Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0I031908.268ON24124112701e-179
TPHA0J007708.268ON2782214935e-61
NCAS0B038108.268ON3142154801e-58
Smik_4.3608.268ON2852144762e-58
Kwal_56.237758.268ON2812214711e-57
KLLA0F19272g8.268ON2662234682e-57
YDR116C (MRPL1)8.268ON2852134693e-57
Suva_2.2758.268ON2852134693e-57
ZYRO0C01518g8.268ON2772174622e-56
Kpol_392.38.268ON2812214606e-56
Ecym_43028.268ON2752144519e-55
Skud_4.3768.268ON2852144521e-54
KNAG0H032108.268ON2852104451e-53
SAKL0H16896g8.268ON2852154423e-53
KLTH0G13552g8.268ON2812214414e-53
NDAI0J013308.268ON3142224271e-50
AGR080W8.268ON2752144232e-50
TDEL0F039508.268ON2762154213e-50
KAFR0B054808.268ON2802264162e-49
CAGL0B01815g8.268ON2902223693e-42
Kwal_56.23052na 1ON48599820.063
Skud_3.281.39ON35563780.15
KAFR0D003701.39ON37333740.57
AFL071C6.195ON35151711.2
Suva_3.1791.39ON35663701.8
YCL034W (LSB5)1.39ON35463683.4
Kwal_14.1917na 2ON14741645.6
NCAS0B088601.39ON39063656.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0I03190
         (241 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   493   e-179
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   194   5e-61
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   189   1e-58
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   187   2e-58
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   186   1e-57
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   184   2e-57
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   185   3e-57
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   185   3e-57
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   182   2e-56
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   181   6e-56
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   178   9e-55
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   178   1e-54
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   176   1e-53
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   174   3e-53
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   174   4e-53
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   169   1e-50
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   167   2e-50
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   166   3e-50
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   164   2e-49
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   146   3e-42
Kwal_56.23052 s56 complement(378274..379731) [1458 bp, 485 aa] {...    36   0.063
Skud_3.28 Chr3 (49532..50599) [1068 bp, 355 aa] {ON} YCL034W (REAL)    35   0.15 
KAFR0D00370 Chr4 (54870..55991) [1122 bp, 373 aa] {ON} Anc_1.39 ...    33   0.57 
AFL071C Chr6 complement(301720..302775) [1056 bp, 351 aa] {ON} S...    32   1.2  
Suva_3.179 Chr3 (272175..273245) [1071 bp, 356 aa] {ON} YCL034W ...    32   1.8  
YCL034W Chr3 (61658..62722) [1065 bp, 354 aa] {ON}  LSB5Protein ...    31   3.4  
Kwal_14.1917 s14 (525856..526299) [444 bp, 147 aa] {ON} [contig ...    29   5.6  
NCAS0B08860 Chr2 complement(1700937..1702109) [1173 bp, 390 aa] ...    30   6.8  

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  493 bits (1270), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MLTKLNFTLARQFHCSSTCFKARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQT 60
           MLTKLNFTLARQFHCSSTCFKARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQT
Sbjct: 1   MLTKLNFTLARQFHCSSTCFKARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQT 60

Query: 61  VVAAARGNTPLRGEINFHMLIRKPVIAVFTEDPEQHKIAKEMGIDIIGGSELIDKIASGE 120
           VVAAARGNTPLRGEINFHMLIRKPVIAVFTEDPEQHKIAKEMGIDIIGGSELIDKIASGE
Sbjct: 61  VVAAARGNTPLRGEINFHMLIRKPVIAVFTEDPEQHKIAKEMGIDIIGGSELIDKIASGE 120

Query: 121 QKITFQTAFATTDMVQDLARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKA 180
           QKITFQTAFATTDMVQDLARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKA
Sbjct: 121 QKITFQTAFATTDMVQDLARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKA 180

Query: 181 SFISFPVGKCSFTDEEILRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           SFISFPVGKCSFTDEEILRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL
Sbjct: 181 SFISFPVGKCSFTDEEILRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

Query: 241 F 241
           F
Sbjct: 241 F 241

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  194 bits (493), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 99/221 (44%), Positives = 147/221 (66%), Gaps = 1/221 (0%)

Query: 21  KARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHML 80
           +A++ + +HPL M+VP ALR+LRA E G+  S+QT+ L T+V + +G+  L G+I F   
Sbjct: 57  EAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTP 116

Query: 81  IRKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA 139
           +++  IA+FT D  Q KIAKE     ++GGSELI KI +GE ++ F  AFAT D+VQ+L 
Sbjct: 117 LKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELG 176

Query: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199
            VA+ LG + V P +KK TV +N+ +L++  L  +PF +  + IS  +GKC+F+D +IL 
Sbjct: 177 SVARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILE 236

Query: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           NLI  R+  + ++  Q  KKPS + K  L++THGPGI ID 
Sbjct: 237 NLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  189 bits (480), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 141/215 (65%), Gaps = 2/215 (0%)

Query: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88
           HPL M V  ALRY+RA E GR S +QT+TL ++V   +G  PL G I+    ++   +AV
Sbjct: 100 HPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAV 159

Query: 89  FTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146
           F+++ E   ++ ++    ++GG ELI+KI +GE K  F  AFA++DM   L A++ + LG
Sbjct: 160 FSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLG 219

Query: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206
           ++ +LP  KK TV D++  LL DK+  +PF +  + IS  +GKC F+DEEILRN+I AR 
Sbjct: 220 RRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARS 279

Query: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDLF 241
            + KAL EQ +KKPS + K TL+STHGPGI ID  
Sbjct: 280 AVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI 314

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  187 bits (476), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 2/214 (0%)

Query: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88
           +PL M V +ALRYLRA E GR  S+QT+ L T+V   RG  PL G + F   +R   +A 
Sbjct: 71  NPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAA 130

Query: 89  FTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146
           FT D  +  ++ K+    +IGG++L+ +I SGE  + F  AFAT D+V  L ++VA+ LG
Sbjct: 131 FTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILG 190

Query: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206
            + VLP LKK TV D+I  LL++ L  +PF ++ + IS  VGKC F+D EIL+N+I AR 
Sbjct: 191 PRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARS 250

Query: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
             + A+  Q +KKP+ + K TL+STHGPGI ID 
Sbjct: 251 AFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  186 bits (471), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 149/221 (67%), Gaps = 2/221 (0%)

Query: 22  ARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLI 81
           AR  + +HPL M V  ALR+LRA E+G+  S+QT+++ T+V + RG  PL G ++F   +
Sbjct: 60  ARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPL 119

Query: 82  RKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA- 139
           +   IAVFT D +Q +IA+E  G  ++GGS+L++KI  G   + F  +FAT ++   LA 
Sbjct: 120 KDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLAS 179

Query: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199
           ++ + LG + +LP  KK TV +N+  LL++ +  +PF ++ + +S  VGKCSFTD+++L 
Sbjct: 180 QLGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLE 239

Query: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           N++ A++GL++AL  Q  KKPS + + TLTSTHGPGI ID 
Sbjct: 240 NILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVIDF 280

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  184 bits (468), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 144/223 (64%), Gaps = 2/223 (0%)

Query: 20  FKARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHM 79
            +A+  + +HPL M V  ALRYLRAIE G+ +S+QT+TL T+V A RG  PL G ++F  
Sbjct: 43  LQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGK 102

Query: 80  LIRKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL 138
            ++   +AVFT D  Q  + K+   + ++GGS+L+ +I +GE  I F  AFAT D+V  L
Sbjct: 103 PLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQL 162

Query: 139 A-RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEI 197
           A +V + LG + +LP  KK TV +++  L++D +  VPF ++ + IS  V K  FTD+E+
Sbjct: 163 ASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEV 222

Query: 198 LRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           L NL+  ++  ++++  Q  KKPS + + TLTSTHGPGI ID 
Sbjct: 223 LENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVIDF 265

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  185 bits (469), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 136/213 (63%), Gaps = 2/213 (0%)

Query: 30  PLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVF 89
           PL M V  ALRYLRA E GR  S+QT+ L T+V   RG  PL G + F   +R   IA F
Sbjct: 72  PLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAF 131

Query: 90  TEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLGK 147
           T D  +  ++ ++    +IGG++L+ KI SGE  + F  AFAT D+V  L ++VA+ LG 
Sbjct: 132 TNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGP 191

Query: 148 QKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG 207
           + VLP +KK TV D+I  LLQ+ L  +PF ++ + IS  VGKC FTD EIL+N+I AR  
Sbjct: 192 RGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAA 251

Query: 208 LQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
            + A+  Q +KKP+ + K TL+STHGPGI ID 
Sbjct: 252 FKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  185 bits (469), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 136/213 (63%), Gaps = 2/213 (0%)

Query: 30  PLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVF 89
           PL M V +ALRYLRA E GR  S+QT+ L T+V   RG  P+ G + F   +R   +AVF
Sbjct: 72  PLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVF 131

Query: 90  TEDPEQHKIAKEMGID-IIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLGK 147
           T D  + K  +E   + I+GG++L+ KI + E  + F  AFAT D+V  L ++VA+ LG 
Sbjct: 132 TNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGP 191

Query: 148 QKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG 207
           + VLP +KK TV D+I  LLQ+ L  +PF ++ + IS  +GKC FTD E+L+N+I AR  
Sbjct: 192 RGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTA 251

Query: 208 LQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
            + A+  Q  KKPS + K TL+STHGPGI ID 
Sbjct: 252 FRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDF 284

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  182 bits (462), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 140/217 (64%), Gaps = 2/217 (0%)

Query: 26  SKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPV 85
           +  HPL M  PLALRYLRA+E G  +S+Q +T+ T V A RGN P+ G ++    ++  +
Sbjct: 60  AHTHPLYMPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVL 119

Query: 86  IAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQ 143
           +AVF+ D +Q  +A++     ++GGS++I KI  GE  + F  AFAT D+ Q+L ++VA+
Sbjct: 120 VAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVAR 179

Query: 144 KLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIK 203
            LG ++VLP  K+ TV  ++  L++D    +PF +K + IS  V KC F+D ++L NL+ 
Sbjct: 180 ILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLA 239

Query: 204 AREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
            +   ++A+  Q  K+PS + + TLT+THGPGI IDL
Sbjct: 240 VQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  181 bits (460), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 144/221 (65%), Gaps = 2/221 (0%)

Query: 22  ARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLI 81
           AR  + ++PL M +  ALRYLRA E G+  S+Q +T+ T V + RGN  L G I+++  I
Sbjct: 60  ARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPI 119

Query: 82  RKPVIAVFTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-A 139
           +   IAVF+ DPE+  KI +E    +IGG++L++KI SG+Q + F  AFAT D+   L +
Sbjct: 120 KDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTS 179

Query: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199
           ++A+ LG + VLP +KK TV +++  L++  + ++PF +  + IS  VG+C+F+D++IL 
Sbjct: 180 QLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILE 239

Query: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           N+I  R      L  Q +KKPS + K T+TSTHGPGI ID 
Sbjct: 240 NIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDF 280

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  178 bits (451), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 141/214 (65%), Gaps = 2/214 (0%)

Query: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88
           HPL M V  A R+LRA E G+  S+QT++L TVV + +G   L G I F   +R   +AV
Sbjct: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120

Query: 89  FTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146
           FT + EQ ++A+E     ++GG+ELI+ I +G+  I F  A AT D+V  L +++A  LG
Sbjct: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180

Query: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206
            +++LP +KK TV +NI  L+++ ++ VPF ++  F+S  VGKC F+D+++L+N++  ++
Sbjct: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240

Query: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
             ++AL +Q  KK S + K T+TSTHGPGI ID 
Sbjct: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 98/214 (45%), Positives = 140/214 (65%), Gaps = 2/214 (0%)

Query: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88
           +PL M V +ALRYLRA E GR  S+QT+ L T+V   RG  PL G + F   +R   +AV
Sbjct: 71  NPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAV 130

Query: 89  FTEDPEQHKIAKEMGID-IIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146
           FT D  + K  +E   + +IGG++L+ +I +GE  + F  A+AT D+V  L ++VA+ LG
Sbjct: 131 FTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILG 190

Query: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206
            + VLP +KK TV D+I  LLQ+ L  +PF ++ + IS  +GKC FTD E+L+N+I AR 
Sbjct: 191 PRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARA 250

Query: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
             + A+ +Q +KKP+ + K TL+STHGPGI ID 
Sbjct: 251 AFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  176 bits (445), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 144/210 (68%), Gaps = 2/210 (0%)

Query: 33  MEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVFTED 92
           + VP A+R LRA+E G+ +S+QT+TL T+V + +G  PL G++     ++   IA F+ D
Sbjct: 75  LSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSAD 134

Query: 93  PEQHK-IAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLGKQKV 150
           PE  K + +E+ ++I+GG+ELID++ SGE  + F  AFAT D+   L +++   LG++ +
Sbjct: 135 PELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQLNSKLGALLGRRGL 194

Query: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210
           LP +KK TVG ++  +++ K+  +PF ++A+ ++F + KC F+D ++L NLI ARE  Q 
Sbjct: 195 LPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQVLGNLIAAREAFQL 254

Query: 211 ALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           A++ Q +KK S + ++TL+STHGPGI IDL
Sbjct: 255 AIQNQKSKKRSILGRSTLSSTHGPGIVIDL 284

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  174 bits (442), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 139/215 (64%), Gaps = 2/215 (0%)

Query: 28  NHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIA 87
           +HPL M V  ALR+LRA E G+  S+QT++L T+V + RG   L G I+F   ++   IA
Sbjct: 70  DHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIA 129

Query: 88  VFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKL 145
           VFT D ++ KIA++     ++GGSELI+KI  GE  + F  AFAT D+   L +++ + L
Sbjct: 130 VFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRIL 189

Query: 146 GKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAR 205
           G + +LP  KK TV ++I  L++D +  +PF ++ + IS  V KCSFTD ++L N++ A+
Sbjct: 190 GPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQ 249

Query: 206 EGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           +  + AL  Q  KKPS + + TLT+THGPG+ ID 
Sbjct: 250 KSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDF 284

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  174 bits (441), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 145/221 (65%), Gaps = 2/221 (0%)

Query: 22  ARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLI 81
           AR  +  HPL M V  ALR+LRA E G+  S+QT+++ T+V + RG   L G ++F   +
Sbjct: 60  ARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNAL 119

Query: 82  RKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA- 139
           ++  IAVFT D +Q +IA+E     ++GGSEL++KI  G+  + F  +FAT ++   LA 
Sbjct: 120 KELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLAS 179

Query: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199
           ++ + LG + +LP  KK TV +N+  L++D +  +PF ++ + IS  VG+CSFTD+++L 
Sbjct: 180 QLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLE 239

Query: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           N++ A++ +++AL  Q  KKPS + + TLTST GPGI ID 
Sbjct: 240 NIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDF 280

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  169 bits (427), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 141/222 (63%), Gaps = 2/222 (0%)

Query: 21  KARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHML 80
           +AR  + +HPL MEV  ALR++RA E GR   +QT+TL T++ + +G + L G +     
Sbjct: 92  QARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRP 151

Query: 81  IRKPVIAVFTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL- 138
           +++  IAVF+ D E   ++  +    ++GG+E ++ I  G  +  F  AFAT ++V  + 
Sbjct: 152 LKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFIN 211

Query: 139 ARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEIL 198
           +++ ++LG++ +LP  KK TV D++  L+  K+  +PF +  + IS P+GKC F+D++IL
Sbjct: 212 SQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDIL 271

Query: 199 RNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
            N+I AR+  ++AL  Q  K+PS + K TL+STHGPGI ID 
Sbjct: 272 LNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVIDF 313

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  167 bits (423), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 133/214 (62%), Gaps = 2/214 (0%)

Query: 30  PLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVF 89
           PL M V  ALR+LRA E G+ +++QT+++ T+V   +G   L G +     +R+  +AVF
Sbjct: 61  PLYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVF 120

Query: 90  TEDPEQHKIAK-EMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDLA-RVAQKLGK 147
           T DPEQ + A+ + G  ++GG+EL++++ SGE K+ F  AFAT D+   +A ++ + LG 
Sbjct: 121 TNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGP 180

Query: 148 QKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG 207
           + +LP +KK TV  ++ ELL D +   PF ++ + IS  +GKC F+D +I+ NL+  +  
Sbjct: 181 KGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAA 240

Query: 208 LQKALREQNNKKPSTIIKATLTSTHGPGIDIDLF 241
            + A+  Q  KK S     TLTSTHGPGI ID  
Sbjct: 241 FRAAMTSQKTKKTSLFGTTTLTSTHGPGIVIDFL 274

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  166 bits (421), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 142/215 (66%), Gaps = 2/215 (0%)

Query: 28  NHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIA 87
           +HPL M +P+ALR+LRA E G+  ++QT+TL T V A RG   L G ++F   +++  IA
Sbjct: 61  DHPLYMSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIA 120

Query: 88  VFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKL 145
           VF+ D +Q K+A+E     ++GG+E+I+KI SGE  + F  AFAT D+   L +++A+ L
Sbjct: 121 VFSGDEDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARIL 180

Query: 146 GKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAR 205
           G + VLP +KK TV  ++  L+QD +  +PF ++ + IS  VGK SF+D +IL N I   
Sbjct: 181 GPRGVLPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATH 240

Query: 206 EGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           + +++AL  Q +KK S + K TL+STHGPGI ID 
Sbjct: 241 DAVKEALANQVSKKTSLLGKTTLSSTHGPGIVIDF 275

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  164 bits (416), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 139/226 (61%), Gaps = 9/226 (3%)

Query: 21  KARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHML 80
           +AR  + NHPL M+VP ALR+LRA+E G+  S+QT+TL T+V + +G  P+ G +     
Sbjct: 57  QAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTP 116

Query: 81  IRKPVIAVFTEDPEQHKIAKE--MGIDIIGGSELIDKIASGEQKITFQTAFATTDMV--- 135
           +R   + V ++DP++ +  ++    + ++GG EL+DK  + + +I F    AT D++   
Sbjct: 117 LRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYT 176

Query: 136 -QDLARVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTD 194
            Q+L ++    G + +LP +KK TV +N+ EL+ + +  +PF ++A  IS  +GK  F+D
Sbjct: 177 NQNLGKM---FGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSD 233

Query: 195 EEILRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
           ++IL N+I  RE     L  Q  KK ST+ K TLTSTHGPGI ID 
Sbjct: 234 KQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDF 279

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  146 bits (369), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 137/222 (61%), Gaps = 12/222 (5%)

Query: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88
           HPL M +PLALRYLR+ E GR +  QT+T+ T+V A +GN  L G I F   +++  IA+
Sbjct: 70  HPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAI 129

Query: 89  FTEDPEQ-----HKIAKEMGIDIIGGSELIDKIASGEQKIT-FQTAFATTDMVQDLA-RV 141
           F+ + E+      K +K+  + I GG ++I  I SG+ K+      FAT ++   +A ++
Sbjct: 130 FSSNKEKLDELKSKYSKQ--VKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQL 187

Query: 142 AQKLGKQKVLPQLKKK---TVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEIL 198
            + LG + ++P LKK+   TVG+++  L+++ L  V F ++ + +S  VG+C+F+D +IL
Sbjct: 188 GRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDIL 247

Query: 199 RNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240
            N+I  R   ++++  Q  KKPS + K T+++T GPGI ID 
Sbjct: 248 ENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDF 289

>Kwal_56.23052 s56 complement(378274..379731) [1458 bp, 485 aa] {ON}
           YDR338C - Hypothetical ORF [contig 183] FULL
          Length = 485

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 13/99 (13%)

Query: 24  ILSKNHPLKMEVPLAL------RYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINF 77
           +++    L  EVP ++      R    I  GR    Q  T  T+V+ A     + G  NF
Sbjct: 303 VIASIQTLTFEVPFSVGVAASNRIAYYIGKGRLRDCQIATRTTLVSLA----CVVGIANF 358

Query: 78  HMLI--RKPVIAVFTEDPEQHKIAKEMGIDIIGGSELID 114
             LI  R  + A+F+ DPE  +IA ++ + IIG ++++D
Sbjct: 359 STLILGRHAIPAIFSNDPEVIRIASQV-LPIIGLNQILD 396

>Skud_3.28 Chr3 (49532..50599) [1068 bp, 355 aa] {ON} YCL034W (REAL)
          Length = 355

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210
           +PQ+        IR ++ D L     + + S I  P GKCS  DEE     I+AR   +K
Sbjct: 204 IPQINLNKEAPKIRLIISDAL-ASAVSLQNSLIGLPRGKCSTDDEEATSKFIQARAIRRK 262

Query: 211 ALR 213
            LR
Sbjct: 263 VLR 265

>KAFR0D00370 Chr4 (54870..55991) [1122 bp, 373 aa] {ON} Anc_1.39
           YCL034W
          Length = 373

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 181 SFISFPVGKCSFTDEEILRNLIKAREGLQKALR 213
           S I+ P GK +  DEE+    +KAR+  +K LR
Sbjct: 236 SLITLPAGKNAMDDEEVTEKFVKARDIRRKVLR 268

>AFL071C Chr6 complement(301720..302775) [1056 bp, 351 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL082W and
           YPL191C
          Length = 351

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 175 PFAEK-ASFI--SFPVGKCSFTDEEILRNLIKAREGLQ-KALREQNNKKPS 221
           PFA+K A+F   S P      TDEE+ R+L +  +GL  ++L+ Q  + PS
Sbjct: 282 PFADKNATFSAPSLPPDSAFLTDEELARHLQQEEDGLYVRSLQRQQERSPS 332

>Suva_3.179 Chr3 (272175..273245) [1071 bp, 356 aa] {ON} YCL034W
           (REAL)
          Length = 356

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210
           +P++        IR ++ D L     + + S I  P  KCS  DEE     I+AR   +K
Sbjct: 203 IPKINMNKEAPKIRLIISDAL-ASAVSLQNSLIGLPRAKCSTDDEEATSKFIQARAIRRK 261

Query: 211 ALR 213
            LR
Sbjct: 262 VLR 264

>YCL034W Chr3 (61658..62722) [1065 bp, 354 aa] {ON}  LSB5Protein of
           unknown function; binds Las17p, which is a homolog of
           human Wiskott-Aldrich Syndrome protein involved in actin
           patch assembly and actin polymerization; may mediate
           disassembly of the Pan1 complex from the endocytic coat
          Length = 354

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210
           +PQ+        IR ++ D L     + + S I  P GK S  DEE     I+AR   +K
Sbjct: 203 IPQINMNKEAPRIRLIISDAL-ASAVSLQNSLIGLPKGKFSTDDEEATSKFIQARAIRRK 261

Query: 211 ALR 213
            LR
Sbjct: 262 VLR 264

>Kwal_14.1917 s14 (525856..526299) [444 bp, 147 aa] {ON} [contig
           232] FULL
          Length = 147

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%)

Query: 88  VFTEDPEQHKIAKEMGIDIIGGSELIDKIASGEQKITFQTA 128
           +F  +P      KE+GI   G S    K+  G  KI FQTA
Sbjct: 63  IFAPEPSNRGFLKELGIVESGSSLEWQKLVPGIYKIRFQTA 103

>NCAS0B08860 Chr2 complement(1700937..1702109) [1173 bp, 390 aa]
           {ON} Anc_1.39 YCL034W
          Length = 390

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210
           +PQ+  K  G  I +++ D L     A + + I  P G  +  DE      I+AR   +K
Sbjct: 240 IPQIDLKKEGPKISQIISDSL-AAAVALQNALIVLPSGMSALDDENCTSKFIQARAIRRK 298

Query: 211 ALR 213
            LR
Sbjct: 299 VLR 301

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,975,319
Number of extensions: 893331
Number of successful extensions: 2712
Number of sequences better than 10.0: 39
Number of HSP's gapped: 2744
Number of HSP's successfully gapped: 39
Length of query: 241
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 135
Effective length of database: 41,326,803
Effective search space: 5579118405
Effective search space used: 5579118405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)