Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0I016805.700ON1214121454080.0
YIL147C (SLN1)5.700ON122077318380.0
Kpol_2001.745.700ON111373617990.0
TPHA0D045905.700ON112774217960.0
Smik_9.225.700ON123076818020.0
Suva_9.415.700ON121977117790.0
Skud_9.215.700ON122177217740.0
KAFR0D022405.700ON118774217510.0
NCAS0G002505.700ON118375317270.0
KLLA0A00638g5.700ON115574217200.0
SAKL0E14872g5.700ON114075317090.0
TDEL0B022105.700ON109573416740.0
Ecym_40205.700ON112574516230.0
AFR284W5.700ON110374216210.0
KNAG0L021105.700ON120046713211e-161
ZYRO0G06644g5.700ON116646013181e-161
NDAI0F003105.700ON125949113141e-159
Kwal_55.197075.700ON114354412821e-156
CAGL0H06567g5.700ON116945212661e-153
Kpol_1043.685.700ON104246811411e-136
TPHA0E002505.700ON106845211031e-131
KLTH0E01100g5.700ON117736210751e-126
TBLA0E021005.700ON11404349491e-108
Ecym_50775.230ON7951521425e-08
ADR343C5.230ON7491521391e-07
KNAG0M001804.385ON6151211382e-07
TDEL0E039805.230ON7301441372e-07
CAGL0F09097g4.385ON6301211328e-07
KAFR0B069904.385ON5451211291e-06
ADL388W4.385ON4821211272e-06
Ecym_74744.385ON4961211272e-06
SAKL0B12408g4.385ON4651211263e-06
KLLA0A10219g4.385ON4751211263e-06
YHR206W (SKN7)4.385ON6221211263e-06
Smik_8.2964.385ON6251211264e-06
CAGL0D02882g5.230ON6671401264e-06
KAFR0J007005.230ON6201181255e-06
Suva_15.4124.385ON6171211255e-06
NDAI0D034304.385ON5971421255e-06
Skud_8.2734.385ON6231211246e-06
TDEL0D003204.385ON5471211246e-06
KNAG0B051405.230ON6481191246e-06
ZYRO0G00484g4.385ON6471211238e-06
Kpol_265.24.385ON5491881211e-05
KLTH0D17182g4.385ON464691211e-05
TBLA0A107004.385ON587691211e-05
NCAS0D029005.230ON7621311211e-05
NCAS0A064504.385ON6091211202e-05
TPHA0C001504.385ON5101851192e-05
Kwal_47.167704.385ON4611211183e-05
Kwal_33.152885.230ON5871351183e-05
Suva_10.845.230ON6951391184e-05
Smik_12.685.230ON7121391174e-05
Skud_12.725.230ON7021391175e-05
YLR006C (SSK1)5.230ON7121391175e-05
KLTH0B02684g5.230ON5951341165e-05
ZYRO0A11154g5.230ON7761501167e-05
TPHA0N008505.230ON6701401158e-05
Kpol_1004.45.230ON7141421159e-05
KLLA0E09505g5.230ON635751094e-04
NDAI0I020005.230ON8901351050.001
SAKL0G12100g5.230ON738761000.004
TBLA0D031705.230ON76584960.015
KLLA0E04533g7.222ON42179850.21
Klac_YGOB_Anc_8.348.34ON157178860.26
SAKL0F08184g7.222ON41279830.40
TBLA0D037401.507ON839114820.68
KLTH0G18612g8.34ON152471810.92
Suva_9.1587.222ON393114762.8
KNAG0D017507.222ON40998735.4
ACR218W8.34ON156975736.8
Skud_6.388.34ON175875738.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0I01680
         (1214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....  2087   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   712   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   697   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   696   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   698   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   689   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   687   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   679   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   669   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   667   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   662   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   649   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   629   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   629   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   513   e-161
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   512   e-161
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   510   e-159
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   498   e-156
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   492   e-153
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   444   e-136
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   429   e-131
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   418   e-126
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   370   e-108
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    59   5e-08
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    58   1e-07
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    58   2e-07
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    57   2e-07
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    55   8e-07
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    54   1e-06
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    54   2e-06
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    54   2e-06
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    53   3e-06
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    53   3e-06
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    53   3e-06
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    53   4e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    53   4e-06
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    53   5e-06
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    53   5e-06
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     53   5e-06
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    52   6e-06
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    52   6e-06
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    52   6e-06
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    52   8e-06
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    51   1e-05
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    51   1e-05
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    51   1e-05
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    51   1e-05
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    51   2e-05
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    50   2e-05
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    50   3e-05
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    50   3e-05
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    50   4e-05
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    50   4e-05
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    50   5e-05
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    50   5e-05
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    49   5e-05
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    49   7e-05
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    49   8e-05
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    49   9e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    47   4e-04
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    45   0.001
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    43   0.004
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    42   0.015
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    37   0.21 
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    38   0.26 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    37   0.40 
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    36   0.68 
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    36   0.92 
Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON...    34   2.8  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    33   5.4  
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    33   6.8  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    33   8.0  

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score = 2087 bits (5408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1041/1214 (85%), Positives = 1041/1214 (85%)

Query: 1    MGPSRMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSI 60
            MGPSRMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSI
Sbjct: 1    MGPSRMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSI 60

Query: 61   AAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSS 120
            AAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSS
Sbjct: 61   AAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSS 120

Query: 121  DIFSISRLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVL 180
            DIFSISRLYDANFNLVMNATNNGTGNVVPNDV                     MLTDPVL
Sbjct: 121  DIFSISRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVL 180

Query: 181  NSTTYLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE 240
            NSTTYLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE
Sbjct: 181  NSTTYLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE 240

Query: 241  YSDYSASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDV 300
            YSDYSASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDV
Sbjct: 241  YSDYSASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDV 300

Query: 301  AIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVK 360
            AIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVK
Sbjct: 301  AIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVK 360

Query: 361  PIVRLQKATELIAEXXXXXXXXXXXXXXXXXXKFGRYXXXXXXXXXXXTFLXXXXXXXXX 420
            PIVRLQKATELIAE                  KFGRY           TFL         
Sbjct: 361  PIVRLQKATELIAEGRGLRSSSNRTLSRNGSLKFGRYSIDSPIIPISPTFLHNNNNHHRN 420

Query: 421  XXXXXXDPEKLXXXXXXXXXXXXXXXXXXRFHFVCIFFSSHKSSNTPPPPMSTILETKVP 480
                  DPEKL                  RFHFVCIFFSSHKSSNTPPPPMSTILETKVP
Sbjct: 421  SSNESHDPEKLSHLSNDISKSSNSSSTGSRFHFVCIFFSSHKSSNTPPPPMSTILETKVP 480

Query: 481  VYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXXXXXXKTVFI 540
            VYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQL             KTVFI
Sbjct: 481  VYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFI 540

Query: 541  ANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXXXXFSKNVLQ 600
            ANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSG            FSKNVLQ
Sbjct: 541  ANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTELLTFSKNVLQ 600

Query: 601  RTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRIIQIVMN 660
            RTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRIIQIVMN
Sbjct: 601  RTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRIIQIVMN 660

Query: 661  LVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKILQKLNTE 720
            LVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKILQKLNTE
Sbjct: 661  LVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKILQKLNTE 720

Query: 721  KLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDXXXXXXXXXX 780
            KLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDD          
Sbjct: 721  KLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDTLSLLSTSTS 780

Query: 781  XYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPF 840
             YDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPF
Sbjct: 781  SYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPF 840

Query: 841  VQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGX 900
            VQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIG 
Sbjct: 841  VQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGE 900

Query: 901  XXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXXXXXXXXXXFVGEIQNVN 960
                          YSKKNRKVKFAIPSSPGTTLA                FVGEIQNVN
Sbjct: 901  DEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSLNSSFVGEIQNVN 960

Query: 961  EAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPFLQSTGTATSTMKIPVLKDFS 1020
            EAEEDAYNSKDINSSGELKIRHI         IPSLDRPFLQSTGTATSTMKIPVLKDFS
Sbjct: 961  EAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPSLDRPFLQSTGTATSTMKIPVLKDFS 1020

Query: 1021 NSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXXXLVTEDNHV 1080
            NSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSS              LVTEDNHV
Sbjct: 1021 NSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHV 1080

Query: 1081 NQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGL 1140
            NQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGL
Sbjct: 1081 NQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGL 1140

Query: 1141 ESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGY 1200
            ESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGY
Sbjct: 1141 ESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGY 1200

Query: 1201 HLQNNTDTNKGLQK 1214
            HLQNNTDTNKGLQK
Sbjct: 1201 HLQNNTDTNKGLQK 1214

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/773 (52%), Positives = 473/773 (61%), Gaps = 96/773 (12%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + + E ++P YRRLF DELS+LT+TFNTM+DALDQHYALLEERVRARTKQL         
Sbjct: 503  ANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEA 562

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I++SLKLIFRSG          
Sbjct: 563  ANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTEL 622

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 623  LTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDS 682

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDKE S+   YKEV++K GTE  EN  
Sbjct: 683  NRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLE 742

Query: 712  KI----LQKL-NTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766
                  L  L N  K +   S+ +     R    I E+   I+  +  +N +    +++R
Sbjct: 743  TTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE---ITKRNTVANESIYKKVNDR 799

Query: 767  TR---DDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVED 823
             +   DD           YD  +FN QF K  G  D +   LG  I+ PKTWVI IEVED
Sbjct: 800  EKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVED 859

Query: 824  TGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSK 883
            TGPGI P+LQESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM LESKVG GSK
Sbjct: 860  TGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSK 919

Query: 884  FTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSS------------PG 931
            FTFT+PL QT+EI                   S+KNR+VKF++  S            P 
Sbjct: 920  FTFTLPLNQTKEISFADMEFPFEDEFNPE---SRKNRRVKFSVAKSIKSRQSTSSVATPA 976

Query: 932  TTLAXXXXXXXXXXXXXXXXFVGEIQNVNEAEEDAYNS-------------------KDI 972
            T  +                   ++ N N   E+  ++                    ++
Sbjct: 977  TNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEV 1036

Query: 973  NSSGELKIRHIXXXXXXXXXIPSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDE 1032
            N    L  +H            +LDRPFLQSTGTATS+  IP +K             D+
Sbjct: 1037 NEQNSLSSKHRSRHEGLGSV--NLDRPFLQSTGTATSSRNIPTVK-------------DD 1081

Query: 1033 GKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLE 1092
             K++ S K                                LV EDNHVNQEVIKRML LE
Sbjct: 1082 DKNETSVK-------------------------------ILVVEDNHVNQEVIKRMLNLE 1110

Query: 1093 KLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKY 1152
             + NI+LACDG+EA+ KVKE+TS     K   Y++IFMDVQMP++DGL STK+IR +L Y
Sbjct: 1111 GIENIELACDGQEAFDKVKELTS-----KGENYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1165

Query: 1153 TKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYHLQNN 1205
            T PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKLK IL EFC  Y  + N
Sbjct: 1166 TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKN 1218

 Score =  438 bits (1127), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 221/364 (60%), Positives = 275/364 (75%), Gaps = 1/364 (0%)

Query: 11  LRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVD 70
           L PP  IGIRTQLTALV  VA  SLIILAV TG+YFT NYK++R DRL IAA+LKSSQ+D
Sbjct: 11  LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 71  QTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYD 130
           QTLN+LYYQ Y+L+ RD LQ+++ +Y AGNKS+  W DS  V++KFLSSS++F ++++YD
Sbjct: 71  QTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYD 130

Query: 131 ANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSMS 190
           ++FN V+NATNNGTG+++P DV                     +LTDPVLNST YLMSMS
Sbjct: 131 SSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMS 190

Query: 191 LPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTE 250
           LPI ANPSIILTDS+VYGYITIIMSAE L SV+NDTTALE S +AI+S  Y+    + + 
Sbjct: 191 LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKA-SG 249

Query: 251 YHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFD 310
           YHFVFPPYG+   +    + ++N +F+  A  N K GS+ +T      + A+GYSPCSF+
Sbjct: 250 YHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFN 309

Query: 311 LVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATE 370
           LV+WVAIVSQPESVFLSP+TKL +II GTV+AI VFV  +T PL+HWAV+PIVRLQKATE
Sbjct: 310 LVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATE 369

Query: 371 LIAE 374
           LI E
Sbjct: 370 LITE 373

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/736 (53%), Positives = 465/736 (63%), Gaps = 99/736 (13%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            S +++ +VPVY R   DELSELTDTFN M++ALDQHY LLE+RVRARTKQL         
Sbjct: 458  SNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEA 517

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEEDD D IK +LKLIFRSG          
Sbjct: 518  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTEL 577

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVL+RT LE+RDFCIT++ALQIKSIFGKVA+DQHVKL I L+PN IR++VLWGDS
Sbjct: 578  LTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDS 637

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTE-PEENY 710
            NRIIQIVMNLVSNALKFTPIDGKV VR+ LLGEYD+E+S   DYKEV++K+GTE P  N 
Sbjct: 638  NRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNG 697

Query: 711  SKI------LQKLNTEKLIATRSA---RSCDNEERHNELI-GEKNDIISNNHQSSNTTFD 760
             K       +Q+L+ +  I   +A          + ++LI  E+ +  S+N  ++N   D
Sbjct: 698  KKTDMVRKKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNN---D 754

Query: 761  ISIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIE 820
            I I + T              YD+     QFKK   L D  EE LGVE+ EPKTWVI +E
Sbjct: 755  IEILSMT--------TSSTRSYDDAALQRQFKKTPDLDDK-EETLGVELSEPKTWVISVE 805

Query: 821  VEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGS 880
            VEDTGPGI P LQE+VFEPFVQGDQALSRQYGGTGLGLSICRQLATMM+GTM LES VG 
Sbjct: 806  VEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGV 865

Query: 881  GSKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXX 940
            GSKF FTVPL QTREI                   SKKNR++KF I  S  +  +     
Sbjct: 866  GSKFIFTVPLKQTREIHFDDEKFEDEFNAE-----SKKNRRIKFKIYDSSKSHDSN---- 916

Query: 941  XXXXXXXXXXXFVGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPF 1000
                               +E EE   +S+DI+SS                 +  LDRPF
Sbjct: 917  -------------------DEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKV-RLDRPF 956

Query: 1001 LQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXX 1060
            LQSTGTATS+ KIP L                         N   T I++ +        
Sbjct: 957  LQSTGTATSSQKIPTLI------------------------NKEDTNIEKSI-------- 984

Query: 1061 XXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPK 1120
                        LV EDNHVNQEVIKRML LEK+ NIDLACDG++A+ KVK +       
Sbjct: 985  ----------RILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLAD----- 1029

Query: 1121 KKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFL 1180
             + YYD+IFMDVQMP++DGL STK+IR +L Y  PIVALTAFA++ NIKECLD GMDGFL
Sbjct: 1030 NEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFL 1089

Query: 1181 SKPIKRPKLKDILNEF 1196
             KPIKRPKLK IL E+
Sbjct: 1090 GKPIKRPKLKQILQEY 1105

 Score =  450 bits (1157), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 220/368 (59%), Positives = 276/368 (75%), Gaps = 2/368 (0%)

Query: 7   FRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKS 66
           +R   +PP  I IR QLTALV  VA +SLIILAV TG+YFT NYK +R  RL+IAA+LKS
Sbjct: 5   WRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKS 64

Query: 67  SQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSIS 126
           SQ+DQTLN+L+YQC +L+ RDTLQ A+ NY AGNK+   W +S+ VV+KFLSSSD+F ++
Sbjct: 65  SQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVA 124

Query: 127 RLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYL 186
           RLYD NF  V+NATNNGTG+++PN+V                     +LTDPVLN + YL
Sbjct: 125 RLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYL 184

Query: 187 MSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSA 246
           MSMSLPIL NPSIIL+ S+VYGYITI+MSA+ L +VY + TALE SNV ++S  Y+D   
Sbjct: 185 MSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYND-QG 243

Query: 247 SLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSP 306
            +  +HFVF         + I YP+QNG++L  A+   K GSI KTK+ +N ++AIGYSP
Sbjct: 244 KVDGFHFVFEVENDDFSTL-IEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSP 302

Query: 307 CSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQ 366
           CSF L +WVA+V+QPE+VFLSPSTKL +II+GTVVAIAVFVC +TFPLSHWAVKPIVRLQ
Sbjct: 303 CSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQ 362

Query: 367 KATELIAE 374
           KATELI++
Sbjct: 363 KATELISQ 370

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/742 (53%), Positives = 465/742 (62%), Gaps = 96/742 (12%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + ++E +VPVY RL  DELSELTDTFNTM+DALDQHY LLEERVRARTKQL         
Sbjct: 470  ANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAES 529

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEEDD+D I+ +LKLIFRSG          
Sbjct: 530  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTEL 589

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE+RDFCIT+VALQIKSIFGK+AKDQHVKLSI L+PN +R+ VLWGDS
Sbjct: 590  LTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDS 649

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQ+VMNLVSNALKFTP+DG V VR++LLGEYD+E+SKA DYK+V+VK GTE   N S
Sbjct: 650  NRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNIS 709

Query: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDX 771
             +  + N +  I+ +S    +N+E     I  K+D   ++ +  N   D+ I    +   
Sbjct: 710  HLKTEENND--ISRKSETELNNDENETHTIS-KDDTADSSIKIGNE--DVEISEVDKMGM 764

Query: 772  XXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPA 831
                      YD+T    Q  K T L D DE +LGVE+KE KTWVI +EV+DTG GI P 
Sbjct: 765  ASLVTTSSKSYDDTALMKQLIKSTDLDD-DENKLGVELKEQKTWVISVEVKDTGSGIDPK 823

Query: 832  LQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLT 891
            LQESVFEPFVQGDQALSRQYGGTGLGLSIC+QL+TMMNGTM LES+VG GSKF FT+PL 
Sbjct: 824  LQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLK 883

Query: 892  QTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXXXXXXXXXX 951
            QTREI I                 SKKNRKVKF    S                      
Sbjct: 884  QTREISI----PDDELFNDEFNAVSKKNRKVKFKFSGSSS-------------------- 919

Query: 952  FVGEIQNVNEAEEDAYNSKDINSSG-ELKIRHIXXXXXXXXXI--------PS---LDRP 999
                          A + K  NS G  L  RH                   PS   L+RP
Sbjct: 920  --------------AKSIKTRNSIGSSLNNRHSTTSIDSSSSDSDEEDNVRPSSVRLNRP 965

Query: 1000 FLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSX 1059
            FLQSTGTATST  +P L   ++  +K+ V N   K DL                      
Sbjct: 966  FLQSTGTATSTQNVPTLNAHTDDKSKNKVLN---KMDL---------------------- 1000

Query: 1060 XXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNP 1119
                         LV EDNHVNQEVIKRMLKLE ++NIDLA DG++A+ K K ++     
Sbjct: 1001 ----------IYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLS----- 1045

Query: 1120 KKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGF 1179
            +    YD+IFMDVQMPR+DGL +TK+IR EL YT+PIVAL+AF  E N+KECLDVGM+ F
Sbjct: 1046 ENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDF 1105

Query: 1180 LSKPIKRPKLKDILNEFCPGYH 1201
            LSKPIKRP LK IL ++   + 
Sbjct: 1106 LSKPIKRPDLKIILKKYIEDFQ 1127

 Score =  409 bits (1051), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 202/368 (54%), Positives = 269/368 (73%), Gaps = 2/368 (0%)

Query: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67
           +   +PP  I IR QLTALV  VA +SLIILAV  G+YFT NYK+++  RL IAA+LK+S
Sbjct: 6   KKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKAS 65

Query: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127
           Q+DQTLN+LYYQCY+LS  +TLQ ++ +Y AGN SS+ WY+S +V+EKFL+SSD+FS++R
Sbjct: 66  QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125

Query: 128 LYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLM 187
           LYD NFN+++NATNN +GN VP  V                     + TDPVLN + +LM
Sbjct: 126 LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185

Query: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247
           SMSLPI ANPSIIL+DS++YGY+++IMSAE L SV+NDTTALE S V ++S +YS  + +
Sbjct: 186 SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS-ITTN 244

Query: 248 LTEYHFVFP-PYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSP 306
           L  ++F+F   Y    K  D++Y + N +F+Y+ + N K G++ KT  F     A+GYS 
Sbjct: 245 LEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSS 304

Query: 307 CSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQ 366
           CSF LV+W+AIV+QPE+ F   +TKL RII+G VVA+AVFVC +TFPLSHWAV+P++RLQ
Sbjct: 305 CSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQ 364

Query: 367 KATELIAE 374
           KATE IAE
Sbjct: 365 KATERIAE 372

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/768 (52%), Positives = 469/768 (61%), Gaps = 93/768 (12%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + + E ++P YRRLF DELS+LT+TFNTM+DALDQHYALLE+RVRARTKQL         
Sbjct: 503  ANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEA 562

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I++SLKLIFRSG          
Sbjct: 563  ANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTEL 622

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 623  LTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDS 682

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDK+ S+   +KEV VK GTE  E YS
Sbjct: 683  NRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITE-YS 741

Query: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKN-DIISNNHQSSNTTFDISIHNRTRD- 769
            +   K +    I++   +  D E     +   ++  II       NT  + +I+ R  D 
Sbjct: 742  EETNKCDIP--ISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRMNDA 799

Query: 770  ------DXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVED 823
                  D           YD+ +FN QF K  G  + +   LG  I+ PKTWVI IEVED
Sbjct: 800  EKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVED 859

Query: 824  TGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSK 883
            TGPGI P+LQESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MMNGTM LESKVG GSK
Sbjct: 860  TGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSK 919

Query: 884  FTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXX 943
            FTFT+PL QT+EI                   S+KNR+VKF +  S  +  +        
Sbjct: 920  FTFTLPLPQTKEISFANMDFPFEDEFNPE---SRKNRRVKFNVAKSIKSRQSTSSIATPA 976

Query: 944  XXXXXXXXFV-GEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIP-------- 994
                     V  EI + NE +   + + ++   G   I  I          P        
Sbjct: 977  TNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAE 1036

Query: 995  ---------------------SLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEG 1033
                                 +LDRPFLQSTGTATS+  +P ++D           ND  
Sbjct: 1037 SSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQD-----------ND-- 1083

Query: 1034 KSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEK 1093
            K+D S K                                LV EDNHVNQEVIKRML LE 
Sbjct: 1084 KNDTSIK-------------------------------ILVVEDNHVNQEVIKRMLNLEG 1112

Query: 1094 LSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYT 1153
            + NI+LACDG+EA+ KVKE+TS     K   Y++IFMDVQMP++DGL STK+IR +L Y 
Sbjct: 1113 IENIELACDGQEAFDKVKELTS-----KGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYK 1167

Query: 1154 KPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYH 1201
             PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKLK IL EFC  Y 
Sbjct: 1168 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1215

 Score =  438 bits (1126), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/367 (59%), Positives = 278/367 (75%), Gaps = 1/367 (0%)

Query: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67
           +S   PP  IGIR QLTALV  VA VSLIILAV TG+YFT NYK++R DRL IAA+LKSS
Sbjct: 8   KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127
           Q+DQTLN+LYYQ Y+L+ RD LQ+++ ++ AGNKS+  W DS  VV+KFLSSS++F +++
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127

Query: 128 LYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLM 187
           +YD++F  V+NATNNGTG+++P DV                     +LTDPV+N+T YLM
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187

Query: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247
           SMSLPI ANPSIILTDS+VYGYITIIMSAE L SV+NDTTALEKSNVAI+S  Y++   +
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247

Query: 248 LTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPC 307
            + YHF+FPPYG    +    + ++N +F+  A  N K GS+ +T  F   ++A+GYSPC
Sbjct: 248 -SGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPC 306

Query: 308 SFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQK 367
           SF LV+WVA+VSQPESVFLSP+TKL +II GTV+AI VFV  +T PL+HWAV+PIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 368 ATELIAE 374
           ATELI E
Sbjct: 367 ATELITE 373

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/771 (51%), Positives = 468/771 (60%), Gaps = 99/771 (12%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + + E ++P YRRLF DELS+LT+TFNTM+DALDQHYALLE+RVRARTKQL         
Sbjct: 503  ANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEA 562

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I++SLKLIFRSG          
Sbjct: 563  ANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTEL 622

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 623  LTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDS 682

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDKE S+   +KEV V+ GTE  E+  
Sbjct: 683  NRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIG 742

Query: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKN-DIISNNHQSSNTTFDISIHNRTR-- 768
             I  K + +K  +    +S D+E     +   ++   I       NT  + +I+ +TR  
Sbjct: 743  NI-NKHDAKK--SENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNTAANENIYKKTRDR 799

Query: 769  -----DDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVED 823
                 DD           YD+ +FN QF K  G  D +   LG  I+ PKTW I IEVED
Sbjct: 800  EKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGDLGKPIENPKTWAISIEVED 859

Query: 824  TGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSK 883
            TGPGI P+LQESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM LESKVG GSK
Sbjct: 860  TGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSK 919

Query: 884  FTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSS------------PG 931
            FTFT+PL QT+EI                   S++NR+VKF +  S            P 
Sbjct: 920  FTFTLPLHQTKEISFANMNFPFEDEFNPE---SRQNRRVKFNVARSIKSRQSASSIATPT 976

Query: 932  TTLAXXXXXXXXXXXXXXXXFVGEIQNVNEAEED--------------------AYNSKD 971
                                   +I N+ E +E                     +++S D
Sbjct: 977  ANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELDEAHQQLQEKNVKNSISFSSAD 1036

Query: 972  INSSGEL-KIRHIXXXXXXXXXIPSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTN 1030
             N        RH            +LDRPFLQSTGTATS   IP +   SNS        
Sbjct: 1037 SNEQKSAPSTRHSREESVGSV---NLDRPFLQSTGTATSNRNIPTV---SNS-------- 1082

Query: 1031 DEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLK 1090
               KSD S K                                LV EDNHVNQEVIKRML 
Sbjct: 1083 --DKSDSSIK-------------------------------ILVVEDNHVNQEVIKRMLN 1109

Query: 1091 LEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSEL 1150
            LE + NI+LACDG++A+ KVKE+TS     +   Y++IFMDVQMP++DGL STK+IR +L
Sbjct: 1110 LEGIENIELACDGQDAFDKVKELTS-----RGESYNMIFMDVQMPKVDGLLSTKMIRRDL 1164

Query: 1151 KYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYH 1201
             YT PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKLK IL EFC  Y 
Sbjct: 1165 GYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQ 1215

 Score =  452 bits (1162), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 278/367 (75%), Gaps = 1/367 (0%)

Query: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67
           RS+  PP  I IR QLTALV  VA +SL+ILAV TG+YFT NYK++R DRL IAA+LKSS
Sbjct: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127
           Q+DQTLN+LYYQ Y+L+ RD LQ ++  Y AGNKSS  W DS  +V+KFLSSS++F +++
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127

Query: 128 LYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLM 187
           +YD++F  V+NATNNGTG+++P D+                     +LTDP+LNST YLM
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187

Query: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247
           SMSLPI ANPSIILTDS+VYGYITIIMSAE L SV+NDTTALEKSNVAI+S  Y++ S +
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247

Query: 248 LTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPC 307
              YHFVFPPYG +  I    +P++N +F+  A  N K GS+ KT  F   ++A+GYSPC
Sbjct: 248 YA-YHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPC 306

Query: 308 SFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQK 367
           SF LV+WVA+VSQPESVFLSPSTKL +II GTV+AI VFV  +T PL+HWAV+PIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 368 ATELIAE 374
           ATELI E
Sbjct: 367 ATELITE 373

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/772 (50%), Positives = 468/772 (60%), Gaps = 93/772 (12%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + + E ++P Y+RLF DELS+LT+TFNTM+DALDQHYALLE+RVRARTKQL         
Sbjct: 503  ANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEA 562

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I+++LKLIFRSG          
Sbjct: 563  ANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGELLLHILTEL 622

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 623  LTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDS 682

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDK+ S+   +KEV VK GTE  +   
Sbjct: 683  NRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVE 742

Query: 712  KILQK-----LNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766
             I ++     L   K +   S  +     R N  I E+   I+  + ++N       ++R
Sbjct: 743  SIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE---ITKRNTAANENIYKKANDR 799

Query: 767  TR---DDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVED 823
             +   DD           YD+ +FN QF K       +   +G  I+ PKTWVI IEVED
Sbjct: 800  EKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVED 859

Query: 824  TGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSK 883
            TGPGI P+LQESVF+PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM LES+VG GSK
Sbjct: 860  TGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSK 919

Query: 884  FTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAI---------------PS 928
            FTFT+PL QT+EI                   SKKNR+VKF++               P 
Sbjct: 920  FTFTLPLHQTKEISFANIEFPFEDEFNPE---SKKNRRVKFSVAKSIKSRQSTSSLTTPV 976

Query: 929  SPGTTLAX----XXXXXXXXXXXXXXXFVGEIQNVNEAEEDAYNSKDINS---------- 974
            +   TLA                    F+   +  NE  +     ++ N+          
Sbjct: 977  TNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSAE 1036

Query: 975  -SGELKIRHIXXXXXXXXXIPSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEG 1033
             S +  +              ++DRPFLQSTGTATS+  +P ++                
Sbjct: 1037 RSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQG--------------- 1081

Query: 1034 KSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEK 1093
                   G+  GT I+                       LV EDNHVNQEVI+RML LE 
Sbjct: 1082 -------GDKDGTSIK----------------------ILVVEDNHVNQEVIRRMLNLEG 1112

Query: 1094 LSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYT 1153
            + NI+LACDG+EA+ KVKE+TS     K   Y++IFMDVQMP++DGL STK+IR +L Y 
Sbjct: 1113 IDNIELACDGQEAFDKVKELTS-----KGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYK 1167

Query: 1154 KPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYHLQNN 1205
             PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKL  IL+EFC  Y  + N
Sbjct: 1168 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQGKKN 1219

 Score =  448 bits (1152), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 227/367 (61%), Positives = 276/367 (75%), Gaps = 1/367 (0%)

Query: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67
           RS   PP  IGIR QLTALV  VA VSL ILAV TG+YFT NYK++R DRL IAA+LKSS
Sbjct: 8   RSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127
           QVDQTLN+LYYQ Y+L+ RD LQ+++ +Y AGNKS   W DS  VV+KFLSSS++F ++R
Sbjct: 68  QVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVAR 127

Query: 128 LYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLM 187
           +YD++F  V+NATNNGTG+++P DV                     +LTDP++N+T YLM
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLM 187

Query: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247
           SMSLPI ANPSIILTDS+VYGYITI+MSAE L SV+NDTTALEKSNVAI+S  Y +    
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATY-NAQGR 246

Query: 248 LTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPC 307
            + YHFVFPPYG    I    +P++N +F+     N K GS+ KT  F   ++A+GYSPC
Sbjct: 247 ASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPC 306

Query: 308 SFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQK 367
           SF LV+WVA+VSQPESVFLSP+TKLT+IIAGTV+AI VFV  +T PL+HWAVKPIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQK 366

Query: 368 ATELIAE 374
           ATELI E
Sbjct: 367 ATELITE 373

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/742 (51%), Positives = 461/742 (62%), Gaps = 89/742 (11%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + + E +VP+ R+LF DELS+LT+TFNTM+DALD+HY LLE+RVRARTKQL         
Sbjct: 499  TNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEA 558

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEE+DI  I+SSLKLIFRSG          
Sbjct: 559  ANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTEL 618

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE+R+FCITDVALQ+KSIFGKVAKDQHV+LSI L PN +RT+VL+GDS
Sbjct: 619  LTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDS 678

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQ+VMNLVSNALKFTP+DGKV V++ LLGEYD+E SK + +++V+VK GTE    ++
Sbjct: 679  NRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTE----FT 734

Query: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNN-------------HQSSNTT 758
             I  +L     ++ R + +  +    +  I EK D I  N               + NT+
Sbjct: 735  SIPAEL---AALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEGTTINTS 791

Query: 759  FDISIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVIC 818
               +  N    D           YD+ +FN QFKK   L + ++  LG E+ + KTWV  
Sbjct: 792  QQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFR 851

Query: 819  IEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKV 878
            IEV DTGPGI  +LQESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMMNGTM LES V
Sbjct: 852  IEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTV 911

Query: 879  GSGSKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXX 938
            GSGSKF FTVPLTQTR I +                 SK NRKVKF +  S  +  +   
Sbjct: 912  GSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPK---SKMNRKVKFNVARSINSRRSRSS 968

Query: 939  XXXXXXXXXXXXXFVGEIQNVNEAE--EDAYNSKDINSSGELKIRHIXXXXXXXXXIPSL 996
                             I  V E    E   N  D+++S +                 +L
Sbjct: 969  LITSNS---------SRIATVREESRLETRSNHSDVSTSNK---NESASPQPESGSNLNL 1016

Query: 997  DRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNN 1056
            DRPFLQSTGTA S+  +P                               T+   G T N 
Sbjct: 1017 DRPFLQSTGTAISSANVP-------------------------------TVATLGKTLN- 1044

Query: 1057 SSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSI 1116
                            LV EDNHVNQEVIKRML LE + NIDLACDG++A+  VK +   
Sbjct: 1045 ---------------VLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSL--- 1086

Query: 1117 SNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGM 1176
               ++  +YD+IFMDVQMP++DGL +TK+IR++LKY  PIVALTAFAD+SNIKECLD GM
Sbjct: 1087 --KERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGM 1144

Query: 1177 DGFLSKPIKRPKLKDILNEFCP 1198
            DGFLSKPIKRP+LK IL E+CP
Sbjct: 1145 DGFLSKPIKRPQLKTILLEYCP 1166

 Score =  449 bits (1156), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 218/363 (60%), Positives = 271/363 (74%), Gaps = 1/363 (0%)

Query: 12  RPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQ 71
           +PP  I IRTQL A+V  VA +SL+ILAV TG+YFT +YK++R +RL IAA+LKSSQ+DQ
Sbjct: 24  KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 72  TLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDA 131
           TL +LYYQ YW+S RDTLQ ++AN+ AGNKSSS W  ++ V+EKFLSSSD FS  ++YD 
Sbjct: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 132 NFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSMSL 191
           NF+ V++ TNNGTGN +  DV                     +LTDPVLN T+YLMSMSL
Sbjct: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203

Query: 192 PILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEY 251
           P+ ANPSIIL+ S+VYGYITIIM+A+ L+SV+NDTTA+EKSNVAIVS  Y++ S  L  Y
Sbjct: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQS-ELDAY 262

Query: 252 HFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDL 311
           H   PPYG T  + DI + L+N SFL  A+   K GSI KT F YN  VA+GYSPCSF+L
Sbjct: 263 HLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFEL 322

Query: 312 VSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATEL 371
            +WV++VSQ ESVF  PSTKLT+IIAG VV I+VFV  VT PL+++AVKPIVRL+KATE+
Sbjct: 323 ANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEI 382

Query: 372 IAE 374
           I E
Sbjct: 383 ITE 385

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/753 (49%), Positives = 467/753 (62%), Gaps = 84/753 (11%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + ++E +VP YRRLF DELS+LTDTFN M+DALDQHYALLE+RVRARTKQL         
Sbjct: 484  ANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAET 543

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KT+FIANISHELRTPLNGILGMTAISMEE DI  I+SSLKLIFRSG          
Sbjct: 544  ANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTEL 603

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVL+RT LE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L+PN IRT++L+GDS
Sbjct: 604  LTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDS 663

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DGKV+VR+ L+GEYD+  S+ +++K+V VK+GTE  E  +
Sbjct: 664  NRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKA 723

Query: 712  KIL--------QKLNTEKLIATRSARSCDNEERHNELIGEKND--IISNNHQSSNTTFDI 761
            K +         K +TE ++  +   + +     N++I   +D                 
Sbjct: 724  KAILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEEDNSD 783

Query: 762  SIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEV 821
            + ++ T  +           YD+ VFN+QFKK   L + ++  LG+E+  PKTWVI IEV
Sbjct: 784  NDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEV 843

Query: 822  EDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSG 881
            +DTGPGI P+LQ+SVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MMNGTM L+S+VG G
Sbjct: 844  QDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVG 903

Query: 882  SKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXX 941
            S FTFTVPL QTRE+ +                 S+KNR+VKF         LA      
Sbjct: 904  STFTFTVPLMQTRELELNEDDHPFEDEFNPA---SRKNRRVKFK--------LAKSLRSR 952

Query: 942  XXXXXXXXXXFVGEIQNVNEA---------EEDAYNSKDINSSGELKIRHIXXXXXXXXX 992
                          + NV E          EE     K+ ++  E +  H          
Sbjct: 953  KSRSSTTTFSTTNSLHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHL 1012

Query: 993  IPS--LDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQE 1050
            + +  +DRPFLQSTGTATST  I  + D                      G     ++ E
Sbjct: 1013 LGTVNMDRPFLQSTGTATSTRTIQTVPD---------------------AGKKFKILVAE 1051

Query: 1051 GVTQNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKV 1110
                                      DNHVNQEVIKRML LE + NI+LA DG++A+ +V
Sbjct: 1052 --------------------------DNHVNQEVIKRMLNLEGVENIELARDGQDAFNEV 1085

Query: 1111 KEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKE 1170
            K +      ++  ++D+IFMDVQMP++DGL STK+IR++L YT PIVALTAFAD+SNIKE
Sbjct: 1086 KAMV-----EQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKE 1140

Query: 1171 CLDVGMDGFLSKPIKRPKLKDILNEFCPGYHLQ 1203
            CL+ GM+GFLSKPIKRPK+K IL E+CP + ++
Sbjct: 1141 CLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMK 1173

 Score =  478 bits (1230), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 226/365 (61%), Positives = 283/365 (77%), Gaps = 1/365 (0%)

Query: 10  ILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQV 69
           +L+PP  +GIRTQLT LV  VA  SL+ILA+ TG+YFT NYK++R DRL IAA+LKSSQ+
Sbjct: 10  VLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQI 69

Query: 70  DQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLY 129
           DQ LN+LYYQ YWLS RDTLQ  + NY AGNK++  W DS+ V++KFL+S+++FS ++LY
Sbjct: 70  DQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLY 129

Query: 130 DANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSM 189
           D++FN V+ ATNNGTG+++P  V                     +LTDPVLN +TY+MSM
Sbjct: 130 DSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSM 189

Query: 190 SLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLT 249
           SLPI ANPSIILTDSKVYGYITI+MSAE L +V+NDTTALE+SNVAIVSG Y++ S +L 
Sbjct: 190 SLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNES-TLN 248

Query: 250 EYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSF 309
            YHFVF PYGA   +I+  + + N SFL  A+   K GS+ KTKFFY  ++A+GYSPC+F
Sbjct: 249 AYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTF 308

Query: 310 DLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKAT 369
             V+W+AIVSQ ESVFLSPSTKL +II+GTVVAI VFV  +TFPL+HWAVKPIVRLQKAT
Sbjct: 309 SFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKAT 368

Query: 370 ELIAE 374
           EL++E
Sbjct: 369 ELMSE 373

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/742 (51%), Positives = 454/742 (61%), Gaps = 100/742 (13%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + ++E  VPVYRR F DELSELTDTFNTM+D LD+HYALLEERVRARTKQL         
Sbjct: 489  TNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAES 548

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAI+M E D+  +++SLKLIFRSG          
Sbjct: 549  ANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTEL 608

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVL+RTKLEERDF + D+ALQIKSIFGK+AKDQHVKLSI L PN IRTLVLWGDS
Sbjct: 609  LTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDS 668

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DGKV VR+ LLGEYD ++S++ DY+EVFV  G+E  +++ 
Sbjct: 669  NRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFE 728

Query: 712  KILQKLNTEKLIATRSARSCDNEERHNEL------------IGEKNDIISNNHQSSNTTF 759
              L      +L    S+ S +   +                +  +     N++  S+   
Sbjct: 729  FNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVL 788

Query: 760  DISIHNRTRDDXXXXX---XXXXXXYDETVFNDQFKKITGLQDHD-EERLGVEIKEPKTW 815
            + S H    D+              YD+ +F+ QFKK+    D D EE    ++K PKTW
Sbjct: 789  E-SKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTW 847

Query: 816  VICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLE 875
            VI +EVEDTG GI P+LQESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM L+
Sbjct: 848  VISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLD 907

Query: 876  SKVGSGSKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLA 935
            SKVG GSKF FTVPL QT+EIV                 +S+KNRKVKF I SS  +   
Sbjct: 908  SKVGVGSKFIFTVPLQQTKEIVFD---GAEKQFEDEFNIHSRKNRKVKFKINSSRKSV-- 962

Query: 936  XXXXXXXXXXXXXXXXFVGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPS 995
                              G   N N +E  A NS + NS G +++               
Sbjct: 963  --------QTKKSKSSIDGHSDN-NVSERKASNSTE-NSVGNVRV--------------- 997

Query: 996  LDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQN 1055
             DRPFLQSTGTATST  I        S+    VT                          
Sbjct: 998  -DRPFLQSTGTATSTRSI--------SSVASEVTRHR----------------------- 1025

Query: 1056 NSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITS 1115
                             LV EDN+VNQEVIKRML+LE L+++D+ACDG+EAY KV+EI  
Sbjct: 1026 ----------------VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEIL- 1068

Query: 1116 ISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVG 1175
                K    Y +IFMDVQMPR+DGL +TK+IR++L Y  PIVALTA+AD+SNIK CL+ G
Sbjct: 1069 ----KNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESG 1124

Query: 1176 MDGFLSKPIKRPKLKDILNEFC 1197
            MDGFL KPIKRP LK I+ ++C
Sbjct: 1125 MDGFLPKPIKRPLLKKIIAQYC 1146

 Score =  420 bits (1079), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 264/368 (71%), Gaps = 1/368 (0%)

Query: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64
           +  R    PP  +G+RTQL  LVC +  +SL I+ V TG+YFT NYK +R +RL +AA+L
Sbjct: 12  KALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQL 71

Query: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124
           KSSQVDQ LN+LYYQ YWLS RDTLQ A+ N+ AGN S   W  ++  +EKFL SS +FS
Sbjct: 72  KSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFS 131

Query: 125 ISRLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTT 184
            +R+YD +FN V+N+TNNG+G+ +P +V                     ++TDPV N T 
Sbjct: 132 AARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTN 191

Query: 185 YLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDY 244
           YL+SMSLP+  NPSIIL  +++ GYIT+I SAESL +V NDT AL+KS+V+I+S  + D 
Sbjct: 192 YLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVF-DS 250

Query: 245 SASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGY 304
           ++SLT YHFVFPP+G +     + +P++NG+F+ DA  N K GS+MKT      ++A+GY
Sbjct: 251 NSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGY 310

Query: 305 SPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVR 364
           SP +F LV+WVA+V+QPE VFLSP+ +L +IIAGTV AIAVF+C +TFP++HWAV+PIVR
Sbjct: 311 SPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVR 370

Query: 365 LQKATELI 372
           LQKATE+I
Sbjct: 371 LQKATEII 378

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/753 (50%), Positives = 463/753 (61%), Gaps = 101/753 (13%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + +++ +VPVY RLF DELSELTDTFNTM+D LD+HYALLE+RVRARTKQL         
Sbjct: 475  TNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEA 534

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISM E D+  +++SLKLIFRSG          
Sbjct: 535  ANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTEL 594

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLEER+F I DVALQ+KSIFGK+AKDQHV LSI L PN IRT++LWGDS
Sbjct: 595  LTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDS 654

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTE-PEENY 710
            NRIIQIVMNLVSNALKF+P+DGKV VR+ LLGEYD +KSK ++Y +VF+K GTE P+ + 
Sbjct: 655  NRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASA 714

Query: 711  SK-ILQKLNTEKLIATR---SARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766
            SK  L  L   K+ A +   +++S D+++   E I   +   S+    S    D     R
Sbjct: 715  SKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKR 774

Query: 767  TR---DDXXXXXXXXXXXYDETVFNDQFKKI--TGLQDHDEERLGVEIKEPKTWVICIEV 821
            +     D           YD+ + + Q +K+   G  +   + LG +++  KTWVI IEV
Sbjct: 775  SNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEV 834

Query: 822  EDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSG 881
            EDTGPGI PAL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM LESKVG G
Sbjct: 835  EDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVG 894

Query: 882  SKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXX 941
            SKFTFTVPLTQTRE+                  +SKKNRKVKF +  + G + +      
Sbjct: 895  SKFTFTVPLTQTREVSFD---DVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRPSVNT 951

Query: 942  XXXXXXXXXXFVGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPFL 1001
                              + AE+ A +  ++ S G +++                DRPFL
Sbjct: 952  SLNSGTD-----------STAEKMALSESEV-SVGSVRV----------------DRPFL 983

Query: 1002 QSTGTATSTMKIPVLKD----FSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNS 1057
            QSTGTATST  I  +K     F     +DN  N E                         
Sbjct: 984  QSTGTATSTRSITTVKSLERPFKILVAEDNNVNQE------------------------- 1018

Query: 1058 SXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSIS 1117
                                      V+KRML LE LS+IDLACDG+EA+ KVK +    
Sbjct: 1019 --------------------------VVKRMLNLEGLSDIDLACDGQEAFDKVKALQ--- 1049

Query: 1118 NPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMD 1177
              +  ++Y +IFMDVQMPR+DGL STK+IR EL+Y+ PIVALTAFAD+SNIK CLD GM+
Sbjct: 1050 --EANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMN 1107

Query: 1178 GFLSKPIKRPKLKDILNEFCPGYHLQNNTDTNK 1210
            GFLSKPIKRPKLK +L+EFCP +  + N++  K
Sbjct: 1108 GFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK 1140

 Score =  479 bits (1234), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 220/366 (60%), Positives = 281/366 (76%), Gaps = 1/366 (0%)

Query: 7   FRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKS 66
            RS L+PP  +GIRTQL ALVC VA +SL+ILAV TG+YFT NYK +R DRL +AA+LKS
Sbjct: 7   LRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKS 66

Query: 67  SQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSIS 126
           SQ+DQ LN+LYYQCYWLS RDTLQ ++  Y AGN +   W ++++V+EKFL SSD+FS++
Sbjct: 67  SQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVA 126

Query: 127 RLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYL 186
           R+YD+ F  V+NATNNG+GN+VP  V                     +LTDPVLN T Y+
Sbjct: 127 RIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYV 186

Query: 187 MSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSA 246
           MSMSLPI A+PSI+LT+S++ GYIT++MSAESL  V+NDTTAL+KS+VAI+S EYS+ S 
Sbjct: 187 MSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSL 246

Query: 247 SLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSP 306
            ++ YHFVFPP+G    IID  + ++NGSF+  A +++K GS+ +T FFY  DVA+GYSP
Sbjct: 247 PVS-YHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSP 305

Query: 307 CSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQ 366
           C F  V WVA++SQPE+VFLSPST+LT II GT + IAVF+C VTFPL+HWAVKPIVRLQ
Sbjct: 306 CLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQ 365

Query: 367 KATELI 372
           KATE+I
Sbjct: 366 KATEII 371

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/734 (50%), Positives = 444/734 (60%), Gaps = 108/734 (14%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            S ++E +VPVYR  F DE SELTDTFNTM++ALDQHYALLE+RVRARTKQL         
Sbjct: 452  SNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEA 511

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAISMEE DID I+SSLKLIFRSG          
Sbjct: 512  ANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTEL 571

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVLQRTKLE+RDF ITDVA+QIKSIFGKVAKDQ VK SI L PN+IR +VL+GDS
Sbjct: 572  LTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDS 631

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRIIQIVMNLVSNALKFTP+DGKVSVRM LLGEYDK++S+  D+K V+V  GTEP E   
Sbjct: 632  NRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE--- 688

Query: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEK-NDIISNNHQSSNTTFDISIHNRTR-- 768
                    + LI     +    E+   E I EK N+  ++   S  T  D    +  R  
Sbjct: 689  --------DGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKRSD 740

Query: 769  -DDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPG 827
             DD           YD+T+F+ QFKK T     +   L   ++ PK W I +EVEDTGPG
Sbjct: 741  ADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPG 797

Query: 828  IHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFT 887
            I P+L ESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM L+SK+G GSKFTFT
Sbjct: 798  IDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFT 857

Query: 888  VPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXXXXXX 947
            +PLTQTREI                   SKKNRKVKF +  S  +  +            
Sbjct: 858  LPLTQTREI----EFEDENAFEDEFNPLSKKNRKVKFKVAKSIKSRKSKSSLSNSSGKGG 913

Query: 948  XXXXFVGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPFLQSTGTA 1007
                   +++                S  E  + ++           SLDRPFLQSTGTA
Sbjct: 914  SSDKSSKQLK---------------GSESEFSVGNV-----------SLDRPFLQSTGTA 947

Query: 1008 TSTMKIPVLKDFSNS----ATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXX 1063
            +S+  + V+ + + S      +DN  N E                               
Sbjct: 948  SSSKNVTVVSNVNKSYRILVAEDNHVNQE------------------------------- 976

Query: 1064 XXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKN 1123
                                VIKRML LE +  IDLA DG++A+ KVK +      +K  
Sbjct: 977  --------------------VIKRMLTLEGIDRIDLAADGQDAFDKVKALQ-----EKGE 1011

Query: 1124 YYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKP 1183
            +Y+LIFMDVQMP++DGL +TK+IR +L Y  PIVALTAFAD+SNI+ CL+ GM+GFLSKP
Sbjct: 1012 HYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKP 1071

Query: 1184 IKRPKLKDILNEFC 1197
            IKRPKLK I+ ++C
Sbjct: 1072 IKRPKLKTIIAQYC 1085

 Score =  451 bits (1159), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 223/362 (61%), Positives = 269/362 (74%), Gaps = 1/362 (0%)

Query: 13  PPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQT 72
           PP  I IRTQLTALV  VA VSLIILAV TG+YFT NYK +R +RL +AA+LKSSQ+DQ 
Sbjct: 13  PPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72

Query: 73  LNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDAN 132
           LN+LYYQCYWLS + TLQT++ANY +GNK+ + W DS  V++KFLSSS +FS++R+YDA+
Sbjct: 73  LNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVYDAD 132

Query: 133 FNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSMSLP 192
           F  V+NATNNGTG+V+ +DV                     MLTDPVLN T+YLMSMSLP
Sbjct: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192

Query: 193 ILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEYH 252
           I ANPSIILT+S+VYGY+TIIMSA+SL SVY+D TALEKS+V IVS  Y      L  Y 
Sbjct: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKK-DQGLGSYR 251

Query: 253 FVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDLV 312
           FVF PYG TP I+D  +P+ N SFL  A+   K GS  +T  FYN   A+GYSPCSF  V
Sbjct: 252 FVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFV 311

Query: 313 SWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATELI 372
           +WVAI+SQ E+VF+ PST+LT+II G VV I  FVC  TFPL+HWAV+PIVRLQKATE+I
Sbjct: 312 NWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEII 371

Query: 373 AE 374
            E
Sbjct: 372 TE 373

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/745 (47%), Positives = 446/745 (59%), Gaps = 116/745 (15%)

Query: 475  LETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXXXXX 534
            +ET+VPVYRRLF DELSELTDTFN+M+D LD+HYALLE+RVRARTKQL            
Sbjct: 482  IETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANE 541

Query: 535  XKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXXXXF 594
             KT+FIANISHELRTPLNGILGMTAI+M E+D++ +++SLKLIFRSG            F
Sbjct: 542  AKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTF 601

Query: 595  SKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRI 654
            SKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ+VK SI+L+PN IR +VLWGDSNRI
Sbjct: 602  SKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRI 661

Query: 655  IQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKIL 714
            IQIVMNLVSNALKFTP+DGKVS+R+ LLGEYD+E+S+  +  EVF+K GTE  +    + 
Sbjct: 662  IQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNVF 721

Query: 715  QKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDXXXX 774
              +  EK +      SC  E          +D I    + +            + D    
Sbjct: 722  DTITEEKYV------SCSGE--------STDDTIETGQEGA--------QKPDKADNISV 759

Query: 775  XXXXXXXYDETVFNDQFKKITGLQDHDEERLGV--EIKEPKTWVICIEVEDTGPGIHPAL 832
                   YD+ +F+ +FKKI  + D DE  L    + ++ K WVI IEVEDTGPGI P+L
Sbjct: 760  VSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSL 819

Query: 833  QESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQ 892
            QESVF+PFVQGDQ LSRQYGGTGLGLSICRQL+TMM GTM L S+VG GSKF FTVPL Q
Sbjct: 820  QESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQ 879

Query: 893  TREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXXXXXXXXXXF 952
            T  +                   SK NR+VKF +     +  +                 
Sbjct: 880  TGTVE---DLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSSLS-------------- 922

Query: 953  VGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPFLQSTGTATSTMK 1012
            V EI  V ++         +NS G  +                +DRPFLQSTGTATST  
Sbjct: 923  VPEISGVPDSP--------LNSMGRSESELSVSSVR-------VDRPFLQSTGTATSTRS 967

Query: 1013 IPVL----KDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXX 1068
            IP +     +F     +DN  N E                                    
Sbjct: 968  IPTVGSLESNFKVLVAEDNNVNQE------------------------------------ 991

Query: 1069 XXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLI 1128
                           VIKRML+LE + +I+LACDGEEA  KV  +T+     + ++Y+++
Sbjct: 992  ---------------VIKRMLQLEGIYDIELACDGEEALEKVANLTN-----QYDHYNIV 1031

Query: 1129 FMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPK 1188
            FMDVQMP+MDGL +T+ IR EL YT PIVALTAFAD+SNIK CL+ GMDGFLSKPIKR K
Sbjct: 1032 FMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREK 1091

Query: 1189 LKDILNEFCPGYHLQNNTDTNKGLQ 1213
            L+ IL E+CP  +   +T TN+GL+
Sbjct: 1092 LRKILLEYCPVLNKSVSTTTNRGLE 1116

 Score =  364 bits (934), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/370 (48%), Positives = 252/370 (68%), Gaps = 2/370 (0%)

Query: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64
           R+ + + RPP   G+ TQLT LVC +A  SLIILAV TG+YFT NYK +R DRL++AA+L
Sbjct: 17  RIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQL 76

Query: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124
            S+Q++QTLN +YYQCYWLS RD++Q A+ +Y  GN SS    +++ V+ KFL SS+   
Sbjct: 77  TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136

Query: 125 ISRLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTT 184
            + LYD+ FN V++ + N TGN++ +D+                     ML++PV N ++
Sbjct: 137 RTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSS 196

Query: 185 YLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDY 244
           + MSMSLP+ A  SI+   S   GYIT++MSA+ + SV     AL  S V++++G Y D 
Sbjct: 197 FFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVY-DE 255

Query: 245 SASLTEYHFVFPP-YGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIG 303
           +  L  Y  +FPP     P++++I +P+ N SFLY+A  N+  GS+ KT  FY  +VA+G
Sbjct: 256 NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315

Query: 304 YSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIV 363
           Y+ CSF LV+WVA+V+Q E+VFLSPSTKLT+II GTV+ IA F+C VTF +++WAVKPIV
Sbjct: 316 YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375

Query: 364 RLQKATELIA 373
           RLQKATELIA
Sbjct: 376 RLQKATELIA 385

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/742 (49%), Positives = 446/742 (60%), Gaps = 112/742 (15%)

Query: 458  FSSHKSSNTPPPPMSTILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRA 517
             S H+  +T     +  ++T+VPVYRRLF DELSELTDTFNTM+D LD+ Y +LE+RVRA
Sbjct: 463  LSDHEKGSTSA---TNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRA 519

Query: 518  RTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLI 577
            RTKQL             KTVFIANI HELRTPLNGILGMTAI+M E D + I++SLKLI
Sbjct: 520  RTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLI 579

Query: 578  FRSGXXXXXXXXXXXXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYL 637
            FRSG            FSKNVL+RTKLEER F I D+ALQ+KSIFGK+AKDQHVKLSIYL
Sbjct: 580  FRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYL 639

Query: 638  IPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKE 697
            +PN IRT+VLWGDSNRIIQIVMNLVSNALKFTP+DGKV VR+ L+GEYD  +S+A ++ E
Sbjct: 640  MPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSE 699

Query: 698  VFVKTGTE-PEENYSKILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSN 756
            V++  GTE    + + I   +  E+        + D  ER      +K D        S 
Sbjct: 700  VYILPGTEVTNSSVNNIPTVVEEEEKACEEEPTADDTPER------KKKD--------SE 745

Query: 757  TTFDISIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKI---TGLQDHDEERLGVEIKEPK 813
            T  D         D           YD+ V + Q KKI     L+D D      ++++P+
Sbjct: 746  TVDDA--------DAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPR 797

Query: 814  TWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMV 873
            +WVI IEV+DTGPGI P+L ESVF+PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTM 
Sbjct: 798  SWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMK 857

Query: 874  LESKVGSGSKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTT 933
            LESKVGSGSKFTFTVPL QT  +                  +SKKNRKVKF +  S  + 
Sbjct: 858  LESKVGSGSKFTFTVPLQQTGTVKFN---DGDTLFEDEFNIFSKKNRKVKFQLNRSGKSR 914

Query: 934  LAXXXXXXXXXXXXXXXXFVGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXI 993
                                G++ N N A   A ++  I S G+                
Sbjct: 915  -------------------KGKMNNSNGAGSIAESA--IESFGK-------SESEASFGS 946

Query: 994  PSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVT 1053
              +DRPFLQSTGTATST  +P L                         +S  + ++  V 
Sbjct: 947  VRVDRPFLQSTGTATSTRSVPTL-------------------------SSAESSLRILVA 981

Query: 1054 QNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEI 1113
            ++N                      +VNQEVIKRML LE   NIDLACDGE+AY KV  +
Sbjct: 982  EDN----------------------NVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSAL 1019

Query: 1114 TSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLD 1173
                  ++  +YDLIFMDVQMPRMDGL +TKL+R +L Y  PIVALTAFAD+SNIKECL+
Sbjct: 1020 V-----EQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLE 1074

Query: 1174 VGMDGFLSKPIKRPKLKDILNE 1195
             GM+ FL+KPIKRP LK IL E
Sbjct: 1075 SGMNSFLAKPIKRPMLKKILLE 1096

 Score =  316 bits (809), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 172/381 (45%), Positives = 234/381 (61%), Gaps = 13/381 (3%)

Query: 1   MGPSRMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSI 60
           +G  R   ++L+PP   G+RTQLT LVC +A  SLIILA  TG+YFT NY+ +R DRL +
Sbjct: 3   LGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHV 62

Query: 61  AAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSS 120
           AA L SSQVDQ+L  LYYQC  LS +DT+Q A+++Y AGN+S+  W ++  ++  FL  S
Sbjct: 63  AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122

Query: 121 DIFSISRLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVL 180
             F I+ LYD  +  V++  NN T   +  +                      + T P  
Sbjct: 123 KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181

Query: 181 NSTTYLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE 240
           N T  LMSM+LP+ A  S I+    V G++TI+MSA+ + +V NDT+ L +S V+I++G 
Sbjct: 182 NKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238

Query: 241 YSDYSASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYN--- 297
            +D   +L +Y FVFPP      + +  YP++N SFL DA  N+    +  T  FY+   
Sbjct: 239 PND-KGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGA 297

Query: 298 -----NDVAIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTF 352
                  VA+GYS C F  + WVA+VSQ ESVFLSP+ KLT+II GTV+ +AVF+C VTF
Sbjct: 298 LGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTF 357

Query: 353 PLSHWAVKPIVRLQKATELIA 373
            L+ WAVKPIVRLQKATE IA
Sbjct: 358 ILASWAVKPIVRLQKATEFIA 378

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  513 bits (1321), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/467 (58%), Positives = 317/467 (67%), Gaps = 32/467 (6%)

Query: 474 ILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXXXX 533
           +++ +VP YR LF DELS+LT+TFNTM+DALDQHYALLEERVRARTKQL           
Sbjct: 481 LIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETAN 540

Query: 534 XXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXXXX 593
             KTVFIANISHELRTPLNGILGMTAISMEE DID I++SLKLIFRSG            
Sbjct: 541 EAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLT 600

Query: 594 FSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNR 653
           FSKNVL+RTKLE+R+FCITDVALQIKSIFGKVAKDQHV+LSI L PN IR++VL+GDSNR
Sbjct: 601 FSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNR 660

Query: 654 IIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKI 713
           IIQIVMNLVSNALKFTP+DGKV VRM +LG YD+  S+  ++ +V+VK GTE        
Sbjct: 661 IIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTE-------- 712

Query: 714 LQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDI----------SI 763
                      T S  S + +          +D  S N+ SS+T +D           S 
Sbjct: 713 ----------ITDSTPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESD 762

Query: 764 HNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEE-RLGVEIKEPKTWVICIEVE 822
            +   +D           YD+ +FN QFKK T L D D+E  +GVE++ PKTWVI  EVE
Sbjct: 763 EDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVE 822

Query: 823 DTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGS 882
           D+GPGI   LQESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M+LESKVG GS
Sbjct: 823 DSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGS 882

Query: 883 KFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSS 929
           KFTFT+PLTQTREI                   SKKNRKVKF +  S
Sbjct: 883 KFTFTLPLTQTREINFANVEDPFEDEFNAK---SKKNRKVKFRMARS 926

 Score =  458 bits (1178), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 213/363 (58%), Positives = 275/363 (75%), Gaps = 1/363 (0%)

Query: 12  RPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQ 71
           +PP  +GIR QLT LV  VA +SL+ILAV TG+YFT NYK++R DRL IAA+LKSSQ+DQ
Sbjct: 11  KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70

Query: 72  TLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDA 131
            LN+LYYQCYW++ RDTLQT +ANY AGNKS + W DSQ V+EKFL SS++FS++R+YD+
Sbjct: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130

Query: 132 NFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSMSL 191
           +F  V+N TNN TG+++P DV                     ++T+PV N ++YLMSMSL
Sbjct: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190

Query: 192 PILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEY 251
           PI ANPSIILTDS+VYGY+T++MSAE L+SV+NDTTALE+S VAIVS  Y++ +  L  Y
Sbjct: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTN-ATKLDAY 249

Query: 252 HFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDL 311
            FVFPP+G+T  I++  +PL N +FL  A+   K G++  T+ FY   +A+GYSP + +L
Sbjct: 250 RFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNL 309

Query: 312 VSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATEL 371
            +WVAIV+Q ESVF+SP+TKL +IIAGTVV I VF   +TFPL+HWAVKPIVRLQKATEL
Sbjct: 310 ANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATEL 369

Query: 372 IAE 374
           I E
Sbjct: 370 ITE 372

 Score =  210 bits (535), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 133/203 (65%), Gaps = 27/203 (13%)

Query: 995  SLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQ 1054
            SLDRPFLQSTGTATST  IP L  F      D + N    ++ +KK + G    +     
Sbjct: 1012 SLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYK----- 1066

Query: 1055 NNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEIT 1114
                              LV EDNHVNQEVIKRML+LE + +IDLACDG++A+ KVK++ 
Sbjct: 1067 -----------------ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQ 1109

Query: 1115 SISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDV 1174
                  K + Y+LIFMDVQMP++DGL STK+IR +L    PIVALTAFAD+SNIKECLD 
Sbjct: 1110 D-----KGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDA 1164

Query: 1175 GMDGFLSKPIKRPKLKDILNEFC 1197
            GMDGFLSKPIKR KLK IL EFC
Sbjct: 1165 GMDGFLSKPIKRTKLKTILKEFC 1187

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  512 bits (1318), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/460 (60%), Positives = 324/460 (70%), Gaps = 11/460 (2%)

Query: 472 STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
           + ++E +VPVYRR F DELSELTDTFNTM+DALDQHYALLE+RVRART+QL         
Sbjct: 464 ANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEA 523

Query: 532 XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
               KTVFIANISHELRTPLNGILGMTAISMEE DID I++SLKLIFRSG          
Sbjct: 524 ANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTEL 583

Query: 592 XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
             FSKNVL+RTKLE+R+F +TDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VL+GDS
Sbjct: 584 LTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDS 643

Query: 652 NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
           NRIIQIVMNLVSNALKFTP+DGKV+V MSLLGEYD E+S+  ++K+V+V  GTEP+ N  
Sbjct: 644 NRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDE 703

Query: 712 KILQKLNTEKLIATR-----SARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766
           K    +  ++  +       ++ +  N+    E     ND  ++  Q+S+   D    + 
Sbjct: 704 KDKGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPGLND--TDEKQASD-DMDGGEEDV 760

Query: 767 TRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGP 826
              D           Y++TVF+ QFKK   + D   E LGVE+K+ K WVI I VEDTGP
Sbjct: 761 EDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGP 820

Query: 827 GIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTF 886
           GI  +L ESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTM L+SK+G GS+FTF
Sbjct: 821 GIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTF 880

Query: 887 TVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAI 926
           TVPLTQTREI                   SKKNRKVKF I
Sbjct: 881 TVPLTQTREINFDDIPAAFEDEFNPD---SKKNRKVKFKI 917

 Score =  449 bits (1155), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 272/364 (74%), Gaps = 1/364 (0%)

Query: 11  LRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVD 70
            + P+ +GIR QLTALV  VA VSLIILAV TG+YFT NYK++R +RL +AA+LKS+Q+D
Sbjct: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70

Query: 71  QTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYD 130
           Q LN++YYQCYWLS RDTLQ A+ANY AGNK+ + W DS  V++KFL+SS +FS++ +YD
Sbjct: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130

Query: 131 ANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSMS 190
           A F  V++ATNNGTGN +P                        +LT+PVLN T+YLMSMS
Sbjct: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190

Query: 191 LPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTE 250
           LPI ANPSIILT S VYGYITI+MSA+SL +V++DTTALEKSNVAI+S  Y D + +L+ 
Sbjct: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVY-DQNETLSS 249

Query: 251 YHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFD 310
           Y+FVF P G    I+    P++NG+FL  A+   K G++ +TKF Y   VA+GYSPCS  
Sbjct: 250 YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309

Query: 311 LVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATE 370
            V+W+A+V Q E+VF+ P+TKLT+II+GTVV I VFVC VTFPL+HWAVKPIVRLQKATE
Sbjct: 310 FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369

Query: 371 LIAE 374
           LI E
Sbjct: 370 LITE 373

 Score =  183 bits (464), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 122/208 (58%), Gaps = 55/208 (26%)

Query: 996  LDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQN 1055
            LDRPFLQSTGTA+S                   TN    S ++K                
Sbjct: 958  LDRPFLQSTGTASSN------------------TNLGTTSTINK---------------- 983

Query: 1056 NSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITS 1115
                             LV EDN VNQEVIKRML LE + NI+L CDG+EA  KVK++  
Sbjct: 984  ----------------ILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLV- 1026

Query: 1116 ISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVG 1175
                +   +Y+LIFMDVQMP+MDGL STK+IR +L YT PIVALTAFAD+SNI+ECLD G
Sbjct: 1027 ----ENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAG 1082

Query: 1176 MDGFLSKPIKRPKLKDILNEFCPGYHLQ 1203
            MDGFL+KPIKR +L+ I+ EFCP    Q
Sbjct: 1083 MDGFLAKPIKRAQLRKIIEEFCPDKQPQ 1110

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  510 bits (1314), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/491 (57%), Positives = 332/491 (67%), Gaps = 22/491 (4%)

Query: 458 FSSHKSSNTPPPPMST---ILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEER 514
           FS H   +T    ++T   ++E +VP YRRLF DELS+LTDTFNTM+DALDQHYALLE+R
Sbjct: 507 FSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDR 566

Query: 515 VRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSL 574
           VRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE DI  I+SSL
Sbjct: 567 VRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSL 626

Query: 575 KLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLS 634
           KLIFRSG            FSKNVL+RT LE+RDFCITDVALQIKSIFGKVAKDQ VKLS
Sbjct: 627 KLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLS 686

Query: 635 IYLIPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAAD 694
           I L PN IRT+VL+GDSNRIIQIVMNLVSNALKFTP+DGKV+V++ L+GEYD+  S   +
Sbjct: 687 ITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNN 746

Query: 695 YKEVFVKTGTE------PEENYSKILQKLNTEKLIA---------TRSARSCDNEERHNE 739
           +KEV+VK GTE      P E  ++ +    +E   +         T S  S ++E+  ++
Sbjct: 747 FKEVYVKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADD 806

Query: 740 LIGEKNDIISNNHQSSNTTFDISIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQD 799
           L  EK       +++++ T ++     +  D           YD+ +FN QFKK  GL D
Sbjct: 807 LDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYD 866

Query: 800 HDEER-LGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGL 858
            DE    GV I++PKTWVI I VEDTGPGI   LQESVF+PFVQGDQ LSRQYGGTGLGL
Sbjct: 867 DDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGL 926

Query: 859 SICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKK 918
           SICRQLA MM+GTM L+S+VG GS FTFTVPL QTREI                   S+K
Sbjct: 927 SICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPE---SRK 983

Query: 919 NRKVKFAIPSS 929
           NRKVKF +  S
Sbjct: 984 NRKVKFKLARS 994

 Score =  487 bits (1253), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 233/365 (63%), Positives = 286/365 (78%), Gaps = 1/365 (0%)

Query: 10  ILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQV 69
           +L+PP  IGIR QLTALV  VACVSL+ILA+ TG+YFT NYK++R DRL IAA+LKSSQ+
Sbjct: 8   VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQI 67

Query: 70  DQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLY 129
           DQTLN+LYYQCY++S RDTLQ A+ NY AGNKS+  W DS  +++KFLSSS++FS++++Y
Sbjct: 68  DQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVY 127

Query: 130 DANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSM 189
           DA+F  V+N TNNGTG+ +P+ +                     +LTDPVLNS+TYLMSM
Sbjct: 128 DASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSM 187

Query: 190 SLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLT 249
           SLPI ANPS+IL +S+VYGY+T++MSAE L +V+NDTTALEKSNVAIVS  Y++ SA LT
Sbjct: 188 SLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSA-LT 246

Query: 250 EYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSF 309
            Y FVF P GA   II+  Y L NGSFL  A+   K GS+  TKFFY+ +VAIGYSPC+F
Sbjct: 247 AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTF 306

Query: 310 DLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKAT 369
             V+WVA+VSQ ESVFLSPSTKL +IIAGTVVAI VFV  +TFPL+HWAVKPIVRLQKAT
Sbjct: 307 SFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKAT 366

Query: 370 ELIAE 374
           ELI+E
Sbjct: 367 ELISE 371

 Score =  204 bits (518), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 134/206 (65%), Gaps = 46/206 (22%)

Query: 995  SLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQ 1054
            SLDRPFLQSTGTATS+  +PVL +    + KD                       E   Q
Sbjct: 1095 SLDRPFLQSTGTATSSRNVPVLSE----SNKD-----------------------EDPAQ 1127

Query: 1055 NNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEIT 1114
            N                 LV EDNHVNQEVIKRML LE ++ IDLACDG+EA+ KVK ++
Sbjct: 1128 N--------------IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLS 1173

Query: 1115 SISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDV 1174
                 ++ + Y++IFMDVQMP++DGL STK+IR +L Y  PIVALTAFAD+SNIKECL+ 
Sbjct: 1174 -----EQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLES 1228

Query: 1175 GMDGFLSKPIKRPKLKDILNEFCPGY 1200
            GM+GFLSKPIKRPKL+ I+ E+CPG+
Sbjct: 1229 GMNGFLSKPIKRPKLRTIIKEYCPGW 1254

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score =  498 bits (1282), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/544 (50%), Positives = 348/544 (63%), Gaps = 38/544 (6%)

Query: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXX 531
            + ++E +VPVY+RLF DELSELT+TFNTM+D LD+HYALLE+RVRART+QL         
Sbjct: 482  TNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEG 541

Query: 532  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXX 591
                KTVFIANISHELRTPLNGILGMTAI+M E+D   +KSSLKLIFRSG          
Sbjct: 542  ANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTEL 601

Query: 592  XXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651
              FSKNVL+RTKLEERDF I D+ALQ++SIFGK+AKDQHV L+I ++PN +R++VLWGDS
Sbjct: 602  LTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDS 661

Query: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711
            NRI+QIVMNLVSNALKFTP+DGKV V+  LLGEYD+EKSKA++YKEVFV   TE   + +
Sbjct: 662  NRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSST 721

Query: 712  KILQKLNTEKLIATRS-----ARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766
            +   + N E  + + +       + ++ +  N  IG++    S +    +   + S  + 
Sbjct: 722  EAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQR----SESEAIDSEAIESSDEDD 777

Query: 767  TRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGP 826
              +D           YD+ +F  + +K +  ++++E   G  ++ PK WVI +EV DTGP
Sbjct: 778  ENEDTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEE---GRALESPKKWVISMEVHDTGP 834

Query: 827  GIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTF 886
            GI PAL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM L+S+VG GSKF+F
Sbjct: 835  GIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSF 894

Query: 887  TVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXXXXX 946
            TVPLTQT+E++                  SKKNRKVKF +  S   + +           
Sbjct: 895  TVPLTQTKELLFEDVENPFEDEFNPD---SKKNRKVKFRMGKSNKRSKSRSESSGTE--- 948

Query: 947  XXXXXFVGEIQNVNEAEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPFLQSTGT 1006
                   G   N    E    NS    S  E+ +  +            +DRPFLQSTGT
Sbjct: 949  -------GNGGNSPGVEGSGGNSPGTGS--EVSVGSVR-----------VDRPFLQSTGT 988

Query: 1007 ATST 1010
            A ST
Sbjct: 989  ALST 992

 Score =  459 bits (1182), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 212/366 (57%), Positives = 272/366 (74%), Gaps = 2/366 (0%)

Query: 7   FRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKS 66
           F+  LR PL + IRTQLTALVC VA +SLIILAV TG+YFT ++K +R +RL +AA+LKS
Sbjct: 13  FQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKS 72

Query: 67  SQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSIS 126
           SQ+DQ LN+LYYQCYWLS RD LQ A+  Y AGN S+  W D+   ++KFL SS++FS++
Sbjct: 73  SQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLA 132

Query: 127 RLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYL 186
           R+YD++F  V+N +NNG+GN++P ++                     MLTDPVLN + YL
Sbjct: 133 RVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYL 192

Query: 187 MSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSA 246
           MSMSLPI ANPSIIL+ +KVYGYIT+++SAE L SVYNDTTAL+ S+V IVS  Y D+  
Sbjct: 193 MSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-- 250

Query: 247 SLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSP 306
            L  YH VFPPY   P +I+ +Y ++NGSFL DA+ + K GSI  T+FF N  +A+GYSP
Sbjct: 251 ELAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSP 310

Query: 307 CSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQ 366
           C+  L  WVAI++QPE++FLSPST+L +II GT +AIAV  C VTFPLSHWAV+PIVRLQ
Sbjct: 311 CNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQ 370

Query: 367 KATELI 372
           KATE+I
Sbjct: 371 KATEII 376

 Score =  185 bits (470), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (81%), Gaps = 5/126 (3%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            LV EDN+VNQEVIKRML LE L +++LACDG++A+ KVK     +      +YDLIFMDV
Sbjct: 1007 LVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVK-----AQDATGKHYDLIFMDV 1061

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
            QMPR+DGL +T++IR EL Y+ PIVALTAFAD+SNIKECLD GM+GFLSKPIKRPK+K I
Sbjct: 1062 QMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAI 1121

Query: 1193 LNEFCP 1198
            L E+CP
Sbjct: 1122 LKEYCP 1127

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  492 bits (1266), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/452 (58%), Positives = 312/452 (69%), Gaps = 16/452 (3%)

Query: 476 ETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXXXXXX 535
           E ++P YRRLF DELS+LT+TFN M+DALDQHYALLE+RVRARTKQL             
Sbjct: 470 EARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEA 529

Query: 536 KTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXXXXFS 595
           KTVFIANISHELRTPLNGILGMTAISMEE DI  I++SLKLIFRSG            FS
Sbjct: 530 KTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFS 589

Query: 596 KNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRII 655
           KNVL+RT LE+R+FCITDVALQIKSIFGKVAKDQHV+LSI L PN IRT+VLWGDSNRII
Sbjct: 590 KNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRII 649

Query: 656 QIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENY---SK 712
           QIVMNLVSNALKFTP+DGKV+VR+ LLGEYD+E +KA ++K++     ++  + +   S 
Sbjct: 650 QIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSS 709

Query: 713 ILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDXX 772
               L      ++ S  +  + +++NE   +++D   + H  +N    IS H+       
Sbjct: 710 PNGVLVKHLSTSSDSNSNLSDSDKYNEKTYDEDD---DEHSITN----ISDHSDD---LS 759

Query: 773 XXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPAL 832
                    YD  +FN QFKK   L +   + LG E+ + KTWV  IEVEDTGPGI P L
Sbjct: 760 SLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKL 819

Query: 833 QESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQ 892
            ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM LESKVG GSKFTFTVPL Q
Sbjct: 820 HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQ 879

Query: 893 TREIVIGXXXXXXXXXXXXXXXYSKKNRKVKF 924
           TR I                   SKKNR+VKF
Sbjct: 880 TRVI---KFDEEEDLFEDEFNPESKKNRRVKF 908

 Score =  488 bits (1257), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 239/373 (64%), Positives = 281/373 (75%), Gaps = 3/373 (0%)

Query: 2   GPSRMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIA 61
            P R  R  L+PP  IGIR QLTALV  VAC+SLIILAV TG+YFT NYK++R DRL IA
Sbjct: 7   APRR--RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIA 64

Query: 62  AELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSD 121
           A+LKSSQ+DQ LN+LYYQCYWL+ RDTLQ A+A+Y AGNK+   W +S  V++KFLSSS+
Sbjct: 65  AQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSN 124

Query: 122 IFSISRLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLN 181
           +F +SR+YD +F  V+N TNNGTG+ VP  +                     MLTDPVLN
Sbjct: 125 LFFLSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLN 184

Query: 182 STTYLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEY 241
            T YLMSMSLPI ANPSII +D KVYGYIT++MSAE L SV+NDTTALEKSNVAIVS  Y
Sbjct: 185 GTDYLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARY 244

Query: 242 SDYSASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVA 301
           S+Y+  +  Y FVFPPYG +P I++  + L + SFL  A    K GSI KTKFFY  DVA
Sbjct: 245 SNYT-KIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVA 303

Query: 302 IGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKP 361
           IGY PCSF+ V+WVA+VSQ ESVFLSPSTKLT+II+GTVV IAVFV  +TFPL+ WAVKP
Sbjct: 304 IGYYPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKP 363

Query: 362 IVRLQKATELIAE 374
           IVRLQKATELIAE
Sbjct: 364 IVRLQKATELIAE 376

 Score =  192 bits (488), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 101/215 (46%), Positives = 128/215 (59%), Gaps = 52/215 (24%)

Query: 996  LDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQN 1055
            LDRPFLQSTGTATS+  +P + D +                                   
Sbjct: 993  LDRPFLQSTGTATSSRNVPTMADVT----------------------------------- 1017

Query: 1056 NSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITS 1115
                             LV EDNHVNQEVIKRML LE ++NIDLACDG++A+ KV+ +  
Sbjct: 1018 ------------MRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLV- 1064

Query: 1116 ISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVG 1175
                ++ + YD+IFMD+QMP++DGL STK+IR +L Y   IVALTAFAD+SNIKEC++ G
Sbjct: 1065 ----EQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAG 1120

Query: 1176 MDGFLSKPIKRPKLKDILNEFCPGYHLQNNTDTNK 1210
            M+GFLSKPIKRPKLK IL E+CP +     +  NK
Sbjct: 1121 MNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENK 1155

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  444 bits (1141), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/468 (51%), Positives = 313/468 (66%), Gaps = 44/468 (9%)

Query: 458 FSSHKSSNTPPPPM-STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVR 516
            + + SSN+    M   + + +VP  RR   DELSELT+T+  M+DALD+H  LLE RV+
Sbjct: 434 ITDYSSSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVK 493

Query: 517 ARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKL 576
            RTKQL             KTVFIAN++HELRTPLNGILGMTAI+MEE D++ I+SSLKL
Sbjct: 494 ERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKL 553

Query: 577 IFRSGXXXXXXXXXXXXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIY 636
           I+RSG            FSKNVL++TKLE+  FC+ D+ALQI+SIFGK++KDQHVKLSI+
Sbjct: 554 IYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIF 613

Query: 637 LIPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYK 696
           ++PN++R++VLWGD NRI+Q++MNLVSNALKFTP+DGK++V + LLGEYDK++S A +YK
Sbjct: 614 ILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYK 673

Query: 697 EVFVKTGTEPEENYSKILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSN 756
           +V++K   E   +    ++ L T  LI+++   S               D ISN   +S+
Sbjct: 674 DVYMK---EIRNSNGDKIKPLMT--LISSKDTMSV-------------ADNISNKSVASD 715

Query: 757 TTFDISIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWV 816
           T  + S +N                   T+++++FK  +  QD D+  +GV + + + WV
Sbjct: 716 T--ERSTNN-------------------TIYSNKFKNGSNFQDTDDA-IGVPLDKKRKWV 753

Query: 817 ICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLES 876
           I +EVEDTGPGI P+LQ+SVFEPFVQGDQ LSRQYGGTGLGLSICRQLA +M+GTM LES
Sbjct: 754 ISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLES 813

Query: 877 KVGSGSKFTFTVPLTQTREIVIGXXXXXXXXXXXXXXXYSKKNRKVKF 924
           +VG GSKF FTVPL QTREI                   SKKNR+VKF
Sbjct: 814 EVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNIN---SKKNREVKF 858

 Score =  427 bits (1097), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 200/366 (54%), Positives = 270/366 (73%), Gaps = 1/366 (0%)

Query: 9   SILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQ 68
           SI + P  + +RTQLT LVCFVA +SL+ILA+ TG+YFT NY+ +R+ +L IAA LKSSQ
Sbjct: 8   SIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQ 67

Query: 69  VDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRL 128
           +DQT+N LYYQC WL+ RD +++A+ +Y AGN+S+  W  +  V+  FL SS +F  + L
Sbjct: 68  IDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTL 127

Query: 129 YDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMS 188
           YD+ FNL++N TNN T + +P+DV                     +LTDPVLN +TYLMS
Sbjct: 128 YDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMS 187

Query: 189 MSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASL 248
           MSLPI+ANPS+ L+DS+V+GY+T++MSAE++ +V NDTTALEKS VA++S   ++   S 
Sbjct: 188 MSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTN-GTSG 246

Query: 249 TEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCS 308
            EYHFVFPP+GA+  I++  YP++N +FL DA ++ + GSI K+K  Y+  VAIGY PCS
Sbjct: 247 QEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCS 306

Query: 309 FDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKA 368
           F L +WV  VSQPE VF+S S KLT+IIAGTV+AI VFVC +TFPLS W+V+PIVRLQKA
Sbjct: 307 FGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKA 366

Query: 369 TELIAE 374
           TE+I++
Sbjct: 367 TEVISK 372

 Score =  169 bits (427), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 96/126 (76%), Gaps = 5/126 (3%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN VNQ V+ RMLKLE + N  +ACDG+EA  K+KEI S     +  YY L+ MD+
Sbjct: 920  LIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQS-----RGEYYGLVLMDI 974

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
            QMP++DG+ +TK+IR ELKY KPIVALTAFAD+SNI+ C   GMDGFL+KPIKR +LK I
Sbjct: 975  QMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGI 1034

Query: 1193 LNEFCP 1198
            L EFCP
Sbjct: 1035 LTEFCP 1040

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  429 bits (1103), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/452 (52%), Positives = 291/452 (64%), Gaps = 40/452 (8%)

Query: 478 KVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXXXXXXXKT 537
           +VPV+     DEL+EL +TFN M+D+LD+H  LLEERV+ARTK+L             KT
Sbjct: 469 RVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKT 528

Query: 538 VFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXXXXXFSKN 597
           VFIANISHELRTPLNGILGMTAI++EEDD + ++ SLKLI+RSG            FSKN
Sbjct: 529 VFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKN 588

Query: 598 VLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRIIQI 657
           VLQ+TKLE+  FCI D+ALQIKSIFGK+AKDQ V  SI + PN IRT+V +GDSNRIIQ+
Sbjct: 589 VLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQV 648

Query: 658 VMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKILQKL 717
           +MNLVSNALKFTPIDG V VR+ LLGEYD+EKS   +Y +V++K GT             
Sbjct: 649 IMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGT------------- 695

Query: 718 NTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR-TRDDXXXXXX 776
                     + + DN+    E I +K   IS    SS      SIH+  ++ D      
Sbjct: 696 ----------SFTGDNDAIPTEPISDK---ISFAGGSS------SIHDYCSKTDENDNIK 736

Query: 777 XXXXXYDETVFNDQFKKITGL----QDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPAL 832
                 D T+ +   + I G     ++  +E LGV I +PK WVI ++VEDTGPGI P L
Sbjct: 737 TEIKSDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGISPTL 796

Query: 833 QESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQ 892
           Q+SVFEPFVQGDQ LSRQYGGTGLGLSICRQLA++M+GTM L+S  G GSKFTFTVPL Q
Sbjct: 797 QKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQ 856

Query: 893 TREIVIGXXXXXXXXXXXXXXXYSKKNRKVKF 924
            R+I+                  SKKNRKV F
Sbjct: 857 ERKIIFSETEKAFEDEFNFN---SKKNRKVNF 885

 Score =  395 bits (1015), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 257/369 (69%)

Query: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64
           +  R    PP  + +R QL  L C V+ +SL+IL++ TG+YFT NYK +R ++L IAA+L
Sbjct: 4   KNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQL 63

Query: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124
           KSSQ+DQ+LN+LYYQ  W    D L  A+  YF+GNK++  W +S   V  FL+SS IFS
Sbjct: 64  KSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFS 123

Query: 125 ISRLYDANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTT 184
            + +YD NF  + N +NNGTG  +P+D+                      LTDPVLN++ 
Sbjct: 124 RATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSN 183

Query: 185 YLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDY 244
           YLMS+SLPI  NPSIIL+DS+VYGY+TII  A S+++V+NDTTALE SNVAI+S +Y + 
Sbjct: 184 YLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNS 243

Query: 245 SASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGY 304
           +     YHFVFPPYG+   +IDI+YPL N SFL+DA      GS+  T FFY++ VA+GY
Sbjct: 244 TTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGY 303

Query: 305 SPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVR 364
           S C+F L +WVA+VSQPESVF S + KLT+II+GTVV IA  VCFVTF +S++ VKPI++
Sbjct: 304 STCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIK 363

Query: 365 LQKATELIA 373
           L++ATELI+
Sbjct: 364 LKQATELIS 372

 Score =  145 bits (366), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (76%), Gaps = 5/124 (4%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN VNQEVIKR+LKLEK+  I+ A DG+EA   VK+  S     +K+ +D+IFMD+
Sbjct: 943  LIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKIS-----EKDKFDIIFMDI 997

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
            QMP +DG  +T++IR+EL Y  PIVALTAFAD+SN KEC + GM+ FL+KPIKR +LK+I
Sbjct: 998  QMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEI 1057

Query: 1193 LNEF 1196
            + EF
Sbjct: 1058 IKEF 1061

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  418 bits (1075), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 261/362 (72%), Gaps = 2/362 (0%)

Query: 11  LRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVD 70
           L+PP  I IRTQLTALVC VA +SLIILAV TG+YFT ++K MR +RL +A++LK+SQ+D
Sbjct: 17  LKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQID 76

Query: 71  QTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYD 130
           Q L +LYYQCY+LS RD LQ A+  Y AGN ++  W D+   ++KFL SS++FS++R+YD
Sbjct: 77  QNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYD 136

Query: 131 ANFNLVMNATNNGTGNVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNSTTYLMSMS 190
           ++F  V+NA+NN +GN+VP  V                     MLTDPVLN T YLMSMS
Sbjct: 137 SSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMS 196

Query: 191 LPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTE 250
           LPI ANPSIIL+ SKVYGYIT+++SAE L +V+NDTTALE S+V +VS  Y +    L  
Sbjct: 197 LPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNR--ELAG 254

Query: 251 YHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFD 310
           YH VFPPYG    IID  Y + N SFL DA    K GSI  T F Y+  VAIGYSPCS D
Sbjct: 255 YHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSD 314

Query: 311 LVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATE 370
           LV WVAI++QPES FL PST+L RII GT VAIAV  C VTFPLSHWAV+PIVRLQKATE
Sbjct: 315 LVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATE 374

Query: 371 LI 372
           +I
Sbjct: 375 II 376

 Score =  332 bits (850), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 191/419 (45%), Positives = 239/419 (57%), Gaps = 93/419 (22%)

Query: 782  YDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFV 841
            YD+ +F+ + +K    ++ D    G  ++ P+   I +EV+DTGPGI PALQESVFEPFV
Sbjct: 837  YDDAIFHSRLRKGNSGENED----GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFV 892

Query: 842  QGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGXX 901
            QGDQ LSRQYGGTGLGLSICRQLA MMNG+M L+SKVG GSKFTFTVPLTQT+E+     
Sbjct: 893  QGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEED 952

Query: 902  XXXXXXXXXXXXXYSKKNRKVKFAIPSSPGTTLAXXXXXXXXXXXXXXXXFVGEIQNVNE 961
                          SKKNRKVKF +  +                       VG    V+E
Sbjct: 953  ENPFEDEFNPD---SKKNRKVKFKVSKN-------NKRKKSHSSSSGQNSSVG-TPTVSE 1001

Query: 962  AEEDAYNSKDINSSGELKIRHIXXXXXXXXXIPSLDRPFLQSTGTATSTMKIPVLKDFSN 1021
            +E          S G +++                DRPFLQSTGTA ST           
Sbjct: 1002 SEV---------SVGSVRV----------------DRPFLQSTGTALST----------R 1026

Query: 1022 SATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXXXLVTEDNHVN 1081
            S T  +V N                                          LV EDN+VN
Sbjct: 1027 SVTTTSVAN--------------------------------------KCKVLVAEDNNVN 1048

Query: 1082 QEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLE 1141
            QEVIKRML LE L ++DLACDG++A+ KVK     +  +   +YDLIFMDVQMPR+DGL 
Sbjct: 1049 QEVIKRMLNLEGLDDVDLACDGQDAFDKVK-----ARNEAGKFYDLIFMDVQMPRVDGLS 1103

Query: 1142 STKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGY 1200
            +T++IR+EL YT PIVALTA+AD+ NIKEC+D GM+GFL+KPI+RPK+K+IL+E+CP Y
Sbjct: 1104 ATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY 1162

 Score =  313 bits (801), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 192/258 (74%), Gaps = 1/258 (0%)

Query: 457 FFSSHKSSNTPPPPMST-ILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERV 515
            FS  +S+ +     ST ++E +VP Y RLF DELSELT+TFNTM+D LD+HYALLE+RV
Sbjct: 466 LFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRV 525

Query: 516 RARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLK 575
           RART+QL             KTVFIANISHELRTPLNGILGMTAI+M E+D+  +KSSLK
Sbjct: 526 RARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLK 585

Query: 576 LIFRSGXXXXXXXXXXXXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSI 635
           LIFRSG            FSKNVL+RTKLEERDF + ++ALQ++SIFGK+AKDQHV L+I
Sbjct: 586 LIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTI 645

Query: 636 YLIPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADY 695
            +IPN +RT+VLWGDSNRI+QIVMNLVSNALKFTP+DG+V+V+ +LLGEYD+ K+    +
Sbjct: 646 SIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCF 705

Query: 696 KEVFVKTGTEPEENYSKI 713
               V    E E+  S +
Sbjct: 706 DRAAVVPIQESEKESSTL 723

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  370 bits (949), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 211/434 (48%), Positives = 276/434 (63%), Gaps = 15/434 (3%)

Query: 471 MSTILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLXXXXXXXX 530
           +S   E +VPVYR+LF DEL+ELTDTFN MS+ALD+HYALLE+RV  RTKQL        
Sbjct: 477 LSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAE 536

Query: 531 XXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGXXXXXXXXX 590
                KTVFIANISHELRTPLNGILGMT+ S+EE+DI  IK  LKLIFRSG         
Sbjct: 537 AANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTE 596

Query: 591 XXXFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNE-IRTLVLWG 649
              FSKNVL +TKLE R+F I ++  QIK+IF K+ + Q VKL I L+P + +++L+ +G
Sbjct: 597 LLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYG 656

Query: 650 DSNRIIQIVMNLVSNALKFTP-IDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTE--- 705
           DSNRI+Q++MNL+SNA+KFTP ++GKV V M LLGEYD+E+SK  +Y +V +K  T+   
Sbjct: 657 DSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVT 716

Query: 706 --PEENYSKILQKLN-----TEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTT 758
              E   SKI  K+              SAR   N  ++       N   ++ H  +++ 
Sbjct: 717 ESGELIKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTN-TRTHTHPGADSR 775

Query: 759 FDISIHNRTRDDXXXXXXXXXXXYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVIC 818
            + ++ +   +            YD  +FN   K+  G  D ++ +   +I+  K WVI 
Sbjct: 776 RNSNV-STVNNSSISLDSESSKMYDNLMFNRLIKR-EGDGDINDIKALEQIEGNKKWVIR 833

Query: 819 IEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKV 878
            EV D GPGI   L +SVF+PFVQGDQ LSRQYGGTGLGLSIC+QL  MM GT+ LES++
Sbjct: 834 FEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESEL 893

Query: 879 GSGSKFTFTVPLTQ 892
           G GSKF +T+PL Q
Sbjct: 894 GKGSKFIYTIPLLQ 907

 Score =  339 bits (870), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 176/375 (46%), Positives = 245/375 (65%), Gaps = 7/375 (1%)

Query: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64
           +M +  ++PP    +R QLT LVC VA +SL  LA+ TG+YFT +YK + V+RL IA++L
Sbjct: 11  KMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQL 70

Query: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124
           KSSQ+DQTLN+LYYQCYW++ R+T+QT + +   G  ++S   +SQ V++KF+ +SD+F 
Sbjct: 71  KSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFY 130

Query: 125 ISRLYDANFNLVMNATNNGTG-NVVPNDVXXXXXXXXXXXXXXXXXXXXXMLTDPVLNST 183
            + +YD N   +MN+TNN +G NV P+ +                     +LTDP+LNST
Sbjct: 131 YTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNST 190

Query: 184 TYLMSMSLPI---LANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE 240
            YLMSMSLPI    +  + I   S +YGY+T++MSAESL SV+NDT  L  S  A++S  
Sbjct: 191 KYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAI 250

Query: 241 YSDYSASLTEY-HFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNND 299
           Y++   +L  Y HFVFPP+     IID    ++NG+F Y A +  K GS  K K     +
Sbjct: 251 YTN--DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKN 308

Query: 300 VAIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAV 359
            AIGY+P +F L  WVA+V+ P+  F S S KLT+II GTVV IAVFV  ++ PLS+WAV
Sbjct: 309 YAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAV 368

Query: 360 KPIVRLQKATELIAE 374
           +PIVRLQ+A+ELI +
Sbjct: 369 QPIVRLQRASELITK 383

 Score =  161 bits (407), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            LV EDN VNQEVIKRMLKLE +S+I+LA DG EA+ KVK+  ++ + KK   YD+IFMD+
Sbjct: 1018 LVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKK--NLLSYKK---YDIIFMDI 1072

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
            QMP+MDGLEST  IR ELKY   IVALTAFADESNIKEC D GMDGF+ KPIKR  L  +
Sbjct: 1073 QMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTL 1132

Query: 1193 LNEF 1196
            L EF
Sbjct: 1133 LEEF 1136

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 39/152 (25%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   LK  ++S  ++A +G EA  K ++              LI MD+
Sbjct: 552  LIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWRQ----------GGIHLILMDL 600

Query: 1133 QMPRMDGLESTKLIR-------------SELK-------------YTKP--IVALTAFAD 1164
            Q+P + GLE+TK IR             S+LK             +  P  IVALTAF+ 
Sbjct: 601  QLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSS 660

Query: 1165 ESNIKECLDVGMDGFLSKPIKRPKLKDILNEF 1196
             ++ +E L  G + +L+KP+    L   + E+
Sbjct: 661  HADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 72/152 (47%), Gaps = 39/152 (25%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S  ++A +G EA  K +          K    LI MD+
Sbjct: 512  LIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR----------KGGIHLILMDL 560

Query: 1133 QMPRMDGLESTKLIR-----------------------SEL---KYTKP--IVALTAFAD 1164
            Q+P + G+++ K IR                       SEL   K+  P  IVALTAF+ 
Sbjct: 561  QLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSS 620

Query: 1165 ESNIKECLDVGMDGFLSKPIKRPKLKDILNEF 1196
             ++  E L  G + +L+KP+    L + + E+
Sbjct: 621  HADRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 64/121 (52%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ ++ ++  + L+    + + +  DG  A      IT++ N +    YDL+ MD+
Sbjct: 406  LLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSA------ITTLENSR----YDLVLMDI 454

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T +IRS      PI+A+T   D+ ++   L  GM+  L+KP  R  L  +
Sbjct: 455  VMPNLDGATATSIIRS-FDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSM 513

Query: 1193 L 1193
            L
Sbjct: 514  L 514

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 70/144 (48%), Gaps = 31/144 (21%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ +++  LK  K+S   +A +G+EA  + KE             DLIFMD+
Sbjct: 504  LIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWKE----------GGIDLIFMDL 552

Query: 1133 QMPRMDGLESTKLIR-----------------SELKYTKP---IVALTAFADESNIKECL 1172
            Q+P   G+++ K IR                  + K +K    IVA TA    ++ +E L
Sbjct: 553  QLPVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREAL 612

Query: 1173 DVGMDGFLSKPIKRPKLKDILNEF 1196
              G + +L+KP+    L   +NE+
Sbjct: 613  LSGCNDYLTKPVNLHWLSKKINEW 636

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 65/121 (53%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V+ ++  + L+    + + +  DG         +++ISN  +K  YDL+ MD+
Sbjct: 408  LLVEDDSVSIQLCSKFLRKYGCT-VQVVTDG---------LSAISN-LEKFRYDLVLMDI 456

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T   ++ ++   L  GM+  L+KP  R  L  I
Sbjct: 457  VMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSI 515

Query: 1193 L 1193
            L
Sbjct: 516  L 516

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 63/121 (52%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ ++ ++  + L+    + +++  DG  A + +++            YDL+ MD+
Sbjct: 356  LLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR----------YDLVLMDI 404

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T +IRS      PI+A+T   ++ ++   L  GM+  L+KP  R  L  +
Sbjct: 405  VMPNLDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSM 463

Query: 1193 L 1193
            L
Sbjct: 464  L 464

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 61/121 (50%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V  ++  + L+    S +++  DG  A   V++            YDL+ MD+
Sbjct: 321  LLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ----------YDLVLMDI 369

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T +IRS      PI+A+T   ++ ++   L  GM+  L+KP  +  L  +
Sbjct: 370  VMPNLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSM 428

Query: 1193 L 1193
            L
Sbjct: 429  L 429

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 61/121 (50%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V  ++  + L+    S +++  DG  A   V++            YDL+ MD+
Sbjct: 332  LLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ----------YDLVLMDI 380

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T +IRS      PI+A+T   ++ ++   L  GM+  L+KP  +  L  +
Sbjct: 381  VMPNLDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSM 439

Query: 1193 L 1193
            L
Sbjct: 440  L 440

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 64/121 (52%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V  ++  + L L+   ++++  DG  A + +++            YDL+ MD+
Sbjct: 310  LLVEDDSVCIQLCSKFL-LKYGCSVEVVTDGLSAISTLEKF----------RYDLVLMDI 358

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T   ++ ++   L+ GM+  L+KP  +  L  +
Sbjct: 359  VMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSM 417

Query: 1193 L 1193
            L
Sbjct: 418  L 418

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V  ++  + L+    S +++  DG  A + ++          K  +DL+ MD+
Sbjct: 332  LLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLE----------KQRFDLVLMDI 380

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T   D+ ++   L  GM+  L+KP  +  L  +
Sbjct: 381  VMPNLDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSM 439

Query: 1193 L 1193
            L
Sbjct: 440  L 440

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V+ ++  + L+    + + +  DG  A + ++          K  YDL+ MD+
Sbjct: 380  LLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLE----------KYRYDLVLMDI 428

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T      ++   L  GM+  L+KP  R  L  I
Sbjct: 429  VMPNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 487

Query: 1193 L 1193
            L
Sbjct: 488  L 488

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V+ ++  + L+    + + +  DG  A + +++            YDL+ MD+
Sbjct: 382  LLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF----------RYDLVLMDI 430

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T      ++   L  GM+  L+KP  R  L  I
Sbjct: 431  VMPNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 489

Query: 1193 L 1193
            L
Sbjct: 490  L 490

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 65/140 (46%), Gaps = 40/140 (28%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G+EA  K KE              LIFMD+
Sbjct: 466  LIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKEGN----------LHLIFMDL 514

Query: 1133 QMPRMDGLESTKLIRSELKYTKP----------------------------IVALTAFAD 1164
            Q+P + G+E+ K IR EL+  +                             IVALTA   
Sbjct: 515  QLPVLSGIEAAKKIR-ELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNS 573

Query: 1165 ESNIKECLDVGMDGFLSKPI 1184
            + + +E L  G + +L+KP+
Sbjct: 574  QEDKREALISGCNDYLTKPV 593

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (51%), Gaps = 18/118 (15%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G+EA    K               LIFMD+
Sbjct: 478  LIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEAVEMWK----------NGGLHLIFMDL 526

Query: 1133 QMPRMDGLESTKLIRSELKYTKP------IVALTAFADESNIKECLDVGMDGFLSKPI 1184
            Q+P + G+++ K IR + +  +P      IVALTA     + +  L  G + +L+KP+
Sbjct: 527  QLPVLSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPV 583

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V+ ++  + L+    + + +  DG  A + +++            YDL+ MD+
Sbjct: 381  LLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF----------RYDLVLMDI 429

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T      ++   L  GM+  L+KP  R  L  I
Sbjct: 430  VMPNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 488

Query: 1193 L 1193
            L
Sbjct: 489  L 489

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 12/142 (8%)

Query: 1052 VTQNNSSXXXXXXXXXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVK 1111
            + Q NS               L+ ED+ V+ ++  + L+    + +++  DG  A + ++
Sbjct: 406  IKQENSQSPTATEELRKGYHVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILE 464

Query: 1112 EITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKEC 1171
                         YDL+ MD+ MP +DG  +T +IR+  K T PI+A+T   ++ ++   
Sbjct: 465  AF----------RYDLVLMDIVMPNLDGATATSIIRNFDKET-PIIAMTGNIEDQDLITY 513

Query: 1172 LDVGMDGFLSKPIKRPKLKDIL 1193
            L  GM   L+KP  R  L  +L
Sbjct: 514  LQHGMTDILAKPFTRDDLLSML 535

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V+ ++  + L+    + + +  DG  A + +++            YDL+ MD+
Sbjct: 382  LLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF----------RYDLVLMDI 430

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T      ++   L  GM+  L+KP  R  L  I
Sbjct: 431  VMPNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSI 489

Query: 1193 L 1193
            L
Sbjct: 490  L 490

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 64/121 (52%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V  ++  + L+    + +++  DG  A + ++          K  YDL+ MD+
Sbjct: 337  LLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLE----------KFRYDLVLMDI 385

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS   +T PI+A+T   ++ ++   L  GM+  L+KP  +  L  +
Sbjct: 386  VMPNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSM 444

Query: 1193 L 1193
            L
Sbjct: 445  L 445

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 62/119 (52%), Gaps = 18/119 (15%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G+EA    KE              LIFMD+
Sbjct: 520  LIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE----------GGLHLIFMDL 568

Query: 1133 QMPRMDGLESTKLIRS-ELKYTKP------IVALTAFADESNIKECLDVGMDGFLSKPI 1184
            Q+P + G+++ K IR  E K T        IVALTA     + ++ L  G + +L+KP+
Sbjct: 569  QLPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPV 627

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 64/121 (52%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V  ++  + L+    + +++  DG  A + +++            YDL+ MD+
Sbjct: 379  LLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKF----------RYDLVLMDI 427

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS   +T PI+A+T   ++ ++   L  GM+  L+KP  +  L  +
Sbjct: 428  VMPNLDGATATSIVRSFDIHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSM 486

Query: 1193 L 1193
            L
Sbjct: 487  L 487

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 89/188 (47%), Gaps = 14/188 (7%)

Query: 1006 TATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXX 1065
            T +ST  +   +D ++ +T DNV N +  +++      GG+   +  ++N+         
Sbjct: 320  TESSTQSLVNAQDSTSQSTPDNVRNVQAPTNVPIPDVIGGSA--DINSKNDDIGDVDSNE 377

Query: 1066 XXXXXXXLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYY 1125
                   L+ ED+ V+ ++  + L+    + + +  DG  A + +++            +
Sbjct: 378  LKKGFHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKF----------RF 426

Query: 1126 DLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIK 1185
            DL+ MD+ MP +DG  +T +IR+    T PI+A+T   +  ++   L  GM+  L+KP  
Sbjct: 427  DLVLMDIVMPNLDGATATSIIRNFDNRT-PIIAMTGSIEHQDLITYLQHGMNDILAKPFT 485

Query: 1186 RPKLKDIL 1193
            R  L  IL
Sbjct: 486  RKDLYSIL 493

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1125 YDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPI 1184
            YDL+ MD+ MP +DG  +T ++RS      PI+A+T   ++ ++   L  GM+  L+KP 
Sbjct: 349  YDLVLMDIVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPF 407

Query: 1185 KRPKLKDIL 1193
             +  L  +L
Sbjct: 408  TKDDLHSML 416

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 1125 YDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPI 1184
            +DL+ MD+ MP +DG  +T ++R+   YT PI+A+T   ++ ++   L  GM+  L+KP 
Sbjct: 460  FDLVLMDIVMPNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPF 518

Query: 1185 KRPKLKDIL 1193
             +  L  +L
Sbjct: 519  TKRDLHSML 527

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 30/131 (22%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G+EA    KE              LIFMD+
Sbjct: 548  LIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE----------GGLHLIFMDL 596

Query: 1133 QMPRMDGLESTKLIRS--------------ELKYTKP-----IVALTAFADESNIKECLD 1173
            Q+P + G+E+ + IR+               LK  K      IVALTA   + + +  L 
Sbjct: 597  QLPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALI 656

Query: 1174 VGMDGFLSKPI 1184
             G + +L+KP+
Sbjct: 657  SGCNDYLTKPV 667

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 62/121 (51%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ V+  +  + L+    + +++  DG  A + +++            YDL+ MD+
Sbjct: 384  LLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKF----------RYDLVLMDI 432

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T +IR+      PI+A+T   ++ ++   L  GM+  L+KP  +  L  +
Sbjct: 433  VMPNLDGATATSIIRN-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSM 491

Query: 1193 L 1193
            L
Sbjct: 492  L 492

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 79/185 (42%), Gaps = 34/185 (18%)

Query: 1012 KIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSXXXXXXXXXXXXX 1071
            K P + D  N      + NDE  + +      G TI+++G                    
Sbjct: 314  KTPSISDLPNPI----LENDENINTIDGDLAQGDTILKKGFN------------------ 351

Query: 1072 XLVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMD 1131
             L+ ED+ V+ ++  + L       I   C  +     +  I+++    +K  +DL+ MD
Sbjct: 352  VLLVEDDEVSIQLCSKFL-------IKYGCTVQVVTDGLAAISTL----EKYRFDLVLMD 400

Query: 1132 VQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKD 1191
            + MP +DG  +T +IR+      PI+A+T   +  ++   L  GM+  L+KP  R  L  
Sbjct: 401  IVMPNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYS 459

Query: 1192 ILNEF 1196
            +L  +
Sbjct: 460  MLTRY 464

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 62/121 (51%), Gaps = 12/121 (9%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ ED+ +  ++  + L ++    +++  DG  A + +++            +DL+ MD+
Sbjct: 305  LLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKFR----------FDLVLMDI 353

Query: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192
             MP +DG  +T ++RS      PI+A+T   ++ ++   L  GM+  L+KP  +  L  +
Sbjct: 354  VMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSM 412

Query: 1193 L 1193
            L
Sbjct: 413  L 413

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 62/135 (45%), Gaps = 34/135 (25%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            LV EDN +NQ ++   L+  K+S   +A +G EA  + KE              LI MD+
Sbjct: 422  LVVEDNMINQTILSSFLRKHKIS-YKVAKNGIEAVDRWKE----------GGMHLILMDL 470

Query: 1133 QMPRMDGLESTKLIRSELKYT-----KP------------------IVALTAFADESNIK 1169
            +MP + G+++ K IR   K       KP                  IVALTA   +S+  
Sbjct: 471  EMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKT 530

Query: 1170 ECLDVGMDGFLSKPI 1184
            E L  G + +L+KP+
Sbjct: 531  EALLAGCNDYLTKPV 545

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 38/139 (27%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   LA +G+EA    KE              LIFMD+
Sbjct: 489  LIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE----------GGLHLIFMDL 537

Query: 1133 QMPRMDGLESTKLIRS-----------ELKYTKP----------------IVALTAFADE 1165
            Q+P + G+E+ K IR             L  + P                IVALTA   +
Sbjct: 538  QLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQ 597

Query: 1166 SNIKECLDVGMDGFLSKPI 1184
             + ++ L  G + +L+KP+
Sbjct: 598  MDKRKALVSGCNDYLTKPV 616

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 38/139 (27%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   LA +G+EA    KE              LIFMD+
Sbjct: 506  LIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE----------GGLHLIFMDL 554

Query: 1133 QMPRMDGLESTKLIR----------------SELKYTKP-----------IVALTAFADE 1165
            Q+P + G+E+ K IR                S   + K            IVALTA   +
Sbjct: 555  QLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQ 614

Query: 1166 SNIKECLDVGMDGFLSKPI 1184
             + ++ L  G + +L+KP+
Sbjct: 615  MDKRKALLSGCNDYLTKPV 633

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 65/139 (46%), Gaps = 38/139 (27%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   LA +G+EA    KE              LIFMD+
Sbjct: 496  LIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE----------GGLHLIFMDL 544

Query: 1133 QMPRMDGLESTKLIR------------------------SELKYTKP---IVALTAFADE 1165
            Q+P + G+E+ K IR                        +  K+++    IVALTA   +
Sbjct: 545  QLPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQ 604

Query: 1166 SNIKECLDVGMDGFLSKPI 1184
             + ++ L  G + +L+KP+
Sbjct: 605  MDKRKALLSGCNDYLTKPV 623

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 38/139 (27%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   LA +G+EA    KE              LIFMD+
Sbjct: 507  LIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE----------GGLHLIFMDL 555

Query: 1133 QMPRMDGLESTKLIR------------------------SELKYTKP---IVALTAFADE 1165
            Q+P + G+E+ K IR                        +  ++++    IVALTA   +
Sbjct: 556  QLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQ 615

Query: 1166 SNIKECLDVGMDGFLSKPI 1184
             + ++ L  G + +L+KP+
Sbjct: 616  MDKRKALLSGCNDYLTKPV 634

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 33/134 (24%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            LV EDN +NQ ++   L+  K+ +  +A +G EA  + KE              LI MD+
Sbjct: 409  LVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEAVDRWKE----------GGMHLILMDL 457

Query: 1133 QMPRMDGLESTKLIR-----------------SELK---YTKP--IVALTAFADESNIKE 1170
            +MP + G+++ K IR                 +ELK      P  IVALTA   +++  E
Sbjct: 458  EMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTE 517

Query: 1171 CLDVGMDGFLSKPI 1184
             L  G + +L+KP+
Sbjct: 518  ALLAGCNDYLTKPV 531

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 67/150 (44%), Gaps = 37/150 (24%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+    +A +G+EA    +E              LIFMD+
Sbjct: 568  LIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAIDVWRE----------GGIHLIFMDL 616

Query: 1133 QMPRMDGLESTKLIRS--------------------------ELKYTKPIVALTAFADES 1166
            Q+P + G+++ K IR                           ++     IVA TA   +S
Sbjct: 617  QLPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQS 676

Query: 1167 NIKECLDVGMDGFLSKPIKRPKLKDILNEF 1196
            + KE L  G + +L+KP+    L + +NE+
Sbjct: 677  DKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 64/140 (45%), Gaps = 39/140 (27%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G EA  K KE              LIFMD+
Sbjct: 474  LIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKE----------GGIHLIFMDL 522

Query: 1133 QMPRMDGLESTKLIR--SELK-------------------YTKPI-------VALTAFAD 1164
            Q+P M G+++ K IR   +LK                     KP+       VA TA   
Sbjct: 523  QLPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNS 582

Query: 1165 ESNIKECLDVGMDGFLSKPI 1184
             ++ +E L  G + +L+KP+
Sbjct: 583  LTDKREALVSGCNDYLTKPV 602

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 64/142 (45%), Gaps = 41/142 (28%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G EA  K KE              LIFMD+
Sbjct: 514  LIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWKE----------GGLHLIFMDL 562

Query: 1133 QMPRMDGLESTKLIR-------------------SELKYTKP-----------IVALTAF 1162
            Q+P + G+++ K IR                   + L+ TK            IVA TA 
Sbjct: 563  QLPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTAS 622

Query: 1163 ADESNIKECLDVGMDGFLSKPI 1184
               ++ +E L  G + +L+KP+
Sbjct: 623  NSLTDKREALISGCNDYLTKPV 644

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 41/75 (54%), Gaps = 11/75 (14%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+   +S   +A DG EA  K KE  S           LI MD+
Sbjct: 397  LIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWKEGDS----------HLILMDL 445

Query: 1133 QMPRMDGLESTKLIR 1147
            Q+P + GLE+TK IR
Sbjct: 446  QLPLLSGLEATKKIR 460

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 34/135 (25%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G+EA    KE              LIFMD+
Sbjct: 673  LIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE----------GGLHLIFMDL 721

Query: 1133 QMPRMDGLESTKLIR------------SELKY---------TKP--IVALTAFADESNIK 1169
            Q+P + G+E+ + IR            + LK            P  IVALTA     + +
Sbjct: 722  QLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKR 781

Query: 1170 ECLDVGMDGFLSKPI 1184
            + L  G + +L+KP+
Sbjct: 782  KALLSGCNDYLTKPV 796

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 11/76 (14%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+S   +A +G EA  K K+              LI +D+
Sbjct: 465  LIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWKQ----------GGIHLILLDL 513

Query: 1133 QMPRMDGLESTKLIRS 1148
            Q+P + G+E+TK IR+
Sbjct: 514  QLPILSGIEATKEIRN 529

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 14/84 (16%)

Query: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132
            L+ EDN +NQ ++   L+  K+    +A +G EA  K KE              LIFMD+
Sbjct: 568  LIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE----------GGIHLIFMDL 616

Query: 1133 QMPRMDGLESTKLIRSELKYTKPI 1156
            Q+P + G ++ K IR   +Y K I
Sbjct: 617  QLPVLSGTDAAKEIR---QYEKKI 637

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 15/79 (18%)

Query: 819 IEVEDTGPGIHPALQESVFEPFV------QGDQALS---------RQYGGTGLGLSICRQ 863
           I + D G GI P +++ VF+         + D  +S         +   G G GL +C+ 
Sbjct: 327 IRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMCKA 386

Query: 864 LATMMNGTMVLESKVGSGS 882
              + NGT+ ++S  G G+
Sbjct: 387 YLELFNGTLDIQSLWGWGT 405

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 12/78 (15%)

Query: 1125 YDLIFMDVQMPRMDGLESTKLIR--SELKYTKPIVALTAF---ADESNIKECLDVGMDGF 1179
            +DLI   +++P++  ++  KLIR  + +  T PIVALT +   A ES +        D  
Sbjct: 1484 FDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVYYHDAKESKV-------FDDV 1536

Query: 1180 LSKPIKRPKLKDILNEFC 1197
            L KP+   +L+ +++++ 
Sbjct: 1537 LEKPVSVEQLRKLVSKYA 1554

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 15/79 (18%)

Query: 819 IEVEDTGPGIHPALQESVFEPFVQGDQALSRQYG---------------GTGLGLSICRQ 863
           I + D G GI P +++ +FE      QA ++  G               G G GL +C+ 
Sbjct: 319 IRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKA 378

Query: 864 LATMMNGTMVLESKVGSGS 882
              M +G++ ++S  G G+
Sbjct: 379 YLEMFDGSLDIQSLYGWGT 397

>TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {ON}
            Anc_1.507 YKL198C
          Length = 839

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 1103 GEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAF 1162
            G+   T+V       NPK +   D +F D   P  D +E+   +  E+    P +  +  
Sbjct: 477  GDSDATRVTWRLMDPNPKTRYTMDQLFED---PWFDAIETCVHLDDEISIKFPEIRKSTQ 533

Query: 1163 AD---ESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYHLQNNTDTNKGLQ 1213
            AD   ES IK  L V  D  L+ P+ RPKLK +L+          +T +NK LQ
Sbjct: 534  ADGSVESLIKSGLHVENDD-LNHPV-RPKLKSMLDVVSKSTQSNASTQSNKSLQ 585

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 1125 YDLIFMDVQMPRMDGLESTKLIR--SELKYTKPIVALTAFADESNIKECLDVGMDGFLSK 1182
            +DLIF  +++P++  ++  KL+R  + +  T  I+A+TA+  E+  + C     D  L +
Sbjct: 1434 FDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLER 1489

Query: 1183 PIKRPKLKDIL 1193
            P+   +L+ +L
Sbjct: 1490 PVSVQQLRSLL 1500

>Suva_9.158 Chr9 complement(263759..264940) [1182 bp, 393 aa] {ON}
           YIL042C (REAL)
          Length = 393

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 47/114 (41%), Gaps = 15/114 (13%)

Query: 784 ETVFNDQFKKITGLQ-DHDEERLGVEIK--EPKTWVICIEVEDTGPGIHPALQESVF--- 837
           E +  + FK     Q  H +E + +EI   +P    + I + D G GI P ++  +F   
Sbjct: 262 EYIMTEVFKNAFEAQIAHGQEHVPIEINLLKPDDDELYIRIRDHGGGITPEVEALMFDYS 321

Query: 838 ------EPFVQGDQALSRQ---YGGTGLGLSICRQLATMMNGTMVLESKVGSGS 882
                 +P  +       Q     G G GL +C+    +  G M ++S  G G+
Sbjct: 322 YSTHSQQPSEEATDLPGEQINNVSGMGFGLPMCKTYLELFGGKMDIQSLPGWGT 375

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 40/98 (40%), Gaps = 17/98 (17%)

Query: 807 VEIKEPKTWVICIEVEDTGPGIHPALQESVFE----------------PFVQGDQALSRQ 850
           V +  P    + + V D G GI P ++  +F+                  +   +A+ + 
Sbjct: 303 VTLLRPHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQMHAGEAV-KS 361

Query: 851 YGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTV 888
             G G GL +CR    + +G + ++S  G G+    T+
Sbjct: 362 VAGMGFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 7/75 (9%)

Query: 1125 YDLIFMDVQMPRMDGLESTKLIR--SELKYTKPIVALTAFADESNIKECLDVGMDGFLSK 1182
            +DLI   +++P++  ++ T+L+R  + +  T PIVA+T      N  +      D  L +
Sbjct: 1483 FDLIITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTV-----NYHDAGTHIFDDVLER 1537

Query: 1183 PIKRPKLKDILNEFC 1197
            PI   +L+ +++++ 
Sbjct: 1538 PIGTEQLRKLVSKYA 1552

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 1125 YDLIFMDVQMPRMDGLESTKLIRSE--LKYTKPIVALTAFADESNIKECLDVGMDGFLSK 1182
            +DLI   +++P++  ++  +L+R       T PIVA+T +  E+   +      D  L K
Sbjct: 1668 FDLIMTALKLPKLGAIDIVQLLRQTNGANSTTPIVAITNYFQEAITSKVF----DDVLEK 1723

Query: 1183 PIKRPKLKDILNEFC 1197
            P+   +LK ++ ++ 
Sbjct: 1724 PVNLDELKKLVAKYA 1738

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 111,243,396
Number of extensions: 4519349
Number of successful extensions: 15271
Number of sequences better than 10.0: 82
Number of HSP's gapped: 15519
Number of HSP's successfully gapped: 143
Length of query: 1214
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1093
Effective length of database: 39,606,813
Effective search space: 43290246609
Effective search space used: 43290246609
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)