Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0I032008.269ON56356328980.0
YDR117C (TMA64)8.269ON56556112531e-167
Skud_4.3778.269ON56256812391e-165
Suva_2.2768.269ON56556411891e-157
TPHA0J007808.269ON58357711881e-157
Kwal_56.237718.269ON56255911641e-153
KLTH0G13530g8.269ON57456811631e-153
Smik_4.3618.269ON56556811611e-153
ZYRO0C01496g8.269ON56756911501e-151
Kpol_392.28.269ON56656811391e-149
TDEL0F039608.269ON55855811261e-147
NCAS0B038008.269ON56557411211e-147
SAKL0H16874g8.269ON56355711061e-144
KAFR0B054708.269ON56256710861e-141
CAGL0B01837g8.269ON56956210511e-136
NDAI0J013108.269ON57957810461e-135
AGR079W8.269ON54256410161e-131
Ecym_43018.269ON5645729821e-126
KNAG0H032008.269ON5615699391e-119
KLLA0F19294g8.269ON5705689341e-118
TPHA0I022307.152ON181180920.005
SAKL0F04576g7.152ON180114910.007
ZYRO0D09636g7.152ON181190880.016
TBLA0A010707.152ON181126820.092
NDAI0A083007.152ON181116810.13
KNAG0L008207.152ON208115810.16
KLTH0F13266g7.152ON178175790.23
TDEL0H031507.152ON181124780.38
KAFR0L005707.152ON181115770.49
Smik_6.4136.221ON621101742.1
TDEL0D023601.365ON40795705.8
KAFR0C017703.32ON90168707.2
YDR407C (TRS120)5.506ON1289135707.2
Smik_8.1585.370ON1360120698.4
CAGL0M10197g2.498ON23962688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0I03200
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...  1120   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   487   e-167
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   481   e-165
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   462   e-157
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   462   e-157
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   452   e-153
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   452   e-153
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   451   e-153
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   447   e-151
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   443   e-149
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   438   e-147
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   436   e-147
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   430   e-144
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   422   e-141
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   409   e-136
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   407   e-135
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   395   e-131
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   382   e-126
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   366   e-119
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   364   e-118
TPHA0I02230 Chr9 (499559..499569,499679..500213) [546 bp, 181 aa...    40   0.005
SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 a...    40   0.007
ZYRO0D09636g Chr4 complement(819030..819564,819630..819640) [546...    39   0.016
TBLA0A01070 Chr1 complement(240843..241377,241494..241504) [546 ...    36   0.092
NDAI0A08300 Chr1 complement(1900800..1901334,1901450..1901460) [...    36   0.13 
KNAG0L00820 Chr12 complement(144786..145320,145422..145513) [627...    36   0.16 
KLTH0F13266g Chr6 complement(1089780..1090305,1090378..1090388) ...    35   0.23 
TDEL0H03150 Chr8 complement(518325..518859,518922..518932) [546 ...    35   0.38 
KAFR0L00570 Chr12 (106168..106178,106246..106780) [546 bp, 181 a...    34   0.49 
Smik_6.413 Chr6 complement(664817..666682) [1866 bp, 621 aa] {ON...    33   2.1  
TDEL0D02360 Chr4 complement(459068..460291) [1224 bp, 407 aa] {O...    32   5.8  
KAFR0C01770 Chr3 (360215..362920) [2706 bp, 901 aa] {ON} Anc_3.3...    32   7.2  
YDR407C Chr4 complement(1284069..1287938) [3870 bp, 1289 aa] {ON...    32   7.2  
Smik_8.158 Chr8 complement(239468..243550) [4083 bp, 1360 aa] {O...    31   8.4  
CAGL0M10197g Chr13 (1019623..1020342) [720 bp, 239 aa] {ON} high...    31   8.8  

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/563 (97%), Positives = 547/563 (97%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
           LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
           EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLKV 360
           LKH                TITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLKV
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLKV 360

Query: 361 VTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLFD 420
           VTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLFD
Sbjct: 361 VTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLFD 420

Query: 421 LVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVTEK 480
           LVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVTEK
Sbjct: 421 LVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVTEK 480

Query: 481 VKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPNGSEVQVQGPHGDIVMEYF 540
           VKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPNGSEVQVQGPHGDIVMEYF
Sbjct: 481 VKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPNGSEVQVQGPHGDIVMEYF 540

Query: 541 EKHGIPRKWFDYTNKVKPKKRRS 563
           EKHGIPRKWFDYTNKVKPKKRRS
Sbjct: 541 EKHGIPRKWFDYTNKVKPKKRRS 563

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  487 bits (1253), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 247/561 (44%), Positives = 356/561 (63%), Gaps = 11/561 (1%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + + QT +   +N EY F  S +KQT F    + G +YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NN PI FK+K+   + PTVY+ WEYP  +PI+ TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R K G +CGIAS + P T+LAIG+   D+ + D  +G+TGVAV+++H ++D L+ +FK+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
           L PP +++T +     S  Q   +++I   E E + D       + + +++AE L+   V
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKE-QEDV---KEASVDVEEIAEVLDHFTV 236

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
            D+D F+T++LYYT+TQ+  L+LPI +S F+S ++M+NLP +DHN+VN+KK+SWKK+AKF
Sbjct: 237 SDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKF 296

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKD----KQDNKN 356
           LKH                TI G N +K +LK FVPY++G    A  S++    K+    
Sbjct: 297 LKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSG 356

Query: 357 FLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDD 416
            +  +TLY P          + L S +Y+TS +I SA+  YI+ KNLA+ KDK K+ MDD
Sbjct: 357 MMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDD 416

Query: 417 VLFDLVITNNKA-NANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVK 475
           +LFD+V    K  NA+R I R +++ P+L NNF  ++Q+F  D+  L K P KGS P +K
Sbjct: 417 LLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIK 476

Query: 476 MVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELP--NGSEVQVQGPHG 533
           ++TE     KVITRVSNFEVF +D + ++ +L+ +CSGST+I E      +EVQVQGPHG
Sbjct: 477 IITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHG 536

Query: 534 DIVMEYFEKHGIPRKWFDYTN 554
             ++++  K GIP KW D+ N
Sbjct: 537 QSIIDHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  481 bits (1239), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 251/568 (44%), Positives = 356/568 (62%), Gaps = 14/568 (2%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + + QTC+   +N+EY FP S +KQT F S  + GV+YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NN PI FK+K++  + PTVY+ WE P  +PII TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R K G +CG+AS + P  +LAIG+   D+ + D  LG+TGVAV+V+H ++D L+   K+K
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
           L+PP I  + +        Q     +I E   E    A        + ++LAE L+   V
Sbjct: 181 LDPP-IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQV------HVEELAEVLDHFSV 233

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
            D+D F+T++LYYT+TQ+ SL LPI  S F+S ++M+NLP +DHN+VN+KK+SW+K+AKF
Sbjct: 234 SDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKF 293

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNK----N 356
           LKH                TI G   +K +LK FVPY++G    A  S +  ++K     
Sbjct: 294 LKHFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPG 353

Query: 357 FLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDD 416
            +  +TLY P            L  ++Y+TS +I SA+  YI+  NLA+ KDK K+ MDD
Sbjct: 354 MMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413

Query: 417 VLFDLVITNNK-ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVK 475
           +LF++V    K  NA R + R+Q+++P+L NNF  ++Q+F +D+  L K P KGSPP +K
Sbjct: 414 LLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIK 473

Query: 476 MVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELP--NGSEVQVQGPHG 533
           + TE     KVITRVSNFEVF ID + ++ +L+ +CSGST+I E      +EVQVQGPHG
Sbjct: 474 ITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHG 533

Query: 534 DIVMEYFEKHGIPRKWFDYTNKVKPKKR 561
            +++++    G+P KW D+ NK+K KKR
Sbjct: 534 QLIIDHLNNLGVPNKWIDFENKLKKKKR 561

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  462 bits (1189), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 237/564 (42%), Positives = 350/564 (62%), Gaps = 17/564 (3%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + + QTC+   +N EY FP S +KQT F    + G +YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NN PI FK+K++  + PTVY+ WE    +PI+ TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R K G +CG+AS + P  +LA+G+   D+ +    +G+TGVAV+++H ++D L+  FK+K
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
           L PP   + ++    E    ++   EI E     +           N +++AE L+ L V
Sbjct: 181 LEPPAAFDVAS----EDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSV 236

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
            D+D F+T++LYYT+TQ+ SL LPI +S F+S ++M+NLP +DHN+VN+K++SWKK+AKF
Sbjct: 237 SDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKF 296

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKN---- 356
           LKH                TI G N +K +LK FVPY++G    A   K+K +N N    
Sbjct: 297 LKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSA---KEKGENTNSKEK 353

Query: 357 ---FLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKIS 413
               +  +TLY P            L  ++Y+TS +I SAI  YI+ KNL + KDK K+ 
Sbjct: 354 TSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVV 413

Query: 414 MDDVLFDLVITNNK-ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPP 472
           MDD+L+++V    K  +  R I R+Q+++P+L NNF  ++Q++ +D+  LS+ P KGSPP
Sbjct: 414 MDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPP 473

Query: 473 TVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELP--NGSEVQVQG 530
            +K++TE     KVIT+VSNFE   ID + ++ +L+ +CSGST+I E      +EVQVQG
Sbjct: 474 RIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQG 533

Query: 531 PHGDIVMEYFEKHGIPRKWFDYTN 554
           PHG +++++  K G+P KW D+ N
Sbjct: 534 PHGQLIIDHLNKSGVPNKWIDFEN 557

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  462 bits (1188), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 247/577 (42%), Positives = 358/577 (62%), Gaps = 22/577 (3%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   +   SNLKNSE + + Q+C++  ++++Y FP S +KQ  ++   + G +YTD 
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            NVPIWFK+K+S+ + P+VYT W+ P  +PII T+ ++IE KI NGANLMI GT+ P DE
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           RL  G +CGIAS K P  ++AIG+   D+ +    +G+TGVAV VLH+  D L++ FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LNPPTI---MNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQ 237
           L PP     ++ +N + L +  ++ +  E++ +  ++ PDA  N       DDLAE LE 
Sbjct: 181 LEPPETGAEVDETN-EMLLNQDKQDVNNELTNSNKDLAPDARPN-------DDLAEVLET 232

Query: 238 LRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKT 297
           L V+ ID+F+T+SLYY++T +  L+ PI +S F+S Y+M NLP VD++ VN+KKSSWKKT
Sbjct: 233 LPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKT 292

Query: 298 AKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDK----QD 353
           AKFL+H                 ITGFNKEK +LK+FVPYR G        KDK     D
Sbjct: 293 AKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSD 352

Query: 354 NKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKIS 413
           N + ++ V+ Y P               KS +T+ E+   I  YI KKNL + K+K  I 
Sbjct: 353 NGDMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMIL 412

Query: 414 MDDVLFDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTH-DN---ISLSKHPKKG 469
           MDD+++ LV     +   R I R+ V+EP+  NNF  + Q++   DN   + L K P +G
Sbjct: 413 MDDLMYSLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRG 472

Query: 470 SPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEV 526
           S P V++VTE     KVITRVSNFEVF+IDA+ ++ +L+ LC+G+T+I E    P  +EV
Sbjct: 473 SIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEV 532

Query: 527 QVQGPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKRRS 563
           QVQGPH  +++++     IP KW D+ N VKPK++++
Sbjct: 533 QVQGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKKN 569

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  452 bits (1164), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 234/559 (41%), Positives = 340/559 (60%), Gaps = 11/559 (1%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + ++  CR+ +  ++Y FP   +KQTTF++    G +YTD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            N+PIWFK+K+S+ + PTV++ W   + +PI+  H++++E K+  GANLM+PGTV P DE
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R    K+ G+AST  P  + AIG+   ++      +G++GVAVE++H + DEL   FK+K
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEA-ESEVKPDAPFNDTFTSNADDLAETLEQLR 239
           L PP   +       ES ++E+   E+S A + E KP AP  +    N DD AE L QL 
Sbjct: 181 LQPPEGADG----IAESDSEENSDAEVSGAIKIEPKPSAPLQEPIV-NIDDAAEQLSQLS 235

Query: 240 VEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAK 299
           VED+D+F T++LYYT+TQ++ L++P  +S FVS ++++NLP +DH QVN+KK+SWKKTAK
Sbjct: 236 VEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAK 295

Query: 300 FLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLK 359
           FLKH                TI G +K K +LK FVPYR G  +G     + + N + +K
Sbjct: 296 FLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQN-SMMK 354

Query: 360 VVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLF 419
            + +Y P         A  L+  S F+  E+  A+  YIA K L +  +KA + +DD+LF
Sbjct: 355 ALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLF 414

Query: 420 DLV-ITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVT 478
            LV  +  K NA R I+R+Q++ P+L  NF  +  +   D   L KHP KG  P +++VT
Sbjct: 415 SLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVT 474

Query: 479 EKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGPHGDI 535
           E     KV+T+VSNFE F +DA +++  L+  CSGST+I E    P  +EV VQGPHG  
Sbjct: 475 EMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPA 534

Query: 536 VMEYFEKHGIPRKWFDYTN 554
           V+E   +  IP KW ++ N
Sbjct: 535 VIELLNQLAIPTKWINFVN 553

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  452 bits (1163), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 235/568 (41%), Positives = 342/568 (60%), Gaps = 21/568 (3%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE +NI+  C++   ++EY FP   +KQTTF++    G ++TD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            NVPIWFK+K+S+ + PTV+T W     +PI+  H++++E K+  GANLM+PGTV P DE
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R    ++  +AST  P  + AIG+   ++      +G++GVAVE++H + DEL  +FK+K
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQE-----ISEAESEVKPDAPFNDTFTS--NADDLAE 233
           L PP      +   L+S ++E    E      S  ES   P +   D      N +D++E
Sbjct: 181 LQPP----EGSAAILDSESEEEADIEDDTGVPSAPESLAAPKS-LQDVQEPLVNVEDISE 235

Query: 234 TLEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSS 293
            L +LRVED+D+F T+SLYY++  +  L+ PI +S FVS ++++NLP +DH QVN+KK+S
Sbjct: 236 QLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTS 295

Query: 294 WKKTAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPA-----GALPS 348
           WKKTAKFLK+                TI G ++ K +LK F PYRIG  A     GA   
Sbjct: 296 WKKTAKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSV 355

Query: 349 KDKQDNKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKD 408
            ++++  + +K V+LY P     +  +A  L     FT  +I SA+  YI+ KNL +P +
Sbjct: 356 ANEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDN 415

Query: 409 KAKISMDDVLFDLV-ITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPK 467
           K+ + +DD+L+DLV  ++ K NA R I R+Q++ PVL  NF  +  +   D   L KHP 
Sbjct: 416 KSAVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPV 475

Query: 468 KGSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGS 524
           KGS P V++VTE     KV+T+VSNFE F +DA +++  L+  CSGST+I E    P   
Sbjct: 476 KGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTL 535

Query: 525 EVQVQGPHGDIVMEYFEKHGIPRKWFDY 552
           EV VQGPHG  V+E   + GIP KW ++
Sbjct: 536 EVTVQGPHGPAVIELLNESGIPTKWINF 563

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  451 bits (1161), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 245/568 (43%), Positives = 355/568 (62%), Gaps = 25/568 (4%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + + QTC    +N EY FP S +KQT F    + G +YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NN+PI FK+K+   + PTVY+ W+ P+ +PI+ TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R   G +CG+A  + P  +LAIG+   D+ + D  +G+TGVAV+V+H ++D L   FK+K
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LNPPTIMNT----SNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLE 236
           L PP ++NT     N+ + ++ T E +       ES +K  AP       + +++AE L+
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQES-IKKTAP-------DLEEVAEVLD 232

Query: 237 QLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKK 296
            L V D+D F+T++LYY++TQ+  L LPI +S F+S ++M+NLP +DHN+VN+KKSSWKK
Sbjct: 233 HLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKK 292

Query: 297 TAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDN-- 354
           +AKFLKH                TI G N +K +LK FVPY++G  +   PSK   +N  
Sbjct: 293 SAKFLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSS---PSKGSGENAT 349

Query: 355 -----KNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDK 409
                   +  +TLY P            L   +Y+TS ++ +A+  YI+ KNLA+ KDK
Sbjct: 350 SKDRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDK 409

Query: 410 AKISMDDVLFDLVITNNKA-NANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKK 468
            K+ MDD+LF++V    K  +  R I RS++++P+L NNF  ++Q+F +D+  L + P K
Sbjct: 410 RKVVMDDLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMK 469

Query: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELP--NGSEV 526
           G PP +K+VTE     KVIT+VSNFEVF+ID + ++ +L+ +CSGST+I E      +EV
Sbjct: 470 GCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEV 529

Query: 527 QVQGPHGDIVMEYFEKHGIPRKWFDYTN 554
           QVQGPHG  +++Y  K GIP KW D+ N
Sbjct: 530 QVQGPHGQFIIDYLNKSGIPSKWIDFEN 557

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  447 bits (1150), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 235/569 (41%), Positives = 345/569 (60%), Gaps = 28/569 (4%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK+  +  LSNLKNSE++ +  TCR    N EY FP   +KQT F++    G +YTD+
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           +N PIWFK+K+ N + PTV+  W +P  +P++ TH F++E ++FNGANLM+ GTV P D 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           RLKPG +CGIAS   P  ++A+G+   D+ + D+ LGKTGVAV+++H+  D L+ +FK+ 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LNPPT------IMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAET 234
             PP              + LE   Q+  +QEI   E  V            + DD+AE 
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAV------------DIDDIAEV 228

Query: 235 LEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSW 294
           L++ R+ED+D FLT++LYYT+T +T L+LPI +S F+S ++  NLP+VDH +VN+KKSSW
Sbjct: 229 LDEFRLEDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSW 288

Query: 295 KKTAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRI----GKPAGALPSKD 350
           KKTAKFLK+                TI G NK+KP+L+ F PY+I    G    +  + +
Sbjct: 289 KKTAKFLKNFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNN 348

Query: 351 KQDNKNFLKVVTLYSPKKKNDSCWTALGLTSKS-YFTSAEITSAIQGYIAKKNLANPKDK 409
           K+D    L+  TLY P            L  +   +T+ E+ +A+  YIA  NLA+ K+K
Sbjct: 349 KKDGSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNK 408

Query: 410 AKISMDDVLFDLVITNNK-ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKK 468
             + +DD+L+ LV    K   A R + R+ ++EP+L N+F  + Q++  D I L K+P +
Sbjct: 409 KMVILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSR 467

Query: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSE 525
           G+ P +++VTE     KVITRVS FE+F+ID  +++  L+ LCSGST+I E    P   E
Sbjct: 468 GNLPNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKE 527

Query: 526 VQVQGPHGDIVMEYFEKHGIPRKWFDYTN 554
           V VQGPHG +++++    GIP KW  + N
Sbjct: 528 VTVQGPHGPLIIDHLNSLGIPTKWIKFDN 556

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  443 bits (1139), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 249/568 (43%), Positives = 355/568 (62%), Gaps = 9/568 (1%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I +LSNLKNSE + + Q+C+    + +Y FP S +KQT F +  + GVIYTD 
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
              P+WFK+K+S  + PTVYT WE P  +PI+ THD +I   IFNGANLMI GT+ P D 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           RL P  ICGIA+   P TI+A+G+   DM +  + +GKTGVAV VLH++ D ++  FK+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
            + PTI+   + K++++   +     I+E E       P  +  +++  +LA+    L V
Sbjct: 181 RDIPTIVGGKD-KSVDATENDQSPVIITEEEKTEDDSIP--EISSNDVSELAQEESALTV 237

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
           EDID+F+T+SLYYT+T +  L  PI SS+F+S ++M+NLP VDHN VNIKK+SWKK++KF
Sbjct: 238 EDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKF 297

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRI---GKPAGALPSKDKQDNKNF 357
           LKH                TI G NKEK +LK F PYRI      +G   + ++Q+++N 
Sbjct: 298 LKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENM 357

Query: 358 LKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDV 417
           +  +  YSPK       T   L  K+++T+ E+ +A+  YI KK L + K+    ++DD 
Sbjct: 358 MYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDR 417

Query: 418 LFDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMV 477
           L+D+  T    N  R+I R+ V+E    NNF   +QLF +D+  L+K+P +GSPP +K+V
Sbjct: 418 LYDMCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIV 477

Query: 478 TEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGPHGD 534
           TE     K++TRVSNFE F IDA  ++ +L+ LCSGST+I E    P  +EVQVQGPH  
Sbjct: 478 TEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSK 537

Query: 535 IVMEYFEKHGIPRKWFDYTNKVKPKKRR 562
           I++++     IP KW D+ NK+KPKK R
Sbjct: 538 IIIDHLNSLSIPTKWIDFENKLKPKKIR 565

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  438 bits (1126), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 226/558 (40%), Positives = 337/558 (60%), Gaps = 18/558 (3%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + + Q+C++    ++Y F  S VKQT ++   ++G +YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NNVPIWFK+K+   + PTVY+ W  PN +PI+ THDF+IE ++FNGANLM+ GT+ P DE
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           R  P K+CGIAS   P  ILAIG+   ++ +  + +G+ G+AV+V+H+++D L   FKI 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTS--NADDLAETLEQL 238
           + P              ++ E + +E  E   E   ++P  +TF +  + +D+A+ L++L
Sbjct: 181 IEPAV------------LSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDEL 228

Query: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298
            VED+D+F T++LYYT T +T L +PI +S F+S +++ NLP VD +QVN+KK+SWKKTA
Sbjct: 229 SVEDVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTA 288

Query: 299 KFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFL 358
           KFLKH                 I G NK K +LK FVPY+      +  + +K  +   +
Sbjct: 289 KFLKHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKNSNKDSSPGMM 348

Query: 359 KVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVL 418
               LY P            L  K+ +T  E+  ++  YI  K L + K+K  + +DD+L
Sbjct: 349 YSEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLL 408

Query: 419 FDLVITNNKANAN-RNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMV 477
           FD+     K     R + R+Q+++P + NNF  ++QLF  ++  L K+P +G  P VK+V
Sbjct: 409 FDMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIV 468

Query: 478 TEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGPHGD 534
           TE     KV+TRVS+FE F +D +D++  L+ LCSGST+I E    P  +EVQVQG HG 
Sbjct: 469 TEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGP 528

Query: 535 IVMEYFEKHGIPRKWFDY 552
           ++++Y  K GIP KW D+
Sbjct: 529 LIIDYLNKQGIPTKWIDF 546

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  436 bits (1121), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 236/574 (41%), Positives = 339/574 (59%), Gaps = 38/574 (6%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MF+K   I  LSNLKNS+ + + QT      N++Y  P S VKQT F++    G IYTD 
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            N+PIWFK+K+   +  TVYT W   + +PI  +HDF+I+ K+FNGANLMI GT+ P DE
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RLKPGKICGIASTKVPGTIL-AIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKI 179
           +LK G +CG+AS + PG ++ AIG+   D+   +  +G++GVAV+++H + DEL   FKI
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLNPPTI-----------MNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNA 228
            L PP +                 +  ++  ++  T+E+S A               +N 
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTA---------------TNV 224

Query: 229 DDLAETLEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVN 288
           +DLAE L+ L V+D+D F+T++LYYTIT +T L LPI +S F+S ++ KNLP+VDHN+VN
Sbjct: 225 EDLAEVLDHLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVN 284

Query: 289 IKKSSWKKTAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPS 348
           IKKSSWKKTAKFLKH                T+ G NK K +LK FVPY++G   G    
Sbjct: 285 IKKSSWKKTAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKG 344

Query: 349 KDKQDN--KNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANP 406
             K+ +     +  +T Y P           G+  K+ +   EI   +  YI  KNL + 
Sbjct: 345 AKKEGDSQSGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDN 404

Query: 407 KDKAKISMDDVLFDLVITNNKA---NANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLS 463
           K+K  + +DD+LF +V  N K      +R+I R+Q++EP L NNF  + Q++      L 
Sbjct: 405 KNKKMVLLDDLLFGMV--NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLF 462

Query: 464 KHPKKGSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL--- 520
           K P +GSPP +K++TE     KVIT+VSNFE F I+ + ++ +L+ +CSGST+I E    
Sbjct: 463 KSPMRGSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTS 522

Query: 521 PNGSEVQVQGPHGDIVMEYFEKHGIPRKWFDYTN 554
           P  +EVQVQGPHG I++++  K G+P KW DY N
Sbjct: 523 PKTAEVQVQGPHGQIIIDHLNKLGVPTKWIDYEN 556

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  430 bits (1106), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 235/557 (42%), Positives = 336/557 (60%), Gaps = 12/557 (2%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK+  I  LSNLKNSE + +  + R+    ++Y+FP   VKQTTF+   + G +YTD 
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            NVPIWFK+K+ + + PTV+T W  P+ +P+++TH  ++E K+  GA+LM+PG V P   
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           +   G + G+AST+ P  I AIG+   D+ +    +G+TGVAV ++H + D L   FK+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
           L PP  +  ++ KT      E   +E  ++  E K  A        N +D +E L +L  
Sbjct: 181 LEPPEAIEDTSSKT------EEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSA 234

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
           EDID+FLT+SLYYT+TQ+  LQLP+ +S FVS +++ NLP VDHNQ+N+KKSSWKK+AKF
Sbjct: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKF 294

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDK-QDNKNFLK 359
           LKH                 + G NK+K +LK FVPYRIG       +K K Q+N N ++
Sbjct: 295 LKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQENSNMMQ 354

Query: 360 VVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLF 419
            V+LY P         A+ L     FT+ E+ +A+  YI KKNL N  DK  + +DD LF
Sbjct: 355 AVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLF 414

Query: 420 DLV-ITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVT 478
            ++  +  K NA R I R+Q++ P L NNF  + Q+   D + L K   KG+ P +++VT
Sbjct: 415 PMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGD-VPLFKTALKGAIPEIQIVT 473

Query: 479 EKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGPHGDI 535
           E     KV+T+VSNFE F +DA+ ++ EL+  CSGST+I E    P   EV VQGPHG I
Sbjct: 474 EMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAI 533

Query: 536 VMEYFEKHGIPRKWFDY 552
           V+    ++GIP KW ++
Sbjct: 534 VIGMLNEYGIPTKWINF 550

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  422 bits (1086), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 233/567 (41%), Positives = 335/567 (59%), Gaps = 27/567 (4%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDAL-SNNEYEFPGSQVKQTTFESTVANGVIYTD 59
           MFKK   I  LS LKNS+ + + Q+ +  L S+ +    G  + QT F ST A G IYTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  SNNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHD 119
           SN++PI FK K+S+T+ PT +  W     +  +RTH  ++E  IFNGA+LMI GTV P D
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 ERLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKI 179
             L  G IC +A+ + P   +A+G+   ++      LGKTGVAVE+LH + D L + FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLNPPTIMNTSNLKTLESMTQESMTQEI-----SEAESEVKPDAPFNDTFTSNADDLAET 234
           KL  P         +++S+ QE  T ++     +E ES+   + P   + +   DD+AE 
Sbjct: 181 KLEIPA--------SVKSILQEETTADVAKESDAEQESQSVTEPP---SGSEGPDDIAEV 229

Query: 235 LEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSW 294
           L++L VED+D F+ ++LY+T+ Q+ +L LP+++S F+S ++M+NLP+VDH +VNIK++SW
Sbjct: 230 LDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSW 289

Query: 295 KKTAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDN 354
           KKTAKFLK+                 I G NK+K +LK FVPY+IG  A    SK     
Sbjct: 290 KKTAKFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQ 349

Query: 355 KNFLKV--VTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKI 412
              + V  V LY P            ++    +TS EI + I  YI KKNL + KDK  +
Sbjct: 350 TQGVSVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMV 409

Query: 413 SMDDVLFDLVITNNKANAN----RNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKK 468
            +DD+LF +V   N+   N    R I R+ ++EP++ NNF  Y QL+  DN  L K+P K
Sbjct: 410 MLDDLLFAMV---NRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIK 466

Query: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPNG-SEVQ 527
           G  P + +VTE     KV+TRVSNFE F I  ++++ +L+ LCSGST+I E P   SEVQ
Sbjct: 467 GQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKKVSEVQ 526

Query: 528 VQGPHGDIVMEYFEKHGIPRKWFDYTN 554
           VQGPHG +++++F K GIP K+  + N
Sbjct: 527 VQGPHGQLIIDHFNKSGIPSKFIQFEN 553

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  409 bits (1051), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/562 (41%), Positives = 335/562 (59%), Gaps = 14/562 (2%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE + +++ CR   SN EY F  + +KQT F+     G IYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            N PIWFK+K+   + PTV   W  PN IP++ TH  ++E  IFNGANLMI GT+ P DE
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
           RL  G +CGIA  + P  I+A+G+   ++ +    +G+TGVAV+++H   DEL  +FK+K
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
             PP  +  +   + E +  E+   +I E E++V+ ++   +   SN DD+AE L++LR+
Sbjct: 181 EEPPAELLQTQSSSSEELELEA---DIHEDETKVESNSD-TEKEKSNLDDMAEVLDELRL 236

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLP-NVDHNQVNIKKSSWKKTAK 299
           EDID F+T++LYYTI+Q+T L+ P  +S FVS ++  NLP   +  +VNIKKSSWKKTAK
Sbjct: 237 EDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAK 296

Query: 300 FLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLK 359
           FLKH                TI   NK+K ++K F+PY +    G+    +  + K  +K
Sbjct: 297 FLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKTTIK 356

Query: 360 VVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLF 419
           +VTLY P        ++  +  K  +   EI   I  YI  K+L + KDK  + +DD+L 
Sbjct: 357 IVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDMLM 416

Query: 420 DLVI--TNNKANANRNIMRSQVVEPVLVNNFLLYHQLFT---HDNISLSKHPKKGSPPTV 474
            ++     ++A  +R I R+ +++PVL NNF   + LF    ++   L+K P KG PP +
Sbjct: 417 TMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPKI 476

Query: 475 KMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPNG----SEVQVQG 530
            +VTE     KVIT+VSNFEVF ID ++ + +++  CSGST+I E  +     +EVQVQG
Sbjct: 477 NIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQG 536

Query: 531 PHGDIVMEYFEKHGIPRKWFDY 552
           PHG ++M Y    GIP KW D+
Sbjct: 537 PHGQLIMSYLNDLGIPNKWIDF 558

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  407 bits (1046), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/578 (41%), Positives = 342/578 (59%), Gaps = 36/578 (6%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQV-KQTTFEST--VANGVIY 57
           MFKK   I  LSNLKNS+ + + QT +   +   Y F  S + KQT F++T   + G I+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDSNNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGP 117
           T+ +N+PIWFK K+++ + PTV+T W   + +P + +HDF+I+ K+FNGANLMI GT+ P
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 HDERLKPGKICGIASTKVPGTIL-AIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNI 176
            D RL PG +CGIAS + P  I+ AIG+   +M + D  +G+TGVAVEV+H + DEL  I
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKIKLNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLE 236
           FK     P       L T      +   ++ +  + E +          SN  D  E L+
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENR---------ESNEPDF-EVLD 230

Query: 237 QLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKK 296
             + ED+D F+T+SLYYTITQ+T ++LPI +S F+S ++ KNLP++ HN+VNIKK+SWKK
Sbjct: 231 HFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKK 290

Query: 297 TAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGK---PAGALPS---KD 350
           TAKFLKH                T+ G NK K +LK FVPY+IGK   P+ +L S    D
Sbjct: 291 TAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTND 350

Query: 351 KQDNKNFLKVVTLYSPKKKNDSCWTAL-GLTSKSYFTSAEITSAIQGYIAKKNLANPKDK 409
           K D K  +   T Y P         A+  + +K  +T  EI   +  YI  KNL + K+K
Sbjct: 351 KSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNK 410

Query: 410 AKISMDDVLFDLVI-TNNKANAN-RNIMRSQVVEPVLVNNFLLYHQLFTHDNIS------ 461
             I +DD+LF++V    ++ANA  R +MR  ++EP+L NNF  ++Q++   N        
Sbjct: 411 KMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMED 470

Query: 462 ---LSKHPKKGSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIE 518
              L K P++G  P + ++TE     KVIT+VSNFE+F I +  ++ +L+ LCSGST+I 
Sbjct: 471 VEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIG 530

Query: 519 EL---PNGSEVQVQGPHGDIVMEYF-EKHGIPRKWFDY 552
           E    P   EVQVQGPHG I++++  +K G+P KW +Y
Sbjct: 531 ETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  395 bits (1016), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 203/564 (35%), Positives = 323/564 (57%), Gaps = 24/564 (4%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   +   SN KNSE + ++ + R+      Y+F  +++K  TF++    G +YTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           NN+P+WF+ K+  T +PTVY+ W++P+ +P++ TH+ ++E+K+  GA+LM+PGTV P   
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
             + G++ GIAST+ PG + A+G+C  D+  V T    TGVAV VLH Y D L  +FK++
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240
              P           E+   +  + E  E E+E    AP         + LAE LE+L +
Sbjct: 181 REAP-----------EASEAKGASPEAREPEAEPPKTAP--------GEGLAEELERLTM 221

Query: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300
           ED+D+ LT+++YYTI  +  LQLP+ +S F++ +++KNLP +D +QV +K+SSW K AK 
Sbjct: 222 EDVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKL 281

Query: 301 LKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKNFLKV 360
           LKH                T+   N     LK+F PYR      +  SK+    ++ L++
Sbjct: 282 LKHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS-LEI 340

Query: 361 VTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDVLFD 420
           V  Y P +        LG++     ++ +I   ++ Y+A +   +P DK+ + +DD L  
Sbjct: 341 VYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400

Query: 421 LVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMVTEK 480
           L+  N  A+  R++ R + +  +L  +F  Y  +   D   LSK P+KG  P +K+  E+
Sbjct: 401 LLHKNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGD-APLSK-PQKGRAPPIKVTNER 458

Query: 481 VKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEVQVQGPHGDIVME 538
               KV+T+VSNFEV+ +D ++++ EL+V CSGST+I ++PN    EVQVQGPH   ++ 
Sbjct: 459 KIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIVS 518

Query: 539 YFEKHGIPRKWFDYTNKVKPKKRR 562
              KHGIP K+     KV+PKK++
Sbjct: 519 ILNKHGIPSKYITLDCKVQPKKKK 542

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  382 bits (982), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 201/572 (35%), Positives = 341/572 (59%), Gaps = 19/572 (3%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK  TI + SNLKNSE + +    R   +N E++F  + VKQ TF++  A G I+TD 
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
           +N PI+FK+K+S  ++PT+ T W+YP  + ++ TH  +++ K+ NGA+LM+PGT+ P  +
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180
               GK+ G+AS++ P  + AIG+C  +++ +   +G+TGVAV+VLH  +D L  +FK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LNPPT--IMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTS------NADDLA 232
           + PP+  +++  +   LE++ Q      I E E     D P   T +       +  ++A
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDE-----DLPTAKTASGPLEEPNSLSEVA 235

Query: 233 ETLEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKS 292
           E LE+L +E +D+FLTQ++YYT+  + +L+LPI +S F++ ++MKNLP +   QV++K+S
Sbjct: 236 EQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRS 295

Query: 293 SWKKTAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQ 352
           SW + +KFLK+                T+   NK+K ++K+F PYR  + + +  SK+  
Sbjct: 296 SWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN-- 353

Query: 353 DNKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKI 412
           ++K+ ++VV  Y P     +   ALG    +   + +I + +  Y+ +K L N  D+  I
Sbjct: 354 NDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERII 413

Query: 413 SMDDVLFDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPP 472
            +DD LF L    + +++ R ++R+++ + +L  +F     +F  D   LS  P K    
Sbjct: 414 LLDDTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIF-KDGKPLSSKPLKSKNR 472

Query: 473 TVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEE---LPNGSEVQVQ 529
            V ++TE     K++TR+SNFE++ +D +++S EL+  CSGS+++ E   L + +EVQVQ
Sbjct: 473 NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQ 532

Query: 530 GPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKR 561
           GPHG+  +    +HGIP K+ D+ NK+  KK+
Sbjct: 533 GPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  366 bits (939), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 320/569 (56%), Gaps = 32/569 (5%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MFKK   I  LSNLKNSE R ++Q  +     +E+ F G+ VKQT F+ST + G IY + 
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NN--VPIWFKQKY-SNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGP 117
               VP++FK+K+ S  + P+VY  W +P  +PII TH  +IE  +FNGANLMI GT+ P
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 HD-ERLKPGKICGIASTKVPGTILAIGLCTFDMSTVDT--PLGKTGVAVEVLHWYSDELT 174
            D   L  G+ CGIA+ K P  I+A+G    D+   +T   +G +GV VEV H ++D L 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 NIFKIKLNPPTIMNTSNLKTLESMTQESMTQEISEAES-EVKPDAPFNDTFTSNADDLAE 233
           + F++KL+ P          LES T    TQE++E    E KP +P  +      DDLAE
Sbjct: 181 DAFRLKLDIP--------DKLESAT----TQEVAEEPPVEAKPTSPVTNPVA--VDDLAE 226

Query: 234 TLEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLP-NVDHNQVNIKKS 292
            LE L VED+D F+T++LYYT+TQE  L LPI +S F+S +LMK LP  +D  +VN+KKS
Sbjct: 227 VLETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKS 286

Query: 293 SWKKTAKFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQ--LKTFVPYRIGKPAGALPSKD 350
           SWKKTAK+LKH                 + G    K    LK FVPY +G        K 
Sbjct: 287 SWKKTAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKS 346

Query: 351 KQDNKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKA 410
           +  N   +  VT + P   + +  TAL L  + YF+  EI   +  YI    LA P +  
Sbjct: 347 QTTNGPVMFAVTSFQP---DSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPK 403

Query: 411 KISMDDVLFDLVITNN--KANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKK 468
            + ++D LF +V   N  K    R + R +++E V+  +F   +QLF   +  L+KHP+K
Sbjct: 404 MVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQK 463

Query: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEE---LPNGSE 525
           G PP V ++TE     KV+TRV NF+  NI   + + +L+ LCS ST+I +    P  SE
Sbjct: 464 GEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSE 523

Query: 526 VQVQGPHGDIVMEYFEKHGIPRKWFDYTN 554
           +QVQG HG +++++  + G+P  W  + N
Sbjct: 524 IQVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  364 bits (934), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/568 (37%), Positives = 323/568 (56%), Gaps = 22/568 (3%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MF K   I  LSNLKNS+ + ++ T +  + N EY  P + +KQT+F+     G IYTD 
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNI-PIIRTHDFIIETKIFNGANLMIPGTVGPHD 119
           +N PIWFK K+ + + PT+++ W     + PII THDF+IE  I  GA LM+PGTV P  
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 ERLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKI 179
             +K G I GIASTK P  + AIG+   D+  +   +G  G+AV V+H+  D L   FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLNPPTIM-NTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQL 238
           +L PP ++ N+  ++T    TQ S   E  + ES    +     +  S  +++A+ LE++
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEES----NHLERSSSQSPVNEIADELEEM 235

Query: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298
            +ED+D+ L +++ Y+I  +  + LPI++STF+S ++MKNLP+VD N VNIKKSSWKK  
Sbjct: 236 SIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKAT 295

Query: 299 KFLKHXXXXXXXXXXXXXXXXTITGFNKEKPQLKTFVPYRIGKPAGALPSKD--KQDNKN 356
           K LK+                T+   NK    L     Y+         S D   Q NKN
Sbjct: 296 KLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKN 355

Query: 357 FLKVVTLYSPKKKNDSCWTAL-GLTS---KSYFTSAEITSAIQGYIAKKNLANPKDKAKI 412
            +   +  +  K   +C   + G+T+   +SY+T  E+   +  Y+A  NL +P++K+ +
Sbjct: 356 KITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLV 415

Query: 413 SMDDVLFDLVITNNKANAN---RNIMRSQVVEPVLVN-NFLLYHQLFTHDNISLSKHPKK 468
             DD L+ +   +N+A  N   + I R  +V P  ++ NF  YHQ++  +   L K P+K
Sbjct: 416 KYDDTLYQM---SNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEK 472

Query: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEV 526
           G  PT+++VTEK    KVITRV+NFE F ID+++++  L+  CSGST+I E  +   +EV
Sbjct: 473 GPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEV 532

Query: 527 QVQGPHGDIVMEYFEKHGIPRKWFDYTN 554
           QVQGPHG IV+     +GIP KW  + N
Sbjct: 533 QVQGPHGSIVISILNDYGIPTKWISFEN 560

>TPHA0I02230 Chr9 (499559..499569,499679..500213) [546 bp, 181 aa]
           {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 75/180 (41%), Gaps = 8/180 (4%)

Query: 1   MFKK--NLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYT 58
           MF+K     I + S +K+S  RN++          E        K++  E       I  
Sbjct: 1   MFRKFTKEDIHSRSKVKSSVQRNLKSKLVSQFPQLEEVIDELIQKKSQIELIKCEDKIQL 60

Query: 59  DSNNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPH 118
            + +  ++F Q++ + ++PT+    +YP   P I+     I+  + +GAN+M PG   P 
Sbjct: 61  YTVDGEVYFFQQF-DELIPTLKLIHKYPQAFPTIQVDRGAIKF-VLSGANIMCPGLTSP- 117

Query: 119 DERL--KPG-KICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTN 175
             RL   PG +   I          A+ +    MST D      G  VE++H   D L N
Sbjct: 118 GARLPETPGYEKDSIIIINAENKEHALAVGKLLMSTDDIASINKGHGVEMIHHLGDPLWN 177

>SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 aa]
           {ON} similar to uniprot|P89886 Saccharomyces cerevisiae
           YER007C-A TMA20 Protein of unknown function that
           associates with ribosomes
          Length = 180

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 65  IWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDERL-- 122
           I F QK+ N ++PT+     +P   P ++     I+  + +GAN+M PG   P   +L  
Sbjct: 66  ILFFQKF-NDLIPTLKFVHRFPGAFPTVQVDRGAIKF-VLSGANIMCPGLTSP-GAKLPD 122

Query: 123 KPG---KICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDEL 173
            PG       I + +     LAIG  T  MST D      G  VE++H+  D L
Sbjct: 123 APGLEKDAIVIVNAENKEHALAIG--TLLMSTEDIRSINKGHGVEMVHYLGDCL 174

>ZYRO0D09636g Chr4 complement(819030..819564,819630..819640) [546
           bp, 181 aa] {ON} similar to uniprot|P89886 Saccharomyces
           cerevisiae YER007C-A TMA20 Protein of unknown function
           that associates with ribosomes
          Length = 181

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 77/190 (40%), Gaps = 32/190 (16%)

Query: 1   MFKK--NLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYT 58
           MF+K     + + SN+K+S  R+++          E        K++  E       I  
Sbjct: 1   MFRKFAKEDVHSRSNVKSSVQRSLKSKLVSQYPKLEDVIDELIPKKSQVELIKCEDKIQL 60

Query: 59  DSNNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPH 118
            S +  I F QK++  ++PT+    ++P+  P ++     I+  + +GAN+M PG   P 
Sbjct: 61  YSVDGEILFFQKFAE-LIPTLKLVHKFPDAYPTVQVDRGAIKF-VLSGANIMCPGLTSP- 117

Query: 119 DERLKPGKICGIASTKVPG---------------TILAIGLCTFDMSTVDTPLGKTGVAV 163
                     G +  + PG               + LAIG     MST +      G  V
Sbjct: 118 ----------GASLPEAPGYEKDSVVVINAENKESALAIG--KLMMSTEEIKSINKGHGV 165

Query: 164 EVLHWYSDEL 173
           E++H  SD L
Sbjct: 166 EMIHHLSDPL 175

>TBLA0A01070 Chr1 complement(240843..241377,241494..241504) [546 bp,
           181 aa] {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 30/126 (23%)

Query: 65  IWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDERLKP 124
           ++F QK+ + ++P++    ++P   P ++     I+  + +GAN+M PG   P       
Sbjct: 67  VYFFQKF-DELIPSLKFVHKFPKAFPTVQVDRGAIKF-VLSGANIMCPGLTSP------- 117

Query: 125 GKICGIASTKVPG---------------TILAIGLCTFDMSTVDTPLGKTGVAVEVLHWY 169
               G A  + PG                 LAIG     MST D      G  +E++H  
Sbjct: 118 ----GAALPEAPGYEKDSIVVINAENKEHSLAIG--KLLMSTEDIKSINKGHGIEMIHHL 171

Query: 170 SDELTN 175
            D L N
Sbjct: 172 GDPLWN 177

>NDAI0A08300 Chr1 complement(1900800..1901334,1901450..1901460) [546
           bp, 181 aa] {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 65  IWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDERL-- 122
           + F QK+ + ++PT+     +P   P ++     I+  + +GAN+M PG   P   +L  
Sbjct: 67  VLFFQKF-DELIPTLRLVHRFPEAYPTVQVDRGAIKF-VLSGANIMCPGLTSP-GAKLPD 123

Query: 123 KPG---KICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTN 175
            PG       + + +   + LAIG     MST D      G  VE++H   D L N
Sbjct: 124 APGFEKDSIVVITAENKDSALAIG--KLLMSTEDIKSINKGHGVEMIHHLGDPLWN 177

>KNAG0L00820 Chr12 complement(144786..145320,145422..145513) [627
           bp, 208 aa] {ON} Anc_7.152 YER007C-A
          Length = 208

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 65  IWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDERLK- 123
           + F QK+ + ++P++     +P   P ++     I+  + +GAN+M PG   P  +  + 
Sbjct: 94  VLFFQKF-DELIPSLKLVHRFPEAYPTVQVDRGAIKF-VLSGANIMCPGLTSPGAKLPES 151

Query: 124 PG---KICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTN 175
           PG       + + +   + LAIG     MST D      G  VE++H   D L N
Sbjct: 152 PGFEKDTVVVINAENKDSALAIG--KLMMSTNDIAEINKGHGVELIHHLGDPLWN 204

>KLTH0F13266g Chr6 complement(1089780..1090305,1090378..1090388)
           [537 bp, 178 aa] {ON} similar to uniprot|P89886
           YER007C-A Saccharomyces cerevisiae TMA20 Protein of
           unknown function that associates with ribosomes
          Length = 178

 Score = 35.0 bits (79), Expect = 0.23,   Method: Composition-based stats.
 Identities = 41/175 (23%), Positives = 74/175 (42%), Gaps = 5/175 (2%)

Query: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60
           MF+K   + + SN+K+S  R ++          E        K++  E       I   +
Sbjct: 1   MFRKE-DVHSRSNVKSSVQRTLKTKLVSQFPKLEEVIDELVPKKSHVELIKCEDKIQLYA 59

Query: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120
            +  + F QK+ + ++PT+    ++P   P ++     I+  + +GAN+M PG   P  +
Sbjct: 60  VDGEVCFFQKF-DELIPTLKLVHKFPEAFPTVQVDRGAIKF-VLSGANIMCPGLTSPGAQ 117

Query: 121 RLK-PG-KICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDEL 173
             + PG +   +   K      A+ +    MST D      G  VE++H   D L
Sbjct: 118 LPEAPGLEKDALVIVKAENKESALAVGRLLMSTEDIKSINKGHGVEMIHHLGDPL 172

>TDEL0H03150 Chr8 complement(518325..518859,518922..518932) [546 bp,
           181 aa] {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 50/124 (40%), Gaps = 30/124 (24%)

Query: 65  IWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDERLKP 124
           + F QK+ + ++PT+    ++P   P ++     I+  + +GAN+M PG   P       
Sbjct: 67  VLFFQKF-DELIPTLKLVHKFPAAYPTVQVDRGAIKF-VLSGANIMCPGLTSP------- 117

Query: 125 GKICGIASTKVPG---------------TILAIGLCTFDMSTVDTPLGKTGVAVEVLHWY 169
               G A    PG               + LAIG     MST +      G  VE++H  
Sbjct: 118 ----GAALPDAPGFEEESIVVINAENKDSALAIG--KLMMSTEEIKSVNKGHGVEMIHHL 171

Query: 170 SDEL 173
            D L
Sbjct: 172 GDPL 175

>KAFR0L00570 Chr12 (106168..106178,106246..106780) [546 bp, 181 aa]
           {ON} Anc_7.152 YER007C-A
          Length = 181

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 65  IWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDER-LK 123
           I F QK+ + ++P++    ++P   P ++     I+  + +GAN+M PG   P  +  + 
Sbjct: 67  ILFFQKF-DELIPSLRLVHKFPEAYPTVQVDRGAIKF-VLSGANIMCPGLTSPGAKLPVS 124

Query: 124 PG---KICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTN 175
           PG       I + +     LA+G     MST +      G  VE++H   D L N
Sbjct: 125 PGFEKDSIVIINAENKENALAVG--KLLMSTDEISSINKGHGVELIHHLGDPLWN 177

>Smik_6.413 Chr6 complement(664817..666682) [1866 bp, 621 aa] {ON}
           YPL208W (REAL)
          Length = 621

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 6/101 (5%)

Query: 180 KLNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLR 239
           +LN P I N S LK L S    ++   I E  + +  +   +   +SN  DL +  + ++
Sbjct: 152 RLNSPLIWNPSELKRLSST---NLGNSIREKLANIIKEW-LDLVTSSNIFDLKKVGDDVK 207

Query: 240 VEDI-DNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNL 279
           +  I D    ++LY  I + T LQ P+I  +F S +L  +L
Sbjct: 208 IFHILDELTDEALYEQILKRTELQTPVIWYSF-SAFLWSHL 247

>TDEL0D02360 Chr4 complement(459068..460291) [1224 bp, 407 aa] {ON}
           Anc_1.365 YOL022C
          Length = 407

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 7/95 (7%)

Query: 67  FKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDERLKPGK 126
           F++  ++   P V+ A     + P+    +  +E     G  + +     P+DE LK   
Sbjct: 12  FEEDLTSNNGPPVFLAL---VDAPVKENEEVTVEDSFIGGKPVWLDENSVPNDELLK--- 65

Query: 127 ICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGV 161
            CG   TK    +L       D   V+   GK GV
Sbjct: 66  -CGACKTKENMKLLVQAFSPLDTEQVEEVQGKNGV 99

>KAFR0C01770 Chr3 (360215..362920) [2706 bp, 901 aa] {ON} Anc_3.32
           YNL313C
          Length = 901

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 2   FKKNL-TITTLSNLKNSESRNIRQTC------RDALSNNEYEFPGSQVKQTTFESTVANG 54
           FKKNL TI  L N+K S + N    C       + L++ ++   G++ K+T F+ T   G
Sbjct: 241 FKKNLYTIYYLENVKVSLAINTEHLCLSIFNKSEKLTDFQFVLTGARAKRTKFQQTGHAG 300

Query: 55  VIYTDSNN 62
           +I    +N
Sbjct: 301 LIILAQSN 308

>YDR407C Chr4 complement(1284069..1287938) [3870 bp, 1289 aa] {ON}
           TRS120One of 10 subunits of the transport protein
           particle (TRAPP) complex of the cis-Golgi which mediates
           vesicle docking and fusion; involved in endoplasmic
           reticulum (ER) to Golgi membrane traffic
          Length = 1289

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 25/135 (18%)

Query: 143 GLCTFDMSTVD------------TPLGKTGVAVEVLHWYSDELTNIFKIKLNPPTIMNTS 190
           G   FD  T+D             P  KT V + +++ YSD LTN+  +K   PT++ + 
Sbjct: 65  GKLFFDFLTIDHDDALELFLYDFEPFRKTFVIIGLVNDYSDPLTNLNFMKEKYPTLI-SP 123

Query: 191 NLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRVEDIDNFLTQ- 249
           NL    S   + + Q I   E          + F S+  D+ + +E +  +   NFLT  
Sbjct: 124 NLVYASSTPTKELEQTIDTME----------NVFASSP-DMQKNIETIMCDIARNFLTAL 172

Query: 250 SLYYTITQETSLQLP 264
           + YY+  +  +L+ P
Sbjct: 173 NSYYSSYKHVTLRSP 187

>Smik_8.158 Chr8 complement(239468..243550) [4083 bp, 1360 aa] {ON}
           YHR080C (REAL)
          Length = 1360

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 13/120 (10%)

Query: 454 LFTHDNISLSKHPKKGSPPTVKMVTEKVK--RGKVITRVSNF--EVFNIDAKDMSNELKV 509
           L + D+IS     K+ +    K+V E ++    K    V N   E FN D++    EL+ 
Sbjct: 292 LNSRDDISSENSRKQANATARKVVFEPIRNSHAKPTPGVGNLRLEHFN-DSQVTLEELEA 350

Query: 510 LCSGSTSIEELPNGSEVQVQGPHGDIVMEYFEKHGIPRKWF--------DYTNKVKPKKR 561
           + +GS + EE  N +E+ +     + +    EK  IPRK+           T  +KP++R
Sbjct: 351 VSTGSLAGEEHFNNNELSLNDNSHNAIKINVEKKPIPRKYSSKFSIVAPSTTEGIKPRRR 410

>CAGL0M10197g Chr13 (1019623..1020342) [720 bp, 239 aa] {ON} highly
           similar to uniprot|P33201 Saccharomyces cerevisiae
           YKL009w mRNA turnover 4
          Length = 239

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 28  DALSNNEYEFPGSQVKQTTFESTVANGVIYTDSNNVPIWFKQKYSNTIVPTVYTAWEYPN 87
           +A S  +Y  P S+    TFE  V  G++Y+    +PI      ++++ PT+   +E P 
Sbjct: 117 EAYSRLDYSRPNSRAP-ITFE--VPEGIVYSRGGQIPIEEDVPMAHSLEPTLRNKYEMPT 173

Query: 88  NI 89
            I
Sbjct: 174 KI 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,610,732
Number of extensions: 2768166
Number of successful extensions: 7649
Number of sequences better than 10.0: 69
Number of HSP's gapped: 7855
Number of HSP's successfully gapped: 69
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)