Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0I016905.707ON32032015760.0
NCAS0G002105.707ON2881091475e-10
TPHA0E001805.707ON165951401e-09
Suva_9.365.707ON2241041154e-06
YIL152W5.707ON2351001065e-05
TDEL0B021305.707ON208981049e-05
ZYRO0B16434g5.707ON2371261059e-05
Smik_9.175.707ON2511001041e-04
Skud_9.165.707ON2261001003e-04
KAFR0D022005.707ON18299930.002
NDAI0F002705.707ON298106950.002
KNAG0L021605.707ON209106900.005
Kpol_1043.745.707ON177101810.064
KLTH0E10296g8.442ON154063750.77
KLTH0E01540gna 1ON71185721.9
NOTE: 5 genes in the same pillar as TBLA0I01690 were not hit in these BLAST results
LIST: KLTH0E00946g Kwal_55.19675 KLLA0A00506g Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0I01690
         (320 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...   611   0.0  
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    61   5e-10
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    59   1e-09
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     49   4e-06
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    45   5e-05
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    45   9e-05
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    45   9e-05
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     45   1e-04
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     43   3e-04
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    40   0.002
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    41   0.002
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    39   0.005
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    36   0.064
KLTH0E10296g Chr5 (927506..932128) [4623 bp, 1540 aa] {ON} conse...    33   0.77 
KLTH0E01540g Chr5 (152132..154267) [2136 bp, 711 aa] {ON} weakly...    32   1.9  

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/320 (95%), Positives = 307/320 (95%)

Query: 1   MSSQRSSIRRGFCIYQNPYXXXXXXXXXXXXXIETLDNSPKITLSHHNDKLVKTQLHFLD 60
           MSSQRSSIRRGFCIYQNPY             IETLDNSPKITLSHHNDKLVKTQLHFLD
Sbjct: 1   MSSQRSSIRRGFCIYQNPYNNNSSSSVSSVSSIETLDNSPKITLSHHNDKLVKTQLHFLD 60

Query: 61  QNGVTLNSNTKNFPTKSAFGGKHPLLTSFTNEQTSRLIKKHSNSINNGSVSLNSFDNILH 120
           QNGVTLNSNTKNFPTKSAFGGKHPLLTSFTNEQTSRLIKKHSNSINNGSVSLNSFDNILH
Sbjct: 61  QNGVTLNSNTKNFPTKSAFGGKHPLLTSFTNEQTSRLIKKHSNSINNGSVSLNSFDNILH 120

Query: 121 NSKSNKRDNSLQPLTAAISPRSSANRRHVGHSSIICDEQNDLFLKYFQDAFDIRLKKHKL 180
           NSKSNKRDNSLQPLTAAISPRSSANRRHVGHSSIICDEQNDLFLKYFQDAFDIRLKKHKL
Sbjct: 121 NSKSNKRDNSLQPLTAAISPRSSANRRHVGHSSIICDEQNDLFLKYFQDAFDIRLKKHKL 180

Query: 181 APNISKLRPHLRFLGKKYTKHKSIKQNFLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRI 240
           APNISKLRPHLRFLGKKYTKHKSIKQNFLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRI
Sbjct: 181 APNISKLRPHLRFLGKKYTKHKSIKQNFLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRI 240

Query: 241 HSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTIGQSEFNNYTLKEKVATN 300
           HSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTIGQSEFNNYTLKEKVATN
Sbjct: 241 HSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTIGQSEFNNYTLKEKVATN 300

Query: 301 SISILKITEDLNWYLKWKFI 320
           SISILKITEDLNWYLKWKFI
Sbjct: 301 SISILKITEDLNWYLKWKFI 320

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLL-LHSDSTI 283
            V  L   L +L+T + +S+   +D ++ I+ +TKLSD EL V T  +  L+ LH+ ++I
Sbjct: 177 FVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSI 236

Query: 284 GQSEFNNY------------TLKEKVATNSISILKITEDLNWYLKWKFI 320
                  +            T   K+A NS S +K+++D+NWY+ WKFI
Sbjct: 237 NNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 226 VNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTIGQ 285
           V+ L   ++  N  + +S N K+D+I  I+ + KLS  E +V T  + +L+LHS+     
Sbjct: 59  VSDLRLSINKFNMLLKASSN-KYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEK-NV 116

Query: 286 SEFNNYTLK-EKVATNSISILKITEDLNWYLKWKF 319
              NNYTLK ++VA NS   L +  DLNWYL WKF
Sbjct: 117 VNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 59/104 (56%), Gaps = 13/104 (12%)

Query: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDSTI 283
           LV+ LH+ + +L+T + + +  +FD I   +S  T LS  ELL+  +T  +++LHS + I
Sbjct: 126 LVSQLHSSVKDLDTIVQTHKP-RFDTIIHDLSHTTILSPNELLIKLHTEDTIILHSRTPI 184

Query: 284 GQSEFNNYTLKEKVA-------TNSISILKITEDLNWYLKWKFI 320
             +E+    L+ KV+        +S S L +  ++ WYL WKFI
Sbjct: 185 INAEW----LRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 56/100 (56%), Gaps = 5/100 (5%)

Query: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDSTI 283
           LV+ LH+ + +L+  I + +  KFD I +  S+ T LS  ELL+    + +++LHS +  
Sbjct: 137 LVSQLHSSVKDLDAIIQTHKP-KFDTIIRDFSQATILSSNELLIKLPKDQTIILHSRAPK 195

Query: 284 GQSEFNNYTLKEKVAT---NSISILKITEDLNWYLKWKFI 320
             +E+    + +  A+   +S S L +  ++ WYL WKFI
Sbjct: 196 INAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 9/98 (9%)

Query: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLVITNTNSSLLLHSDSTI- 283
           L   +   LS+LNTRI      + D++    +L  LS  ELLV+T      +LHS   + 
Sbjct: 116 LSTAVSVALSHLNTRIQVLSG-ELDQLMAFERLVLLSQHELLVVTQ-RKIFVLHSVIPLT 173

Query: 284 --GQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKF 319
             G S F       K+A NS     +  D+ W+++WKF
Sbjct: 174 REGVSRFGAL----KLAVNSQCYYVLYNDVVWFMRWKF 207

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 10/126 (7%)

Query: 198 YTKHKSIKQNFLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRIHSSR-NLKFDKIFQISK 256
           YT  + I+ +  K A S    +  KT LV  L   L++ N  + +S+ N  +D +  I  
Sbjct: 119 YTLRRRIRDDNEKCASSA---DKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRH 175

Query: 257 LTKLSDTELLVITNTN--SSLLLHSDSTIGQSEFNNYTLKEKVATNSISILKITEDLNWY 314
              LS  E++VI++       +LHS   I +  F N     ++A  S   L +  D+NWY
Sbjct: 176 AIWLSPFEIMVISDDPRVKRAILHSHKAIPK--FVNSP--SRLAICSKCCLTLYNDMNWY 231

Query: 315 LKWKFI 320
           LKWKF+
Sbjct: 232 LKWKFL 237

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDS-T 282
           LV+ LH+ + +L+  I + +  KFD I   +S+ T LS  ELL+      +++LHS + T
Sbjct: 153 LVSQLHSSVKDLDAIIQTHKP-KFDTIIHDLSRTTILSSNELLIKLPMEETIILHSRTPT 211

Query: 283 IGQSEFNNYT--LKEKVATNSISILKITEDLNWYLKWKFI 320
           I +   +N        +  +S S L +  ++ WYL WKFI
Sbjct: 212 INEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDSTI 283
           LV+ LHT + +L+T + + +  +FD I   +S    LS  ELL+    N +++LHS    
Sbjct: 128 LVSQLHTSVKDLDTIVQTHKP-RFDTIIHDLSHTAILSSNELLIKLPMNDTIILHSRIPK 186

Query: 284 GQSEFNNYTLKEKVAT---NSISILKITEDLNWYLKWKFI 320
             +E+ +    +  A+   +S S L +  ++ WYL WKFI
Sbjct: 187 INAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 225 LVNGLHTILSNLNTRIHSSRN-LKFDKIFQISKLTKLSDTELLVITNTNSSL--LLHSDS 281
           L   L   L +LN  +  S+N  K+D + +++   +LS TE+L+I +T+ ++  +LH   
Sbjct: 84  LAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPL 143

Query: 282 TIGQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKFI 320
           T   +  +N+T    +A NS    ++ + L W L WK +
Sbjct: 144 TFRTNSVDNFT-GAHLALNSKISFRLDDTLIWCLNWKLL 181

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 8/106 (7%)

Query: 223 TPLVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTELLV--ITN------TNSS 274
           + L+  L   L +L+T + +     +D +  ++    LSD E+ +  + N      T+ +
Sbjct: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDVT 252

Query: 275 LLLHSDSTIGQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKFI 320
           +LLHS  ++     NN     K+A +S   L++  ++ WYL WKFI
Sbjct: 253 MLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 12/106 (11%)

Query: 223 TP-LVNGLHTILSNLNTRIHSSRNLK-FDKIFQISKLTKLSDTELLVITNTNSS-LLLHS 279
           TP LV  L   L  LN  + ++ + + +D +  ++   KLS  EL++ T  +S   +LHS
Sbjct: 104 TPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHS 163

Query: 280 DSTI-----GQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKFI 320
           +  +      Q     YT    VA  S   +++T DL W L+WK +
Sbjct: 164 NGPVHGFLLDQIASGGYT----VALYSKLAVRVTPDLYWCLQWKLV 205

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 223 TPLVNGLHTILSNLNTRIHSSRNLKFDKIFQISKLTKLSDTEL--LVITN---TNSSLLL 277
           +P +  LH  L   NT + S   LKFD ++ I     LS  ++  LV+ +   T + +L 
Sbjct: 75  SPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILY 134

Query: 278 HSDSTIGQSEFNNYTLKEKVATNSISILKITEDLNWYLKWK 318
            +++    +     T   K+A NS S + +  ++NWYL W+
Sbjct: 135 KNNNNNNNANITLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175

>KLTH0E10296g Chr5 (927506..932128) [4623 bp, 1540 aa] {ON}
           conserved hypothetical protein
          Length = 1540

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 76  KSAFGGKHPLLTSFTNEQTSRLIKKHSNSINNGSVSLNSFDNILHNSKSNKRDNSLQPLT 135
           +SA GG+  L +     ++ R ++K + +I+NG   L S DN+ H     K  N L+PL 
Sbjct: 732 QSATGGEKALASEM---KSPRRLRKSAKNISNGK--LRSLDNVRHTRTGAKIINPLKPLP 786

Query: 136 AAI 138
            A+
Sbjct: 787 EAV 789

>KLTH0E01540g Chr5 (152132..154267) [2136 bp, 711 aa] {ON} weakly
           similar to uniprot|Q08905 Saccharomyces cerevisiae
           YOR381w FRE3 protein Ferric reductase, reduces
           siderophore-bound iron prior to uptake by transporters
          Length = 711

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 193 FLGKKYTKHKSIKQNFLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRIHSSRNLKFDKIF 252
           ++G    +  S+   F KV  + SY+ Y + P  N + +  S  N  + SS+N K  + F
Sbjct: 29  YVGFSCKRALSVTAKFCKVDTATSYDCYCEEP--NAIASFFSCTNENLKSSKNRKAMEDF 86

Query: 253 QISKLTKLSDTELLVIT-NTNSSLL 276
              +   ++D+E+  +T N +SSL+
Sbjct: 87  FQFRCPNITDSEMRSVTQNLSSSLV 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,264,356
Number of extensions: 1653839
Number of successful extensions: 10184
Number of sequences better than 10.0: 255
Number of HSP's gapped: 10591
Number of HSP's successfully gapped: 265
Length of query: 320
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 210
Effective length of database: 40,868,139
Effective search space: 8582309190
Effective search space used: 8582309190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)