: 129 -------GTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGH 181

Query: 197 MVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSG 256
           MVE+RF  S +STLYYVHKRPHCDLFLSKVSKWYDL++FTASM+EYADPVIDWLE SF+G
Sbjct: 182 MVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTG 241

Query: 257 RFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWI 316
           +F KRLYR+NC++R+GVGYIKDLS+V   T  L EV+L+DNSP SYA N DNAIQVEGWI
Sbjct: 242 KFCKRLYRHNCVVREGVGYIKDLSVV---TEVLDEVVLIDNSPTSYARNEDNAIQVEGWI 298

Query: 317 XXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
                         LEALRY TDVR IL LKN E+A 
Sbjct: 299 SDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKAL 335

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  336 bits (861), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 179/334 (53%), Positives = 218/334 (65%), Gaps = 29/334 (8%)

Query: 49  VILFFPQWLIIKPTQXXXXXXXXXXXXXEYGLK--SRLQRKSTKRS------TGTLQSIS 100
           VI F P +LI KP               E G+K  +R + K+ K S         L SI+
Sbjct: 107 VIFFLPTYLIYKPLLLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSIN 166

Query: 101 XXXXXXXXXXXXIFLQRDAVKGSL---------APAKYXXXXXXXXX------XTVMLGT 145
                        +LQRD VKGSL          P K                 + + GT
Sbjct: 167 EEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTVFGT 226

Query: 146 KRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAIS 205
           K+MGRFLFPKKLIP+S+L+ EK+K LV+DLDETLIHS SR T+H NS+QGH+VE++F+IS
Sbjct: 227 KKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSIS 286

Query: 206 GVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRN 265
           GVSTLYYV KRP+CDLFL+KVSKWYD+V+FTASM+EYADPVIDWLE SF+G+FS+RLYRN
Sbjct: 287 GVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRN 346

Query: 266 NCILRDGVGYIKDLSIVC-GPTVT-----LGEVILVDNSPISYAMNVDNAIQVEGWIXXX 319
           +CILRDGVGYIKDL +V  G  +      L +VI+VDNSP+SYA+NVDNAIQVEGWI   
Sbjct: 347 DCILRDGVGYIKDLKMVTRGSNLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEGWINDP 406

Query: 320 XXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
                      LEAL  TTDVR+IL+LKN E+AF
Sbjct: 407 TDTDLLNLIPLLEALENTTDVRNILSLKNGEKAF 440

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  335 bits (860), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 237/376 (63%), Gaps = 42/376 (11%)

Query: 20  TEDVEDKVAVQKREKIVRR--RSKFTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXXXXE 77
            ++ E K+ +  + K +R   + K  S  WA++LF P +L+IKP               E
Sbjct: 68  NQNEERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVFTFPLSVIE 127

Query: 78  YGLK--SRLQRKSTKRSTGT--------------------LQSISXXXXXXXXXXXXIFL 115
             +K   +  ++S+    G+                    L +IS            I L
Sbjct: 128 RRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDDLNASDEIIL 187

Query: 116 QRDAVKGSLAPA-----------KYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLH 164
           QRD VKGSL  A           K             + GTKRMGRFLFPKKLIP+SVL+
Sbjct: 188 QRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLN 247

Query: 165 AEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLS 224
            +K+K+LV+DLDETLIHSASR+T+HSNS+QGH+VE++F ISG+ TLY++HKRP+CDLFL+
Sbjct: 248 TQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYFIHKRPYCDLFLT 307

Query: 225 KVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIV-- 282
           KVSKWY+L++FTASM+EYADPVIDWLE SF   FS+R YR++C+LRDGVGYIKDLSI+  
Sbjct: 308 KVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYIKDLSIIKN 367

Query: 283 -----CGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYT 337
                 G + +L +VI++DNSP+SYAMNVDNAIQVEGWI             FLEA+RY+
Sbjct: 368 SEENEKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYS 427

Query: 338 TDVRDILALKNSEQAF 353
           TDVR+ILALK+ E+AF
Sbjct: 428 TDVRNILALKHGEKAF 443

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  332 bits (850), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 240/385 (62%), Gaps = 34/385 (8%)

Query: 1   MNAVSYISDQLS----------KRDK-----NGKTEDVEDKVAVQKREKIVRRRSKFTSY 45
           MNA+SYI++ ++          K+D+     +G     E        +K   +++   S 
Sbjct: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKNQTKKATKLSL 60

Query: 46  AWAVILFFPQWLIIKPTQXXXXXXXXXXXXXEYGLKSRLQRKSTKR--STGTLQ-----S 98
            W++ILF P + IIKP               E+        ++ +   STG  +     +
Sbjct: 61  LWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSIN 120

Query: 99  ISXXXXXXXXXXXXIFLQRDAVKGSLAPAKYXXXXXXXXXXT----------VMLGTKRM 148
           I             I LQ DAVKGSL+              T            LG++RM
Sbjct: 121 IIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTALGSRRM 180

Query: 149 GRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVS 208
           GRFLFPKKLIP+SVL+ EK+K LV+DLDETLIHS SR TS SNS+QGHMVE++FA+SG+S
Sbjct: 181 GRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGIS 240

Query: 209 TLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCI 268
           +LY+VHKRP+CDLFLSKV+KWY LVVFTASM+EYADPVIDWLE SFSG FS+RLYR +CI
Sbjct: 241 SLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCI 300

Query: 269 LRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXX 328
           LRDGVGYIKDLS++     +L E+I+VDNSPISYAMNVDNAIQVEGWI            
Sbjct: 301 LRDGVGYIKDLSLISKK--SLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLL 358

Query: 329 XFLEALRYTTDVRDILALKNSEQAF 353
             LEALR+TTD+R++L+LK+ EQAF
Sbjct: 359 PLLEALRFTTDIRNVLSLKSGEQAF 383

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  328 bits (842), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 216/349 (61%), Gaps = 32/349 (9%)

Query: 37  RRRSKFTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXXXXEYGLKSRLQRKSTKRSTGT- 95
           + ++  TS  W+ +LFFP+ LIIKP               E G K R++  S  + +   
Sbjct: 96  KTKNNVTSILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPE 155

Query: 96  ------------------LQSISXXXXXXXXXXXXIFLQRDAVKGSLAPAKYXXXXXXXX 137
                             L +I+            I+LQRD VKGSL  A          
Sbjct: 156 KDETLVHNNSFLPEEPSKLDAINELTEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSR 215

Query: 138 XXTVMLG------TKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSN 191
               M+       +KRMG+FLFPKKLIP+S+   E+RK+LV+DLDETLIHS SR T+H+N
Sbjct: 216 SMKTMVSNNTSFSSKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTN 275

Query: 192 SAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLE 251
            +QGH+VE++F+ SGVS LYYVHKRP+CD FLSKV KWYDL++FTASM+EYADPVIDWLE
Sbjct: 276 VSQGHIVEVKFSSSGVSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLE 335

Query: 252 GSFSGRFSKRLYRNNCILRDGVGYIKDLSIV-------CGPTVTLGEVILVDNSPISYAM 304
            SF G F++R YR +CI RDGVGYIKDL+I+          T TL EVI++DNSPISYAM
Sbjct: 336 ASFQGTFTERYYRTDCIRRDGVGYIKDLTIIKDDSNVSVPQTSTLSEVIILDNSPISYAM 395

Query: 305 NVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
           N DNAIQVEGWI              LEALRYTTDVR ILALKN E+AF
Sbjct: 396 NADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGERAF 444

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  325 bits (833), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/419 (43%), Positives = 237/419 (56%), Gaps = 67/419 (15%)

Query: 1   MNAVSYISDQL-------------SKRDKNGKTEDVEDKVA------VQKREKIVRRRSK 41
           MNA+SYIS  L                D    T DV D         + K E ++   ++
Sbjct: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60

Query: 42  FTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXXXXEYGLKSRLQRKSTKRSTGTLQSISX 101
            ++    V+LFFP++L++KP               E   K   +  +   +    ++++ 
Sbjct: 61  RSTLVL-VLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNI 119

Query: 102 XXXXXXXXXXXIFLQRDAVKGSLAPAK------YXXXXXXXXXXTVMLGTKRMGRFLFPK 155
                      I LQRD + GSL  ++      +          +V L +K++GRFLFPK
Sbjct: 120 LVEEDLSGGGEIILQRDTLNGSLLKSRANQQHSHQSRHAKSSSSSVGLISKKIGRFLFPK 179

Query: 156 KLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHK 215
           KLIPRS+LH+ ++K+LV+DLDETLIHS SR+T +SN+AQ H+VE++F ISG+STLYYVHK
Sbjct: 180 KLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHK 239

Query: 216 RPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGY 275
           RP+CDLFLSKV +WYDL++FTASM+EYADPVIDWLE SF G FSKR YRN+CILRDGVGY
Sbjct: 240 RPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGY 299

Query: 276 IKDLSIVCG-----------------------------------------PTVTLGEVIL 294
           IKDLSIV                                               L EVIL
Sbjct: 300 IKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVIL 359

Query: 295 VDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
           +DNSP+SYAMNVDNAIQV+GWI             FLE+LR TTDVR+IL+LKN E+AF
Sbjct: 360 IDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  320 bits (819), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 163/264 (61%), Positives = 193/264 (73%), Gaps = 23/264 (8%)

Query: 113 IFLQRDAVKGSL------------APAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPR 160
           + LQRD VKGSL            A +            +V  GTK+MGRFLFPKKLIPR
Sbjct: 126 MILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGTKKMGRFLFPKKLIPR 185

Query: 161 SVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCD 220
           S+LH+ ++K+LV+DLDETLIHS SR+ S+SN+AQ H+VE++F ISG+STLYYVHKRP+CD
Sbjct: 186 SILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQISGISTLYYVHKRPYCD 245

Query: 221 LFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLS 280
           LFLS VSKWYDL++FTASM+EYADPVIDWLE SF G FSKR YRN+CILRDGVGYIKDLS
Sbjct: 246 LFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLS 305

Query: 281 IVCG-----------PTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXX 329
           I+                 L E+IL+DNSP+SYAMNVDNAIQVEGWI             
Sbjct: 306 IINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLP 365

Query: 330 FLEALRYTTDVRDILALKNSEQAF 353
           FLE+LRYTTDVR+IL+LKN E+AF
Sbjct: 366 FLESLRYTTDVRNILSLKNGERAF 389

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  313 bits (803), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/411 (45%), Positives = 236/411 (57%), Gaps = 59/411 (14%)

Query: 1   MNAVSYISDQLSKRDKNGKT---EDVEDKVAVQ----------KREKIVRRRSKFTSYAW 47
           MNA+SY+++        G +   E++E    V           K +K  + R    ++ W
Sbjct: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60

Query: 48  AVILFFPQWLIIKP--------TQXXXXXXXXXXXXXEYGLKSRLQR----------KST 89
           ++++F P  L++KP        T                G +S LQR           +T
Sbjct: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTT 120

Query: 90  KRSTGTLQSISX-XXXXXXXXXXXIFLQRDAVKGSL------------------------ 124
             S G+   I+             IFLQ D VKGSL                        
Sbjct: 121 SDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGS 180

Query: 125 --APAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHS 182
             +P                LG++RMGRFLFPKKLIP+SVL+  K + LV+DLDETLIHS
Sbjct: 181 RQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHS 240

Query: 183 ASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREY 242
            SR TS SNS+QGHMVE++FAISG+STLY+VHKRP+CDLFL+ ++ WY+LVVFTASM+EY
Sbjct: 241 MSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEY 300

Query: 243 ADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISY 302
           ADPVIDWLE SF G+FS+RLYR +CILRDGVGYIKDLS V  P   L ++ ++DNSP+SY
Sbjct: 301 ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVA-PNTLLSDIFIIDNSPVSY 359

Query: 303 AMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
           AM+VDNAIQVEGWI              LEALR+TTDVR+ILALK+ E AF
Sbjct: 360 AMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAF 410

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  305 bits (780), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 179/211 (84%), Gaps = 1/211 (0%)

Query: 143 LGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRF 202
           LG++RMGRFLFPKKLIP+SVL+  KR+ LV+DLDETLIHS SR TS SNS+QGHMVE++F
Sbjct: 197 LGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKF 256

Query: 203 AISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRL 262
           A SG+STLY+VHKRP+CDLFL+K++KWY+LVVFTASM+EYADPVIDWLE SF G+FS+RL
Sbjct: 257 ATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRL 316

Query: 263 YRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXX 322
           YR +CILRDGVGYIKDLS+V  P  +L ++ ++DNSP+SYAM+VDNAIQVEGWI      
Sbjct: 317 YRQDCILRDGVGYIKDLSVVV-PNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDT 375

Query: 323 XXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
                   LEALR+TTD+R++LALK+ E AF
Sbjct: 376 DLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 10/70 (14%)

Query: 1  MNAVSYISDQL--SKRDKNGKT----EDVED---KVAVQKREKIVRRRSKFTSYAWAVIL 51
          MNA+SY+++ +   K +++  T    ED E    ++ V  +E   R+R+++T   W+++ 
Sbjct: 1  MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQKRKRARWT-LLWSMLA 59

Query: 52 FFPQWLIIKP 61
          F P  +++KP
Sbjct: 60 FLPNLIVVKP 69

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  290 bits (741), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 168/225 (74%), Gaps = 13/225 (5%)

Query: 142 MLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIR 201
            +G+K MGRFLFPKKLIP S+L   KRK+L++DLDETLIHS SR  S S  +  H++E++
Sbjct: 166 FIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIEVK 225

Query: 202 FAIS------------GVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDW 249
           F                +S+LYYV+KRP+CD FL+ VS WYDL++FTASM+EYADPVIDW
Sbjct: 226 FPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDW 285

Query: 250 LEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIV-CGPTVTLGEVILVDNSPISYAMNVDN 308
           LE SF+G F KRLYRN+CILRDG+GYIKDLS++      TL E+IL+DNSPIS+AMNVDN
Sbjct: 286 LEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDN 345

Query: 309 AIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNSEQAF 353
           AIQV+GWI             FLE+LR+TTDVR+ILALKN E+AF
Sbjct: 346 AIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAF 390

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  283 bits (725), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 167/365 (45%), Positives = 226/365 (61%), Gaps = 33/365 (9%)

Query: 1   MNAVSYISD--QLSKRDKNGKTEDVEDKVAVQKREK--IVRRRSKFTSYAWAVILFFPQW 56
           MN++SY++   Q +    +G+    E  +A  + E+           ++ W V+ F P+W
Sbjct: 1   MNSLSYLTGATQHAAGKGDGRWPGSERGLAKVREEQDAARAGVGAGAAWVWRVLFFLPKW 60

Query: 57  LIIKPTQXXXXXXXXXXXXXEYGLKSRLQRKSTKRSTGT-------LQSISXXXXXXXXX 109
           L++KP                    S +++ S+K + G         + ++         
Sbjct: 61  LVVKPVVLVWFVLTFPL--------SLIEQTSSKEADGAPGPEAAEEEQLAEAVEDDDLA 112

Query: 110 XXXIFLQRDAVKGSLAPAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRK 169
              + LQ D+VK S                     + R+G+FLFPKKLIP+S+L  +++K
Sbjct: 113 GESMVLQEDSVKSSRP-----------STSRSSYTSTRLGKFLFPKKLIPQSILQTDRKK 161

Query: 170 RLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKW 229
            LV+DLDETLIHS SR+TS  +++QGHMVE+ FA SGVSTLYYVHKRP+CDLFLS+VSKW
Sbjct: 162 LLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKW 221

Query: 230 YDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTL 289
           YDLV+FTASM+EYADPVIDWLE   S RFS+R YR++C+LRDGVGY+KDLSI+   +  L
Sbjct: 222 YDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSII---SKNL 278

Query: 290 GEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKNS 349
            ++I+VDNSPISYAMNVDNAIQVEGWI              LE LR+TTD R+IL+LKN 
Sbjct: 279 QDIIIVDNSPISYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNG 338

Query: 350 EQAFL 354
           E+AF+
Sbjct: 339 ERAFI 343

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  283 bits (723), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 164/366 (44%), Positives = 221/366 (60%), Gaps = 26/366 (7%)

Query: 1   MNAVSYISDQLSKRDKNGKTE-----------DVEDKVAVQKREKIVRRRSKFTSYAWAV 49
           MN++SY++   S+   + K E           +V ++  V+  E     +    S+ W V
Sbjct: 1   MNSLSYLTGS-SQPTSSSKEELRFPFSESSLPNVTEEQEVENGEVSQDSKGGRPSWVWRV 59

Query: 50  ILFFPQWLIIKPTQXXXXXXXXXXXXXEYGLKSRLQRKSTKRSTGTLQSISXXXXXXXXX 109
           + F P WLIIKP               E+          T    G+++            
Sbjct: 60  VFFLPTWLIIKPIWLIWFVLTFPLNLIEH----------TSSKDGSVEEEEVIPTNSQGS 109

Query: 110 XXXIFLQRDAVKG-SLAPAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKR 168
                ++ D + G S+   +                + R+G+FLFPKKLIP+S+L  +++
Sbjct: 110 GGGEVIEDDDLVGESMVLHEDSIKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRK 169

Query: 169 KRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSK 228
           K LV+DLDETLIHS SR+TS SN++QGHMVE+ F++SGVS+LYYVHKRP+CDLFLS+V K
Sbjct: 170 KVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCK 229

Query: 229 WYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVT 288
           WYDLV+FTASMREYADPVIDWLE   S RF+KR YR++CILRDG+GY+KDL+++   +  
Sbjct: 230 WYDLVIFTASMREYADPVIDWLESGISARFTKRKYRSDCILRDGIGYVKDLTMI---SKN 286

Query: 289 LGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTTDVRDILALKN 348
           L + I+VDNSP+SYAMNVDNAIQVEGWI              LE LR+TTD R+IL+LKN
Sbjct: 287 LQDTIIVDNSPVSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKN 346

Query: 349 SEQAFL 354
            E AF+
Sbjct: 347 GEHAFV 352

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  227 bits (579), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 129/323 (39%), Positives = 180/323 (55%), Gaps = 29/323 (8%)

Query: 37  RRRSKFTSYAWAVILFFPQWLIIKPTQXXXXXXXXXXXXXEYGLKSRLQRKSTKRSTGTL 96
           +R   F  + W +++F P +L+IKP                + L   L   +T+ + G +
Sbjct: 61  KRNRPFMRWIWCILIFLPNYLLIKPI-------ITIWYVITFPLN--LMETNTQGNKGLI 111

Query: 97  QSISXXXXXXXXXXXXIFLQRDAVKGSLAPAKYXXXXXXXXXXTVMLGTKRMGRFLFPKK 156
           Q  S              L +  V+  L+P               +  T+ +G+F FPKK
Sbjct: 112 QVGSETDSRTEK------LSKYVVEEDLSPTDEIIINQDKMKPRPI--TEYLGKFHFPKK 163

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQG---------HMVEIRFAISGV 207
           L+P+S+L +  RK LV+DLDETLIHS S + S  N             H+VE+RF  + +
Sbjct: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNI 223

Query: 208 STLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNC 267
           STLY V KRP+CD+FL + S+WYD+ +FTASM+EYADPVIDWL+ + S +F  R YR +C
Sbjct: 224 STLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDC 283

Query: 268 ILRDGVGYIKDLSIVCGPTVT---LGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXX 324
            LR GVGY+KD+  V     T   L ++I++DNSPISYAM++DNAIQV GWI        
Sbjct: 284 TLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEL 343

Query: 325 XXXXXFLEALRYTTDVRDILALK 347
                 L+A+R+ TD R ILALK
Sbjct: 344 LHLLPLLKAMRHVTDSRCILALK 366

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 99.8 bits (247), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 98/181 (54%), Gaps = 14/181 (7%)

Query: 166 EKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSK 225
           E +K LV+DLDETL+HS+ +    ++      VEI   +  V    YV KRP  D FL +
Sbjct: 227 EGKKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKRPGVDEFLER 280

Query: 226 VSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGP 285
           V K Y++VVFTAS+  Y DP++D L+    G    RL+R++C   DG  YIK+LS +  P
Sbjct: 281 VGKLYEVVVFTASVSRYGDPLLDILDP--RGAVHHRLFRDSCYNYDG-NYIKNLSQIGRP 337

Query: 286 TVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL--RYTTDVRDI 343
              L ++I++DNSP SY ++  +AI +  W               LE L  +   DV  I
Sbjct: 338 ---LSDLIILDNSPASYILHPQHAIPISSWFSDAHDNELLDIMPLLEDLSKQKVPDVGKI 394

Query: 344 L 344
           L
Sbjct: 395 L 395

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 99.8 bits (247), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 98/161 (60%), Gaps = 14/161 (8%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHM-VEIRFAISGVSTLYYVHK 215
           L+P  +   +++K L++DLDETL+HS+ +   + +SA   + VEI   +  V    YV K
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFK---YMHSADFVLPVEIDDQVHNV----YVIK 268

Query: 216 RPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGY 275
           RP  D FL++VS+ Y++VVFTAS+  YA+P++D L+   +G    RL+R  C   +G  Y
Sbjct: 269 RPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NY 325

Query: 276 IKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWI 316
           IK+LS +  P   L E I++DNSP SY  +  +A+ +  W 
Sbjct: 326 IKNLSQIGRP---LSETIILDNSPASYIFHPQHAVPISSWF 363

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 94/159 (59%), Gaps = 12/159 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P  +   +++K L++DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +VS+ Y++VVFTAS+  YA+P++D L+   +G    RL+R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 321

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L E I++DNSP SY  +  +A+ +  W
Sbjct: 322 KNLSQIGRP---LSETIILDNSPASYIFHPQHAVPISSW 357

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 96/164 (58%), Gaps = 17/164 (10%)

Query: 152 LFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLY 211
           L P KL+P      +++K L++DLDETL+HS+ +    ++      VEI   +  V    
Sbjct: 204 LLPPKLLP-----FQQKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV---- 252

Query: 212 YVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRD 271
           YV KRP  D FL +VS+ Y++VVFTAS+  YA+P++D L+ + +     RL+R  C   +
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRT--IHHRLFREACYNYE 310

Query: 272 GVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           G  YIK+LS +  P   L E I++DNSP SY  +  +A+ +  W
Sbjct: 311 G-NYIKNLSQIGRP---LSETIILDNSPASYIFHPQHAVPISSW 350

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 97/178 (54%), Gaps = 12/178 (6%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P  +   +++K L++DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYMHTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FLS+V + Y++VVFTAS+  YA+P++D L+   +G    RL+R  C   +G  YI
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 321

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL 334
           K+LS +  P   L E I++DNSP SY  +  +A+ +  W               LE L
Sbjct: 322 KNLSQIGRP---LSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDL 376

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 98.2 bits (243), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 101/192 (52%), Gaps = 14/192 (7%)

Query: 155 KKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVH 214
           + L+P        +K LV+DLDETL+HS+ +    ++      V+I   I  V    YV 
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYLHTADFVLP--VDIDDQIHNV----YVI 261

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL +V++ Y++VVFTAS+  Y DP++D L+ S S     RL+R  C   +G  
Sbjct: 262 KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNS--IHHRLFREACYNYEG-N 318

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL 334
           Y+K+L+ +  P   L E++++DNSP SY  +  +AI +  W               LE L
Sbjct: 319 YVKNLAQIGRP---LSEIVILDNSPASYMFHPQHAIPISSWFSDTHDNELLDIIPLLEDL 375

Query: 335 --RYTTDVRDIL 344
             +Y  DV  IL
Sbjct: 376 SQKYVPDVGKIL 387

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 88/150 (58%), Gaps = 12/150 (8%)

Query: 166 EKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSK 225
           + +K LV+DLDETL+HS+ +    ++        +   I   +   YV KRP  D FL +
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFV------LPVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 226 VSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGP 285
           V K +++VVFTAS+  Y DP++D L+ S S     RL+R +C + DG  Y+K+LS +  P
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDSSKS--IHHRLFRESCYIYDG-NYVKNLSQIGRP 415

Query: 286 TVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
              L ++I++DNSP SY  +  +AI +  W
Sbjct: 416 ---LSDIIILDNSPASYIFHPQHAIPISSW 442

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 95.5 bits (236), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 104/202 (51%), Gaps = 16/202 (7%)

Query: 147 RMGRFLFP--KKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAI 204
           + G++  P  K L+P    + + +K L++DLDETL+HS+ +    ++      VEI   +
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQV 278

Query: 205 SGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYR 264
             V    YV KRP  + FL +V K +++VVFTAS+  Y DP++D L+         RL+R
Sbjct: 279 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDA--DKVIHHRLFR 332

Query: 265 NNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXX 324
             C   +G  YIK+LS +  P   L ++I++DNSP SY  +  +AI +  W         
Sbjct: 333 EACYNYEG-NYIKNLSQIGRP---LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNEL 388

Query: 325 XXXXXFLEALRYTT--DVRDIL 344
                 LE L   T  DV  IL
Sbjct: 389 LDIIPLLEDLSVKTSLDVGKIL 410

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 94.4 bits (233), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 100/178 (56%), Gaps = 13/178 (7%)

Query: 140 TVMLGTKRMGRFLFP--KKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHM 197
           T+   + +  +F  P    L+P      + RK LV+DLDETL+HS+ +  S ++      
Sbjct: 149 TISYSSLQKNQFHAPGCNTLLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTADFVLP-- 206

Query: 198 VEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGR 257
           V+I      V    YV KRP  D FL   SK +++V+FTAS+ +Y +P++D L+ + +  
Sbjct: 207 VDIDDQFQNV----YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDST-NDL 261

Query: 258 FSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
              RL+R+ C   +G  YIK+L+ +  P   L ++I++DNSP SY  + ++AI +  W
Sbjct: 262 VHHRLFRDACYNYNG-NYIKNLAQLGRP---LSDIIILDNSPTSYLFHPNHAIPISSW 315

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 95.5 bits (236), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 89/159 (55%), Gaps = 11/159 (6%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L P+  +  + +K LV+DLDETL+HS+ +     N+     V I   I  V    YV KR
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLP--NADFNLPVNIDDQIHNV----YVIKR 385

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL KV K +++V+FTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 386 PGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK-GKSIHHRLFREACYNYEG-NYI 443

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L E+I++DNSP SY  +  +AI +  W
Sbjct: 444 KNLSQMGRP---LSEIIILDNSPASYIFHPQHAIPISSW 479

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 95.1 bits (235), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 89/159 (55%), Gaps = 12/159 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P    H   +K LV+DLDETL+HS+ +    ++      V+I   I  V    YV KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGADFVL--PVDIDDQIHNV----YVMKR 354

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL KV   +++V+FTAS+  Y DP++D L+   S     RL+R  C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHKS--VHHRLFREACYNYEG-NYI 411

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L E+I++DNSP SY  +  +AI +  W
Sbjct: 412 KNLSQIGRP---LSEIIILDNSPASYIFHPQHAIPISSW 447

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 92/159 (57%), Gaps = 11/159 (6%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L P+ +    ++K L++DLDETL+HS+ +    ++        I   I   +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSADFV------IPVTIDNQTHHVYVIKR 365

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +VS+ Y++VVFTAS+  Y DP+++ L+ + +     RL+R +C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPA-NTIIHHRLFRESCYTYEG-NYV 423

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L E+I++DNSP SY  +  +AI +  W
Sbjct: 424 KNLSQLGRP---LNEIIILDNSPASYIFHPQHAIPISSW 459

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 168 RKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVS 227
           +K LV+DLDETL+HS+ +    ++      V+I   I  V    YV KRP  D FL +V 
Sbjct: 277 KKCLVLDLDETLVHSSFKYLHTADFVLP--VDIDDQIHNV----YVIKRPGVDEFLQRVG 330

Query: 228 KWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTV 287
           + Y++VVFTAS+  Y DP++D L+   S     RL+R+ C   +G  YIK+LS +  P  
Sbjct: 331 ELYEVVVFTASVSRYGDPLLDVLDK--SNNIHHRLFRDACYTYEG-NYIKNLSQIGRP-- 385

Query: 288 TLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL 334
            L E+I++DNSP SY  +  +AI +  W               LE L
Sbjct: 386 -LSEIIILDNSPPSYIFHPQHAIPISSWFSDSHDNELLDILPLLEDL 431

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 88/159 (55%), Gaps = 12/159 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P        RK LV+DLDETL+HS+ +    ++      V+I   I  V    YV KR
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 353

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +V K Y++VVFTAS+  Y DP++D L+   S     RL+R  C   +G  YI
Sbjct: 354 PGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKS--IHHRLFREACYNYEG-NYI 410

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L  +I++DNSP SY  +  +AI +  W
Sbjct: 411 KNLSQIGRP---LSNIIILDNSPASYIFHPQHAIPISSW 446

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 96/180 (53%), Gaps = 14/180 (7%)

Query: 167 KRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKV 226
            +K LV+DLDETL+HS+ +    ++      VEI   I  V    YV KRP  D FL +V
Sbjct: 227 NKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVIKRPGVDEFLKRV 280

Query: 227 SKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPT 286
            + Y++VVFTAS+  Y DP+++ L+ S S     RL+R  C   +G  YIK+L+ +  P 
Sbjct: 281 GELYEVVVFTASVSRYGDPLLNILDQSNS--VHHRLFREACYNYEG-NYIKNLAQIGRP- 336

Query: 287 VTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRYTT--DVRDIL 344
             L ++I++DNSP SY  +  +AI +  W               LE L + +  DV  IL
Sbjct: 337 --LSDIIILDNSPASYMFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSHDSVLDVGKIL 394

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 94/159 (59%), Gaps = 10/159 (6%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P      + +K L++DLDETL+HS+ +  ++ +     ++ I      +  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPD----FILPIEIEDGQIHNVYVI-KR 355

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +V KWY++V+FTAS+  YA+P++D L+   +   + RL+R+ C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHN-LINHRLFRDACYNYEN-NFI 413

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L ++I++DNSP SY  +  +AI +  W
Sbjct: 414 KNLSQIGRP---LHDIIILDNSPASYIFHPQHAIPISSW 449

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 92/178 (51%), Gaps = 12/178 (6%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P      + +K LV+DLDETL+HS+ +    ++      V I   +  V    YV KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLP--VNIDDQVHNV----YVIKR 282

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +V + Y++VVFTAS+  Y DP++D L+   S     RL+R  C   +G  YI
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKS--IHHRLFREACYNYEG-NYI 339

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL 334
           K+LS +  P   L E+I++DNSP SY  +  +AI V  W               LE L
Sbjct: 340 KNLSQIGRP---LSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNELIDIVPLLEDL 394

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 102/202 (50%), Gaps = 16/202 (7%)

Query: 147 RMGRFLFP--KKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAI 204
           + G++  P    L+P      + +K L++DLDETL+HS+ +    ++      VEI   +
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQV 291

Query: 205 SGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYR 264
             V    YV KRP  + FL +V K +++VVFTAS+  Y DP++D L+         RL+R
Sbjct: 292 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--DKVIHHRLFR 345

Query: 265 NNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXX 324
             C   +G  YIK+LS +  P   L ++I++DNSP SY  +  +AI +  W         
Sbjct: 346 EACYNYEG-NYIKNLSQIGRP---LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNEL 401

Query: 325 XXXXXFLEALRYTT--DVRDIL 344
                 LE L   T  DV  IL
Sbjct: 402 LDIIPLLEDLSVKTSLDVGKIL 423

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 91.7 bits (226), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 97/190 (51%), Gaps = 14/190 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P      + +K L++DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  + FL +V K +++VVFTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--DKVIHHRLFREACYNYEG-NYI 344

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRY 336
           K+LS +  P   L E+I++DNSP SY  +  +AI +  W               LE L  
Sbjct: 345 KNLSQIGRP---LSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSV 401

Query: 337 TT--DVRDIL 344
            T  DV  IL
Sbjct: 402 KTSLDVGKIL 411

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 92/161 (57%), Gaps = 12/161 (7%)

Query: 155 KKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVH 214
           + L+P       +RK LV+DLDETL+HS+ +    ++      VEI   +  V    YV 
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFKYLHTADFVI--PVEIDNQVHNV----YVI 362

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL +V + Y++VVFTAS+  Y DP++D L+         RL+R++C   +G  
Sbjct: 363 KRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDK--HNVVHHRLFRDSCYNYEG-N 419

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           YIK+LS +  P   L ++I++DNSP SY  +  +AI +  W
Sbjct: 420 YIKNLSQIGRP---LSDLIILDNSPASYIFHPHHAIPISSW 457

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 91.7 bits (226), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 87/148 (58%), Gaps = 12/148 (8%)

Query: 168 RKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVS 227
           +K LV+DLDETL+HS+ +    ++      VEI   I  V    YV KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIKRPGVDEFLKLVG 293

Query: 228 KWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTV 287
           + Y++VVFTAS+  Y DP++D L+ +       RL+R++C   DG  YIK+LS +  P  
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQTQC--IHHRLFRDSCYNYDG-NYIKNLSQIGRP-- 348

Query: 288 TLGEVILVDNSPISYAMNVDNAIQVEGW 315
            L ++I++DNSP SY  +  +AI +  W
Sbjct: 349 -LSDLIILDNSPASYIFHPQHAIPISSW 375

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 91.7 bits (226), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 90/159 (56%), Gaps = 12/159 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P        +K LV+DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVI--PVEIDNQVHNV----YVIKR 281

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL  V + Y++VVFTAS+  Y DP++D L+ +       RL+R++C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHC--IHHRLFRDSCYNYDG-NYI 338

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L ++I++DNSP SY  +  +AI +  W
Sbjct: 339 KNLSQIGRP---LSDLIILDNSPASYIFHPQHAIPISSW 374

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 91.7 bits (226), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 98/190 (51%), Gaps = 14/190 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P      + +K L++DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  + FL +V K +++VVFTAS+  Y DP++D L+   +     RL+R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--NKVIHHRLFREACYNYEG-NYI 344

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEALRY 336
           K+LS +  P   L ++I++DNSP SY  +  +AI +  W               LE L  
Sbjct: 345 KNLSQIGRP---LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSV 401

Query: 337 TT--DVRDIL 344
            T  DV  IL
Sbjct: 402 KTSLDVGKIL 411

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 113/236 (47%), Gaps = 15/236 (6%)

Query: 113 IFLQRDAVKGSLAPAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLV 172
           I +  D ++    P               +L  ++     F   L P++ + + K K L+
Sbjct: 464 IMIDSDTIEDEFNPYLDETQQQQQFVDLTVLQPQQYHAMGFNTLLPPQNQIFSGK-KCLI 522

Query: 173 VDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDL 232
           +DLDETL+HS+ +  + ++      V+I   I  V    YV KRP  D FL  VSK +++
Sbjct: 523 LDLDETLVHSSFKYLTSADFVIP--VDIDEQIHNV----YVIKRPGVDQFLETVSKIFEV 576

Query: 233 VVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEV 292
           VVFTAS+  Y DP++D L+         RL+R  C   +G  YIK+LS +  P   L E+
Sbjct: 577 VVFTASVSRYGDPLLDVLDKHRC--IHHRLFREACYDYEG-NYIKNLSQIGRP---LSEL 630

Query: 293 ILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL--RYTTDVRDILAL 346
           I++DNSP SY  +  +AI +  W               L+ L      D+R+IL +
Sbjct: 631 IILDNSPASYIFHPQHAIPISSWFSDTHDNELLDILPLLQDLAEENIPDIRNILNV 686

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 104/190 (54%), Gaps = 15/190 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P++ +  + +K LV+DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 234 LLPKADMF-KGKKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKR 286

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL ++++ Y++VVFTAS+  Y DP++D L+   +     RL+R++C   +G  YI
Sbjct: 287 PGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKT--IHHRLFRDSCYNYEG-NYI 343

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL-- 334
           K+LS +  P   L ++I++DNSP SY  +  +AI +  W               LE L  
Sbjct: 344 KNLSQIGRP---LSDMIILDNSPASYIFHPQHAIPISSWFSDAHDNELLDIIPLLEDLAE 400

Query: 335 RYTTDVRDIL 344
               DV +IL
Sbjct: 401 ERVPDVGEIL 410

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 90/160 (56%), Gaps = 12/160 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P       ++K LV+DLDETL+HS+ +    ++      V+I   I  V    YV KR
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 355

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +V + +++VVFTAS+  Y DP++D L+   S     RL+R  C   +G  YI
Sbjct: 356 PGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKS--IHHRLFREACYNYEG-NYI 412

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWI 316
           K+LS +  P   L ++I++DNSP SY  +  +AI +  W 
Sbjct: 413 KNLSQLGRP---LSDIIILDNSPASYIFHPQHAIPISSWF 449

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 89/149 (59%), Gaps = 14/149 (9%)

Query: 168 RKRLVVDLDETLIHSASRTTSHSNSAQGHM-VEIRFAISGVSTLYYVHKRPHCDLFLSKV 226
           RK LV+DLDETL+HS+ +   + N A   + V+I   +  V    YV KRP  D FL  V
Sbjct: 282 RKCLVLDLDETLVHSSFK---YLNIADFVLPVDIDNQVQNV----YVSKRPGVDEFLKIV 334

Query: 227 SKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPT 286
              Y+++VFTAS+  Y +P++D L+         RL+R++C + +G  Y+K+LS +  P 
Sbjct: 335 GDLYEVIVFTASVSRYGNPLMDILDP--HKYIHHRLFRDSCYVYEG-NYVKNLSQIGRP- 390

Query: 287 VTLGEVILVDNSPISYAMNVDNAIQVEGW 315
             LG++I++DNSP SY  +  +AI +  W
Sbjct: 391 --LGDIIILDNSPASYIFHPQHAIPISSW 417

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 89/159 (55%), Gaps = 12/159 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P        +K LV+DLDETL+HS+ +    ++      V+I   I  V    YV KR
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFKYLRTADFVL--PVDIDDQIHNV----YVIKR 325

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +V   Y++VVFTAS+  Y DP++D L+   +     RL+R +C   +G  YI
Sbjct: 326 PGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKT--IHHRLFRESCYNYEG-NYI 382

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           K+LS +  P   L ++I++DNSP SY  +  +AI +  W
Sbjct: 383 KNLSQIGRP---LSDIIILDNSPASYIFHPQHAIPISSW 418

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 99/190 (52%), Gaps = 14/190 (7%)

Query: 157 LIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKR 216
           L+P        RK LV+DLDETL+HS+ +    ++      VEI   +  V    YV KR
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFKYLHTADFVI--PVEIDNQVHNV----YVIKR 350

Query: 217 PHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYI 276
           P  D FL +V + +++VVFTAS+  Y DP++D L+   +     RL+R++C   +G  YI
Sbjct: 351 PGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKA--VHHRLFRDSCYNYEG-NYI 407

Query: 277 KDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL-- 334
           K+LS +  P   L ++I++DNSP SY  +  +A+ +  W               LE L  
Sbjct: 408 KNLSQIGRP---LSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNELLDILPLLEDLSS 464

Query: 335 RYTTDVRDIL 344
           R   DV  IL
Sbjct: 465 RKVPDVARIL 474

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%), Gaps = 15/150 (10%)

Query: 168 RKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVS 227
           +K LV+DLDETL+HS+ +    ++      V I   I  V    YV KRP  + FL +V 
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQTADFVLP--VNIDEQIHNV----YVIKRPGVEEFLKRVG 355

Query: 228 KWYDLVVFTASMREYADPVIDWLEGSFSGR--FSKRLYRNNCILRDGVGYIKDLSIVCGP 285
           + +++VVFTAS+  Y DP++D L+    GR     RL+R  C   +G  YIK+LS +  P
Sbjct: 356 ELFEVVVFTASVARYGDPLLDILD---PGRQLIHHRLFREACYNYEG-NYIKNLSQMGRP 411

Query: 286 TVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
              L E+I++DNSP SY  +  +AI +  W
Sbjct: 412 ---LSEIIILDNSPASYIFHPQHAIPISSW 438

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP CD FL  +S++Y++V+F+++   YA+ + + L+       S  L++ +C+ +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 265

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKD+S +      LG+V+ +D  P +Y +  +NAI ++ W              FLE  
Sbjct: 266 HIKDISKL---NRDLGKVVTIDTDPNTYKLQPENAIPMDPWT-GEADDKLLRLIPFLEYL 321

Query: 333 ALRYTTDVRDIL 344
           A +   DVR IL
Sbjct: 322 ATQQVNDVRPIL 333

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y+D + + L+       S  L++ +C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      L +VI++D  P SY +  +NAI +E W              FLE  
Sbjct: 275 HIKDLSKL---NRDLSKVIIIDTDPNSYKLQPENAIPMEPW-NGEADDKLVRLIPFLEYL 330

Query: 333 ALRYTTDVRDIL 344
           A + T DVR IL
Sbjct: 331 ATQQTKDVRPIL 342

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   YA+ V + ++       +  LY+ +C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV- 273

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      LG+ +++D  P SY +  +NAI V+ W              FLE  
Sbjct: 274 HIKDLSKL---NRDLGKTMIIDTDPNSYKLQPENAIPVKPW-EGTADDGLLKLIPFLEYL 329

Query: 333 ALRYTTDVRDIL 344
           A +  +DVR IL
Sbjct: 330 ATQQVSDVRPIL 341

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S+++++V+F+++   Y+D + + L+       S  L++ +C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      L +VI++D  P SY +  +NAI ++ W              FLE  
Sbjct: 275 HIKDLSKL---NRDLSKVIIIDTEPNSYKLQPENAIPMDPW-NGEADDKLVRLIPFLEYL 330

Query: 333 ALRYTTDVRDIL 344
           A + T DVR IL
Sbjct: 331 ATQQTKDVRPIL 342

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y++ + + L+       S  LY+ +C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLD-PIHAFISYNLYKEHCVYKEG-D 283

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      LG+VI+VD  P SY +  +NAI ++ W              FLE  
Sbjct: 284 HIKDLSKL---NRDLGKVIIVDTDPASYKLQPENAIPMQPW-DGKADDKLMRLIPFLEYL 339

Query: 333 ALRYTTDVRDIL 344
           A +  +DVR IL
Sbjct: 340 ATQQVSDVRPIL 351

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 72/133 (54%), Gaps = 8/133 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP CD FL  +S++Y++V+F+++   Y+D + + L+       S  L++ +C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKD+S +      +G+V+++D  P  Y    +NAI  + W              FLE  
Sbjct: 279 HIKDISKM---NRDVGKVVMIDTDPNCYKSQPENAIPAKPW-DGTPDDGLLQLIPFLEYL 334

Query: 333 ALRYTTDVRDILA 345
           A +   DVR IL+
Sbjct: 335 ATQQVNDVRPILS 347

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S+++++V+F+++   Y++ + + L+       S  L++ +C+ +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 279

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      L +VI++D  P SY +  +NAI +E W              FLE  
Sbjct: 280 HIKDLSKL---NRDLSKVIIIDTDPNSYKLQPENAIPMEPW-NGEADDKLVRLIPFLEYL 335

Query: 333 ALRYTTDVRDIL 344
           A + T DVR IL
Sbjct: 336 ATQQTKDVRPIL 347

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 73/132 (55%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y+D V + L+       +  L++ +C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      LG+ +++D  P +Y +  +NAI ++ W              FLE  
Sbjct: 270 HIKDLSKL---NRDLGKTVIIDCDPNAYKLQPENAIPMKPW-DGKADDGLLKLIPFLEYL 325

Query: 333 ALRYTTDVRDIL 344
           A + T DVR +L
Sbjct: 326 ATQQTEDVRPVL 337

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 61/101 (60%), Gaps = 5/101 (4%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y+D V + L+       +  L++ +C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           +IKDLS +      LG+ I+VD  P +Y +  +NAI +  W
Sbjct: 271 HIKDLSKL---NRDLGKTIIVDCDPNAYKLQPENAIPMRPW 308

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  + FL  +S++Y++V+F+++   Y++   + L+       S  L++ +C+ +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLD-PIHAFVSYNLFKEHCVYKDGV- 277

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      L +VI++D  P SY +  +NAI ++ W              FLE  
Sbjct: 278 HIKDLSKL---KRDLSKVIIIDTDPNSYKLQPENAIPMDPW-NGEADDKLVRLIPFLEYL 333

Query: 333 ALRYTTDVRDIL 344
           A + T DVR IL
Sbjct: 334 ATQQTKDVRPIL 345

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 72/132 (54%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y + + + L+       S  L++ +C+ +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV- 285

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      + +V+++D  P +Y +  +NAI V+ W              FLE  
Sbjct: 286 HIKDLSKL---NRDVNKVLIIDTEPNNYKLQPENAIPVKPW-DGKADDELLRLIPFLEYL 341

Query: 333 ALRYTTDVRDIL 344
           A + T DV+ IL
Sbjct: 342 ATQQTEDVKPIL 353

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 78/145 (53%), Gaps = 12/145 (8%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   YA+ + + L+       +  L++ +C+ +DGV 
Sbjct: 220 KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYKDGV- 277

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      LG+V+++D    S+ +  +NAI +E W              FLE  
Sbjct: 278 HIKDLSKL---NRDLGKVLIIDTDENSFKLQPENAIYLEPW-DGKADDRLLRLIPFLEYL 333

Query: 333 ALRYTTDVRDILAL----KNSEQAF 353
           A +  +DVR IL      KN  +AF
Sbjct: 334 ATQQVSDVRPILKSFPDNKNIPEAF 358

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 61/101 (60%), Gaps = 5/101 (4%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y + + + L+       S  L++ +C+ +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV- 293

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           +IKDLS +      + +V+++D  P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKL---NRDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 71/132 (53%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   YA+ + + ++       S  L++ +C+ +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV- 280

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +      L +V+++D    SY +  +NAI ++ W              FLE  
Sbjct: 281 HIKDLSKL---NRDLKKVMIIDTDENSYKLQPENAIPMDPW-DGKADDKLLRLIPFLEYM 336

Query: 333 ALRYTTDVRDIL 344
           A +   DVR IL
Sbjct: 337 ATQQVEDVRPIL 348

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 73/133 (54%), Gaps = 8/133 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y+D + + L+       S  L++ +C+ +DGV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV- 278

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLE-- 332
           +IKDLS +        +V+++D  P SY +  +NAI ++ W              FLE  
Sbjct: 279 HIKDLSKL---NRDEKKVLIIDVDPNSYKLQPENAIPMKPW-DGQMDDKLIRLIPFLEYL 334

Query: 333 ALRYTTDVRDILA 345
           A +  +DVR +L+
Sbjct: 335 ATQQVSDVRPVLS 347

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 71/132 (53%), Gaps = 8/132 (6%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   +++ + + L+       +  L++ +C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIXXXXXXXXXXXXXFLEAL 334
           +IKDLS +      LG+ I++D    ++ +  +NAI  E W              FLE L
Sbjct: 285 HIKDLSHL---NRDLGKTIIIDTDANAFKLQPENAIHAEPW-DGKADHELLTYIPFLEYL 340

Query: 335 --RYTTDVRDIL 344
             + T D+R IL
Sbjct: 341 VTQPTEDIRPIL 352

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y++ + + L+       S  LY+ +C+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT- 274

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           +IKDLS +      L +V+++D  P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKL---NRDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 57/100 (57%), Gaps = 5/100 (5%)

Query: 216 RPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGY 275
           RP  D  L  +S +Y+ V+F ++   Y+  V++ L+       +  L++++C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLD-PIRAFITYNLFKDHCVYKDGI-H 274

Query: 276 IKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           IKDLS +      LG+ +++D  P S  + ++NAI  E W
Sbjct: 275 IKDLSHL---NRDLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 59/101 (58%), Gaps = 5/101 (4%)

Query: 215 KRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVG 274
           KRP  D FL  +S++Y++V+F+++   Y++ + + L+       S  L++ +C+ + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-K 248

Query: 275 YIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
           +IKDLS +      + +VI++D    +Y +  +NAI ++ W
Sbjct: 249 HIKDLSKL---NRDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 61/107 (57%), Gaps = 5/107 (4%)

Query: 209 TLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCI 268
           T +   KRP  D FL  +S++Y++V+F+++   Y++ + + L+       S  L++ +C+
Sbjct: 205 TGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCV 263

Query: 269 LRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYAMNVDNAIQVEGW 315
            +D V +IKDLS +      + +V+++D    SY +  +NA+ +  W
Sbjct: 264 YKDHV-HIKDLSKL---NRDVRKVVIMDTDANSYKLQPENALPMAPW 306

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 22/106 (20%)

Query: 160 RSVLHAEKRKRLVVDLDETLIHSASRTT--SHSNSAQGHMVEI-----RFAISGVSTL-- 210
           R+ L  EK+  LVVDLD+T+IH     T     N  +    E      +F++     L  
Sbjct: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219

Query: 211 -------------YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYA 243
                        YYV  RP    FL K++  +++ ++T + R YA
Sbjct: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYA 265

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 68/183 (37%), Gaps = 40/183 (21%)

Query: 116 QRDAVKGSLAPAKYXXXXXXXXXXTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDL 175
           +RD V  +L  +               +G     R +  KKLI            LVVDL
Sbjct: 127 ERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLI------------LVVDL 174

Query: 176 DETLIHSASRTT------SHSNSAQGHMVEIR-FAISGVSTL---------------YYV 213
           D+T+IH     T        SN     +  ++ F +   + L               YYV
Sbjct: 175 DQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYV 234

Query: 214 HKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGV 273
             RP    F  KV+  Y++ ++T + R YA+ +   ++   S      L+ N  + RD  
Sbjct: 235 KVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS------LFGNRILSRDEN 288

Query: 274 GYI 276
           G +
Sbjct: 289 GSL 291

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 163 LHAEKRKRLVVDLDETLIHSASRTT------SHSNSAQGHMVEIR-FAISGVSTL----- 210
           L  EK+  LVVDLD+T+IH     T        SN     + +++ F++     L     
Sbjct: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221

Query: 211 ----------YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYA 243
                     YYV  RP    F  K++  Y++ ++T + R YA
Sbjct: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 22/100 (22%)

Query: 166 EKRKRLVVDLDETLIHSASRTT------SHSNSAQGHMVEIR-FAISGVSTL-------- 210
           EK+  LVVDLD+T+IH     T        +N     + +++ F +     L        
Sbjct: 162 EKKLILVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPK 221

Query: 211 -------YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYA 243
                  YYV  RP    F  +VSK Y++ ++T + R YA
Sbjct: 222 PPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYA 261

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 49/124 (39%), Gaps = 25/124 (20%)

Query: 163 LHAEKRKRLVVDLDETLIHSASRTT------SHSNSAQGHMVEIR-FAISGVSTL----- 210
           L   K+  LVVDLD+T+IH     T        SN     +  ++ F++     L     
Sbjct: 160 LRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYM 219

Query: 211 ----------YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYA---DPVIDWLEGSFSGR 257
                     YYV  RP    F  KV+  ++L ++T + R YA     +ID     F  R
Sbjct: 220 GPRPPPRRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDR 279

Query: 258 FSKR 261
              R
Sbjct: 280 ILSR 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,537,322
Number of extensions: 1058898
Number of successful extensions: 2943
Number of sequences better than 10.0: 77
Number of HSP's gapped: 2851
Number of HSP's successfully gapped: 86
Length of query: 355
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 244
Effective length of database: 40,753,473
Effective search space: 9943847412
Effective search space used: 9943847412
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)