Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0I014802.533ON5133217577e-94
TDEL0A030702.533ON239562422e-22
KAFR0A018602.533ON490542505e-22
KNAG0C058102.533ON554552507e-22
NCAS0A048002.533ON511532462e-21
Suva_13.2462.533ON419622432e-21
TPHA0G035102.533ON387582422e-21
Kpol_1018.332.533ON589502453e-21
Skud_13.2262.533ON475622433e-21
TBLA0G022302.533ON216602305e-21
ZYRO0B02002g2.533ON294502347e-21
YMR070W (MOT3)2.533ON490622408e-21
Smik_13.2492.533ON473532381e-20
SAKL0A09482g2.533ON388512342e-20
NCAS0F009002.533ON525572354e-20
NDAI0K018602.533ON730532374e-20
KLLA0E18547g2.533ON431522334e-20
AGL071C2.533ON396532315e-20
NDAI0H014002.533ON541522346e-20
Ecym_72552.533ON544532347e-20
CAGL0K03003g2.533ON647512276e-19
Kwal_26.80212.533ON507542151e-17
KLTH0D06842g2.533ON506542105e-17
KAFR0J003402.533ON218531944e-16
TPHA0C041902.533ON417531962e-15
KNAG0A070402.533ON352521632e-11
NCAS0A129102.598ON822551538e-10
TBLA0H028302.598ON746581501e-09
NDAI0B013402.598ON769501483e-09
Suva_13.2062.598ON709501473e-09
CAGL0F05995g2.598ON597531473e-09
Skud_13.1932.598ON704501464e-09
YMR037C (MSN2)2.598ON704501465e-09
Smik_13.2072.598ON703501456e-09
ZYRO0F01012g2.598ON584611431e-08
KNAG0H005502.598ON620541402e-08
YKL062W (MSN4)2.598ON630501402e-08
Smik_11.1862.598ON641501393e-08
Skud_11.1672.598ON628501384e-08
Kpol_185.32.598ON647501384e-08
KAFR0F020702.598ON370531364e-08
NDAI0C005602.598ON972501376e-08
CAGL0M13189g2.598ON541501358e-08
KAFR0A023202.598ON443501349e-08
CAGL0L06072g8.144ON300511329e-08
TDEL0B069102.598ON437611331e-07
TBLA0G019202.598ON523501331e-07
Kpol_1013.212.598ON494501332e-07
Suva_11.1642.598ON639501332e-07
SAKL0B11330g2.598ON499501322e-07
TPHA0N014602.598ON519511322e-07
NCAS0H030802.598ON730601322e-07
ABR089C2.598ON571501312e-07
KNAG0M023102.598ON660501313e-07
Kwal_26.83512.598ON698501303e-07
KLLA0F26961g2.598ON694501303e-07
Ecym_23012.598ON767501304e-07
KLTH0D08734g2.598ON677501304e-07
TPHA0C025802.598ON365561276e-07
KNAG0G012808.144ON472501286e-07
ACL057W8.144ON520601278e-07
Ecym_84038.144ON573601278e-07
KLTH0E06688g8.144ON397501223e-06
Kpol_1031.428.144ON359511213e-06
Kwal_26.80112.531ON190511163e-06
SAKL0H24816g8.144ON410501214e-06
Kwal_47.172418.144ON403501195e-06
ZYRO0G19140g8.144ON557501198e-06
NCAS0C040708.144ON289491151e-05
NDAI0C048608.425ON1350531181e-05
NCAS0B046008.144ON547501171e-05
KLLA0C17072g8.144ON474501162e-05
CAGL0K02145g8.144ON317501142e-05
TDEL0B046708.144ON312501132e-05
TPHA0D010508.144ON439501142e-05
TBLA0F003708.144ON687511153e-05
KNAG0D021208.144ON402501133e-05
KLLA0F13046g8.425ON1379531144e-05
KAFR0B063608.425ON627471134e-05
Kpol_529.138.425ON1410481135e-05
TPHA0C021608.425ON1375531135e-05
NDAI0B019308.144ON436501116e-05
KAFR0B025508.234ON890531127e-05
Smik_5.2768.144ON442501107e-05
Suva_5.2518.144ON449501107e-05
Suva_16.766.256ON392561108e-05
YPL230W (USV1)6.256ON391561108e-05
Skud_5.2488.144ON442501108e-05
NCAS0B028408.425ON1152531118e-05
ZYRO0A09416g8.425ON1346481119e-05
YER130C8.144ON443501091e-04
TDEL0F055008.425ON1207481101e-04
Skud_16.486.256ON398561081e-04
ZYRO0B11770g8.234ON867531091e-04
Smik_6.4356.256ON386551071e-04
TBLA0H006608.425ON1311531092e-04
NDAI0G034208.144ON484501072e-04
CAGL0E04884g8.425ON1489481082e-04
SAKL0H12958g8.425ON1129481072e-04
ADL198W2.303ON547511072e-04
TDEL0A013008.234ON837531073e-04
KAFR0B021608.144ON453501053e-04
Kpol_1072.582.162ON794481063e-04
ADR308Cna 1ON278501034e-04
KLTH0H08800g8.117ON168621004e-04
TBLA0F038308.234ON967531054e-04
KLTH0E09922g8.425ON1119531054e-04
KNAG0G018708.234ON875531054e-04
Kwal_27.114602.303ON531511045e-04
Kwal_47.190453.518ON266511025e-04
NDAI0C06260na 2ON582511045e-04
KLLA0F01463g1.326ON781491045e-04
AGR172W8.425ON1057481046e-04
KAFR0C029808.144ON225501006e-04
SAKL0F01980g3.518ON385521026e-04
NCAS0B05750singletonON505511036e-04
TPHA0B003804.351ON1310471047e-04
Suva_2.3838.425ON1319521037e-04
YDR216W (ADR1)8.425ON1323521037e-04
SAKL0E07216g2.303ON548511027e-04
Kpol_1052.83.298ON386561027e-04
NDAI0B022508.234ON1156531038e-04
KLLA0F20636gsingletonON285501008e-04
KNAG0I020702.162ON572511028e-04
NDAI0I009906.256ON409561018e-04
Smik_4.4638.425ON1324521038e-04
SAKL0H17842g8.234ON814531029e-04
Ecym_4128na 3ON312621009e-04
Suva_13.704.351ON777471020.001
CAGL0E06116g6.256ON613551020.001
Kwal_23.54007.543ON429571010.001
KAFR0E042704.351ON1255471020.001
KLTH0G10802g2.303ON526511010.001
KLTH0G14454g8.234ON832571010.001
TPHA0D034003.518ON338611000.001
TBLA0E042208.234ON519501010.001
Skud_4.4788.425ON1323521010.001
KAFR0A008001.326ON753491010.001
TBLA0E04210singletonON454501000.001
Kwal_56.234538.234ON828531010.001
Smik_13.584.351ON1253471010.001
TPHA0A019408.234ON912531010.001
KLTH0G01826g3.518ON30751990.001
SAKL0E10714g2.162ON819481010.001
Ecym_54242.162ON775481010.001
CAGL0L11880g8.234ON980531010.001
CAGL0M00594g4.351ON1020521010.001
NCAS0G012706.256ON27447980.001
Kpol_1032.528.234ON824531000.001
Skud_13.614.351ON1253471010.001
YML081W (TDA9)4.351ON1251471010.001
KAFR0F012106.256ON31155990.001
ACR264W2.162ON769481000.002
NDAI0I029003.518ON524581000.002
AGR117C8.234ON799521000.002
KLLA0C17710g8.234ON821531000.002
Kpol_1001.14.351ON1341471000.002
KAFR0C057105.586ON44274990.002
Smik_4.3378.234ON89453990.002
ZYRO0D13992g5.586ON58774990.002
AEL278W7.543ON47657980.002
TBLA0B060502.303ON76251990.002
NDAI0G058001.326ON83649990.002
NCAS0B048408.234ON86453990.002
KNAG0A044608.425ON129047990.002
ZYRO0G20526g1.326ON84949990.002
YDR096W (GIS1)8.234ON89453990.002
Kpol_1023.1004.351ON91645990.002
Suva_2.2558.234ON89453990.002
Skud_5.3088.234ON80253990.002
YER169W (RPH1)8.234ON79653990.002
Smik_5.3418.234ON79853980.002
Suva_5.3038.234ON79753980.003
Skud_4.3548.234ON91653980.003
ZYRO0E08426g3.518ON17156940.003
Kpol_541.398.116ON29150960.003
Kpol_1023.635.586ON55667980.003
Ecym_35208.234ON81950980.003
TBLA0B012802.162ON82348980.003
KAFR0F041503.518ON41651970.003
AGR186Cna 3ON28762960.003
Suva_8.1662.162ON94848980.003
KNAG0B005903.518ON43951970.003
Ecym_33412.303ON56051970.003
TBLA0C048803.518ON33957960.003
TPHA0A039103.298ON35154960.003
NDAI0B042902.162ON106452970.003
TBLA0I032803.518ON33057960.004
KLLA0F23782g2.162ON78252970.004
TDEL0F026904.80ON35050960.004
Kpol_1065.483.298ON36456960.004
TPHA0G008202.303ON53251960.004
KNAG0C060305.586ON31464950.004
Kwal_14.22068.117ON25462940.004
SAKL0G18062g4.351ON123847970.004
TDEL0G023302.303ON50651960.004
KNAG0H030108.234ON78456960.004
KNAG0M003504.351ON107647960.005
CAGL0M01870g3.298ON31564950.005
YOR113W (AZF1)2.162ON91448960.005
KAFR0H032402.303ON51951950.005
Skud_15.2762.162ON91748960.005
Kwal_47.178882.162ON78652960.005
KAFR0B068104.351ON115547960.005
Suva_16.5187.543ON42744950.006
ZYRO0B14894g4.351ON111947960.006
NCAS0I014603.298ON33060940.006
Ecym_28177.543ON43157940.006
KLTH0E09724g2.162ON76852950.006
KNAG0H019302.303ON61851950.006
AEL174W1.326ON66150950.006
Kwal_47.166214.351ON117847950.006
Smik_15.2912.162ON90948950.006
SAKL0A09438g2.531ON44151940.006
TBLA0E028205.586ON31262940.006
NCAS0E006103.518ON40156940.006
Ecym_21596.256ON46060940.006
Ecym_8011na 1ON27650930.006
KLTH0H15048gna 4ON29660930.006
KLTH0D18062g4.351ON112847950.007
TPHA0B029102.162ON71747950.007
AER159C4.351ON119147950.007
NDAI0D032404.351ON136247950.007
NCAS0F00910singletonON35049930.008
KNAG0E016003.518ON33852930.008
KLLA0F10109g5.586ON62367940.008
Kwal_27.109253.281ON26460920.008
TDEL0B052502.162ON71448940.008
ADL051Wna 5ON17362900.008
TBLA0B061604.351ON138452940.008
KLLA0B04477g4.351ON133247940.009
KNAG0J008703.281ON28051920.009
NCAS0B069602.162ON83948940.009
ZYRO0A02288g2.303ON61950930.009
CAGL0L03916g2.162ON64247930.009
Smik_13.3876.256ON21247900.009
YGL209W (MIG2)3.518ON38256930.009
KAFR0C04550singletonON46748930.010
SAKL0H04070g4.214ON89952930.010
NDAI0B060203.518ON42659930.010
Skud_13.3486.256ON21647900.010
Kpol_472.104.214ON83050930.010
TDEL0D058603.518ON33058920.011
Skud_8.555.586ON53569920.011
KLLA0B07909g4.214ON92250930.011
TPHA0K002105.586ON48164920.011
CAGL0G08107g8.234ON62552930.012
KAFR0I023703.518ON39158920.012
SAKL0H20394g8.117ON35950920.012
Suva_13.3636.256ON21147900.012
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0I01480
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   296   7e-94
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    98   2e-22
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   100   5e-22
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   100   7e-22
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    99   2e-21
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    98   2e-21
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    98   2e-21
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    99   3e-21
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    98   3e-21
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    93   5e-21
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    95   7e-21
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    97   8e-21
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    96   1e-20
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    95   2e-20
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    95   4e-20
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    96   4e-20
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    94   4e-20
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    94   5e-20
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    95   6e-20
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    95   7e-20
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    92   6e-19
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    87   1e-17
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    86   5e-17
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       79   4e-16
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    80   2e-15
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    67   2e-11
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    64   8e-10
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    62   1e-09
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     62   3e-09
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    61   3e-09
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    61   3e-09
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    61   4e-09
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    61   5e-09
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    60   6e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    60   1e-08
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    59   2e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    59   2e-08
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    58   3e-08
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    58   4e-08
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    58   4e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    57   4e-08
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     57   6e-08
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    57   8e-08
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    56   9e-08
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    55   9e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    56   1e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    56   1e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    56   2e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    56   2e-07
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    55   2e-07
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    55   2e-07
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    55   2e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    55   2e-07
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    55   3e-07
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    55   3e-07
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    55   3e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    55   4e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    55   4e-07
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    54   6e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    54   6e-07
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    54   8e-07
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    54   8e-07
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    52   3e-06
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    51   3e-06
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    49   3e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    51   4e-06
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    50   5e-06
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    50   8e-06
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      49   1e-05
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    50   1e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    50   1e-05
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    49   2e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    49   2e-05
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    48   2e-05
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    49   2e-05
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    49   3e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    48   3e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    49   4e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    48   4e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    48   5e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    48   5e-05
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     47   6e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    48   7e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    47   7e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    47   7e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    47   8e-05
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    47   8e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    47   8e-05
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    47   8e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    47   9e-05
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   1e-04
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    47   1e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    46   1e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    47   1e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    46   1e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    47   2e-04
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    46   2e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    46   2e-04
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    46   2e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    46   2e-04
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    46   3e-04
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    45   3e-04
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    45   3e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    44   4e-04
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    43   4e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    45   4e-04
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    45   4e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    45   4e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    45   5e-04
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    44   5e-04
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             45   5e-04
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    45   5e-04
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    45   6e-04
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    43   6e-04
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    44   6e-04
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    44   6e-04
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    45   7e-04
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    44   7e-04
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    44   7e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    44   7e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    44   7e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    44   8e-04
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    43   8e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    44   8e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    44   8e-04
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    44   8e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    44   9e-04
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    43   9e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    44   0.001
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    44   0.001
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    44   0.001
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    44   0.001
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    44   0.001
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    44   0.001
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    43   0.001
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    44   0.001
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    44   0.001
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    44   0.001
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             43   0.001
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    44   0.001
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    44   0.001
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    44   0.001
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    43   0.001
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    44   0.001
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    44   0.001
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    44   0.001
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    44   0.001
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      42   0.001
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    43   0.001
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    44   0.001
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    44   0.001
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    43   0.001
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    43   0.002
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    43   0.002
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    43   0.002
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    43   0.002
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    43   0.002
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    43   0.002
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    43   0.002
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    43   0.002
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    42   0.002
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    43   0.002
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    43   0.002
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     43   0.002
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    43   0.002
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    43   0.002
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    43   0.002
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    43   0.002
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    43   0.002
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    43   0.002
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    43   0.002
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    42   0.002
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    42   0.003
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    42   0.003
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    41   0.003
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    42   0.003
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    42   0.003
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    42   0.003
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    42   0.003
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    42   0.003
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    42   0.003
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    42   0.003
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    42   0.003
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    42   0.003
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    42   0.003
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    42   0.003
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    42   0.003
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    42   0.004
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    42   0.004
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    42   0.004
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    42   0.004
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   0.004
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    41   0.004
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    41   0.004
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    42   0.004
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    42   0.004
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    42   0.004
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    42   0.005
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    41   0.005
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    42   0.005
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    41   0.005
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    42   0.005
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    42   0.005
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    42   0.005
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    41   0.006
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    42   0.006
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    41   0.006
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    41   0.006
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    41   0.006
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    41   0.006
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    41   0.006
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    41   0.006
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    41   0.006
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    41   0.006
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    41   0.006
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     41   0.006
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    41   0.006
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    40   0.006
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    40   0.006
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    41   0.007
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    41   0.007
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    41   0.007
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    41   0.007
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               40   0.008
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    40   0.008
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    41   0.008
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    40   0.008
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    41   0.008
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    39   0.008
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    41   0.008
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    41   0.009
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    40   0.009
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    41   0.009
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    40   0.009
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    40   0.009
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    39   0.009
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    40   0.009
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               40   0.010
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    40   0.010
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    40   0.010
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    39   0.010
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    40   0.010
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    40   0.011
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    40   0.011
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    40   0.011
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    40   0.011
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    40   0.012
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    40   0.012
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    40   0.012
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    39   0.012
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    40   0.012
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    40   0.012
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    40   0.012
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    40   0.013
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    39   0.013
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    40   0.014
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    40   0.014
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    40   0.014
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    40   0.015
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    40   0.015
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                39   0.015
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    40   0.015
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    40   0.016
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    40   0.016
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    40   0.016
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    40   0.016
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    39   0.016
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    40   0.016
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    40   0.017
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    40   0.017
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     40   0.018
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    39   0.018
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    40   0.019
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     40   0.019
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    39   0.019
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      39   0.020
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    39   0.020
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    39   0.021
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    39   0.022
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    37   0.023
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    39   0.023
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    39   0.024
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    39   0.024
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    39   0.024
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    39   0.024
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    39   0.024
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    39   0.025
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    39   0.026
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    39   0.026
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      39   0.026
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    39   0.026
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    39   0.026
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    39   0.027
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    39   0.027
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    37   0.028
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    39   0.029
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    39   0.029
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     39   0.029
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    39   0.029
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    39   0.029
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    39   0.032
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    39   0.032
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    39   0.032
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    39   0.033
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    39   0.033
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    39   0.034
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               39   0.035
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    38   0.035
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    39   0.036
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    39   0.036
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    39   0.036
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    38   0.037
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    38   0.038
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    39   0.039
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     39   0.039
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    38   0.039
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    38   0.039
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    38   0.040
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    38   0.042
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    39   0.043
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    38   0.044
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    38   0.044
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    39   0.044
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    38   0.044
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    38   0.045
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    38   0.046
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    38   0.046
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    39   0.047
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    38   0.048
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    38   0.048
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    37   0.049
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    38   0.049
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    38   0.050
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    38   0.050
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    39   0.050
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    38   0.051
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    39   0.051
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    38   0.051
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    38   0.051
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    37   0.052
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    38   0.054
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    38   0.055
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    38   0.055
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    37   0.057
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    38   0.057
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    38   0.057
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      38   0.058
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    37   0.060
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      37   0.060
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    38   0.060
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    38   0.061
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    38   0.063
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    38   0.064
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    37   0.066
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    38   0.066
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    38   0.066
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    37   0.067
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    37   0.068
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    37   0.068
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    37   0.072
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    37   0.072
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    37   0.072
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    37   0.073
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    38   0.076
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    38   0.076
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    38   0.077
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    37   0.078
KAFR0C00960 Chr3 (195663..196892) [1230 bp, 409 aa] {ON} Anc_3.1...    37   0.079
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               37   0.079
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    38   0.080
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    38   0.081
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    36   0.082
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    37   0.086
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    37   0.087
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    37   0.089
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    37   0.091
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             37   0.093
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    37   0.093
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    37   0.094
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    37   0.097
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    37   0.097
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    37   0.100
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    37   0.10 
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    37   0.10 
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    37   0.10 
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    37   0.11 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    37   0.11 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    37   0.11 
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     37   0.12 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.12 
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    37   0.12 
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    37   0.13 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    37   0.13 
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    37   0.13 
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    37   0.13 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    37   0.13 
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    37   0.13 
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    37   0.13 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    36   0.14 
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    37   0.14 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     37   0.14 
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    37   0.14 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    36   0.14 
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    37   0.14 
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    37   0.15 
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    36   0.15 
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    37   0.15 
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    37   0.16 
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    37   0.16 
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    37   0.16 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    37   0.16 
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    37   0.16 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.17 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    37   0.17 
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    35   0.17 
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    36   0.17 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    36   0.19 
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    36   0.19 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    36   0.19 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    36   0.19 
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    36   0.20 
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    36   0.20 
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      36   0.20 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    36   0.20 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    35   0.21 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    36   0.21 
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    36   0.23 
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    36   0.25 
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    36   0.25 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    36   0.26 
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    35   0.27 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    36   0.27 
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    35   0.28 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    35   0.28 
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               36   0.28 
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    35   0.28 
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    36   0.29 
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    36   0.29 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    35   0.31 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    35   0.32 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    35   0.34 
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    35   0.35 
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    35   0.37 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    35   0.38 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    35   0.39 
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                35   0.40 
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    35   0.41 
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    35   0.41 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    35   0.41 
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    35   0.42 
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    35   0.42 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     35   0.44 
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    35   0.46 
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               35   0.46 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    35   0.46 
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    35   0.46 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    35   0.49 
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    35   0.50 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    35   0.50 
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    35   0.52 
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    35   0.57 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    35   0.57 
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    34   0.57 
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    35   0.57 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                34   0.62 
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    34   0.62 
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    34   0.64 
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    35   0.64 
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    35   0.65 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    34   0.68 
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    35   0.69 
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    35   0.72 
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    34   0.74 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    34   0.77 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    35   0.77 
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    33   0.81 
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    34   0.89 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    34   1.0  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 34   1.0  
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    33   1.0  
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    34   1.1  
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                33   1.4  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    33   1.4  
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    33   1.4  
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    33   1.4  
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    32   1.4  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    33   1.5  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    33   1.5  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  33   1.6  
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                33   1.7  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    33   1.7  
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      33   1.8  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    33   1.8  
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    33   1.9  
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    33   1.9  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      32   1.9  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    33   1.9  
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    32   2.0  
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    33   2.1  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    33   2.1  
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                32   2.1  
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    33   2.1  
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    32   2.2  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    33   2.2  
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    32   2.2  
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    33   2.3  
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    32   2.5  
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    32   2.5  
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    32   2.7  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    32   2.7  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    33   2.8  
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    32   2.8  
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    31   2.8  
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    32   2.9  
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    32   2.9  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   3.1  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    32   3.1  
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    32   3.4  
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    32   3.5  
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    32   3.5  
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    32   3.5  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    32   3.6  
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    32   3.6  
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    32   3.9  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    32   4.0  
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    31   4.1  
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    30   4.1  
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    32   4.1  
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    31   4.1  
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    31   4.4  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    32   4.6  
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    32   4.8  
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    31   5.0  
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       30   5.1  
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     32   5.6  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    32   5.8  
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    31   5.8  
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    31   5.9  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    32   6.0  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    31   6.2  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    32   6.3  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    30   6.3  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    32   6.5  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    31   8.2  
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    31   8.8  
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    30   8.9  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    30   9.0  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    31   9.4  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    30   9.8  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    31   9.9  

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  296 bits (757), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 171/321 (53%)

Query: 193 YPFQFQLPVTNHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTNQFIRDK 252
           YPFQFQLPVTNHD                                      FTNQFIRDK
Sbjct: 193 YPFQFQLPVTNHDNSTIPSSANTNSTNNNNSYLDSSTSLDNSSNNNLSIPSFTNQFIRDK 252

Query: 253 YLPTSQHHXXXXXXXXXXXXXSFQNVINXXXXXXXXXXXXXXQHPXXXXXXXXXXXXXXX 312
           YLPTSQHH             SFQNVIN              QHP               
Sbjct: 253 YLPTSQHHLPLNNTNTNPNLNSFQNVINPTTLPSSSITPPPLQHPNSLINNSILNNNNNN 312

Query: 313 XXXXXXXXXXXXXXXXXPQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC 372
                            PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC
Sbjct: 313 NANNSNNHNNTANLLNAPQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC 372

Query: 373 CLSKHKRKDNLIQHLKLKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGILHAPNY 432
           CLSKHKRKDNLIQHLKLKH                                 GILHAPNY
Sbjct: 373 CLSKHKRKDNLIQHLKLKHLDYILKKLNKDDLIIKYNLSSNSTTLHNNNLTNGILHAPNY 432

Query: 433 QLKLPLNNSNLYGMGINNLNNQLHPNXXXXXXXXXIYDYNELRLEXXXXXXXXXXXLIND 492
           QLKLPLNNSNLYGMGINNLNNQLHPN         IYDYNELRLE           LIND
Sbjct: 433 QLKLPLNNSNLYGMGINNLNNQLHPNTSSTTSTSSIYDYNELRLENVKKNTVTVKKLIND 492

Query: 493 AKVNKDELKRVINYIISEANK 513
           AKVNKDELKRVINYIISEANK
Sbjct: 493 AKVNKDELKRVINYIISEANK 513

 Score =  114 bits (284), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 65/102 (63%)

Query: 1   MNVPKPNATNNTASQDPLNIPFLNSNSLHLPLXXXXXXXXXXXXXXXXYNPLSSIXXXXX 60
           MNVPKPNATNNTASQDPLNIPFLNSNSLHLPL                YNPLSSI     
Sbjct: 1   MNVPKPNATNNTASQDPLNIPFLNSNSLHLPLQAATAAAAAANAQTQNYNPLSSINSLNS 60

Query: 61  XXXXXXXXXXXXXXXXQQAYLPFANSNAANSLYTQPAFNYPL 102
                           QQAYLPFANSNAANSLYTQPAFNYPL
Sbjct: 61  YSTHTSSNTYSNNNSLQQAYLPFANSNAANSLYTQPAFNYPL 102

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score = 97.8 bits (242), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/56 (76%), Positives = 49/56 (87%)

Query: 336 QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           Q  + +CHLC KSFKRKSWL+RHLLSHS  R+FSCP CLSKHKRKDNL+QH+KLKH
Sbjct: 130 QGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKH 185

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  100 bits (250), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 42/54 (77%), Positives = 48/54 (88%)

Query: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +I  CHLCEKSF+RKSWLKRHLLSHS +R F CP CLS+HKRKDNL+QH+KLKH
Sbjct: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKH 404

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  100 bits (250), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 50/55 (90%)

Query: 337 DIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           + I +CHLCEKSFKR+SWLKRHLLSHS +R++ CP CLS+HKRKDNL+QH+KLKH
Sbjct: 433 NFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKH 487

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/53 (73%), Positives = 49/53 (92%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           ++QCH+C KSF+R SWLKRHLL+HS +R++SCP C+SKHKRKDNL+QHLKLKH
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKH 438

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           P  + +Q  I QC  CEKSFKRKSWLKRHLLSHS++R+F CP CLS+ KRKDNL+QH+KL
Sbjct: 317 PAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 376

Query: 390 KH 391
           KH
Sbjct: 377 KH 378

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%)

Query: 334 INQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +N   IF+C++C K FKRKSWLKRHLLSHS  R +SCP CLSKHKRKDNL+QH+KLKH
Sbjct: 248 MNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           CH+C K FKRKSWL+RHLLSHS +RNF CP CLSKHKRKDNL+QH+KLKH
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKH 528

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (80%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           P S+     I QC  CEKSFKRKSWLKRHLLSHS++R+F CP CLS+ KRKDNL+QH+KL
Sbjct: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377

Query: 390 KH 391
           KH
Sbjct: 378 KH 379

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%)

Query: 489 LINDAKVNKDELKRVINYIISEANK 513
           LIND  +NKD++KRV+N +I   NK
Sbjct: 451 LINDGVLNKDDVKRVLNNLIVSHNK 475

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 93.2 bits (230), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 51/60 (85%)

Query: 332 SAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           S++N+    +C  CEK FKRKSWLKRH+LSHS++R +SCP C+S+HKRKDNL+QH+KLKH
Sbjct: 105 SSMNEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKH 164

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 94.7 bits (234), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C +C+KSFKRKSWL+RHLLSHS +R+F CP CLSKHKRKDNL+QH+KLKH
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 97.1 bits (240), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 50/62 (80%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           P  + +   I QC  CEKSFKRKSWLKRHLLSHS++R+F CP CLS+ KRKDNL+QH+KL
Sbjct: 336 PAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 395

Query: 390 KH 391
           KH
Sbjct: 396 KH 397

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%)

Query: 489 LINDAKVNKDELKRVINYIISEANK 513
           LIND  +NKD++KRV+N +I   NK
Sbjct: 466 LINDGVLNKDDVKRVLNNLIVSHNK 490

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (88%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           I QC  CEKSFKRKSWLKRHLLSHS++R+F CP CLS+ KRKDNL+QH+KLKH
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 389

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%)

Query: 489 LINDAKVNKDELKRVINYIISEANK 513
           LIND  +NKD++KRV+N +I   NK
Sbjct: 449 LINDGVLNKDDVKRVLNNLIVSHNK 473

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 46/51 (90%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           QCHLC+KSFKRKSWLKRHLLSHS  + F+CP C S+HKRKDNL+QH+KLKH
Sbjct: 259 QCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKH 309

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 51/57 (89%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +++ ++ CH+C K+FKR+SWLKRHLLSHS +R++ CP CLS+HKR+DNL+QH+KLKH
Sbjct: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKH 439

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 47/53 (88%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +FQC  C KSFKR SWLKRHLL+HS +R++SCP CLSKHKRKDNL+QHLKLKH
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKH 611

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 40/52 (76%), Positives = 44/52 (84%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +QCHLCEK F+RKSWLKRHLLSHS  + F CP C S HKRKDNL+QHLKLKH
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKH 357

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (84%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           I +CH CEK+FKRKSWLKRHLLSHS  + +SCP C S+HKRKDNL QHLKLKH
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKH 236

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score = 94.7 bits (234), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 47/52 (90%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           ++C +CEK FKR+SWLKRHLLSHS +R++ CP CLS+HKR+DNL+QH+KLKH
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKH 451

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (84%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           I +CH CEK+FKRKSWLKRHLLSHS  + +SCP C S+HKRKDNL QHLKLKH
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKH 337

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 92.0 bits (227), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 38/51 (74%), Positives = 46/51 (90%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +CHLC K FKRKSWLKRHLLSHS++R+F CP C S+HKR+DNL+QH+KLKH
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKH 585

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%)

Query: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           + ++C +C+KSFKR+SW KRHLLSHS  + +SCP C S+HKR+DNL QH+K KH
Sbjct: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKH 440

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 45/54 (83%)

Query: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           ++++C +CEKSFKRKSW +RHLLSHS  + ++CP C S+HKR+DNL QH+K KH
Sbjct: 386 MLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 79.3 bits (194), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +++C++C K F+R++WL+RH LSH+  RNF CP C SKHKR+DNL +H+KLKH
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
            ++C +C K+FKR SWLKRH  SHSK +NFSC  C  K+KRKDNL+QH++ KH
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           + C  C KSF+R +WLKRH ++H+    F C  C S+HKR+DN+ +H+KLKH
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKH 301

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           +++  F+C  C K+F+R   LKRH+ S HS +R F+CP C  K  R DNL QH+K
Sbjct: 760 DENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 332 SAINQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           SAIN+   F+C  C K+F+R   LKRH+ S HS +R FSC  CL K  R DNL QHLK
Sbjct: 683 SAINKP--FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           FQC  C KSF+R   LKRH+ S HSK+R F+C  C  K  R DNL QHLK
Sbjct: 712 FQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSK 364
           F C+LCEK F R   L +HL +H K
Sbjct: 741 FACNLCEKKFSRSDNLSQHLKTHKK 765

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F CH+C KSFKR   LKRH+ S HS +R F+C  C  K  R DNL QH+K
Sbjct: 652 FHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSK 364
           F CH+C+K F R   L +H+ +H K
Sbjct: 681 FACHICDKKFSRSDNLSQHIKTHKK 705

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 337 DIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           D  F CHLC K+FKR   LKRH+ S HS  R FSC  C  K  R DNL QH+K
Sbjct: 532 DKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 331 QSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           +S  + D  F CHLCEK F R   L +H+ +H K  + S 
Sbjct: 555 RSVHSTDRPFSCHLCEKKFSRSDNLSQHIKTHKKSGSTST 594

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F CH+C KSFKR   LKRH+ S HS +R F+C  C  K  R DNL QH+K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSK 364
           F CH+C+K F R   L +H+ +H K
Sbjct: 676 FACHICDKKFSRSDNLSQHIKTHKK 700

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F CH+C KSFKR   LKRH+ S HS +R F+C  C  K  R DNL QH+K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSK 364
           F CH+C+K F R   L +H+ +H K
Sbjct: 676 FACHICDKKFSRSDNLSQHIKTHKK 700

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F CH+C KSFKR   LKRH+ S HS +R F+C  C  K  R DNL QH+K
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSK 364
           F CH+CEK F R   L +H+ +H K
Sbjct: 675 FACHICEKKFSRSDNLSQHIKTHKK 699

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 330 PQSAINQDII-FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHL 387
           P +A ++D+  F+C  C K+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHL
Sbjct: 516 PMNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHL 575

Query: 388 K 388
           K
Sbjct: 576 K 576

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 556 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 336 QDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           +D  F+C  C K+FKR   LKRH+ S HS  R F+C  C  K  R DNL QHLK
Sbjct: 559 EDKPFKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLK 612

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C LCEK F R   L +HL +H K  +F
Sbjct: 592 FACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  CEK+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 602 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  CEK+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 633

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 613 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  CEK+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 620

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 600 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  CEK+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLK 639

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C+ CEK F R   L +HL +H K  +F
Sbjct: 619 FACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 337 DIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           D  F+C  CEK FKR   LKRH  S HS +R F C  C  K  R DNL QHLK
Sbjct: 310 DKQFKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLK 362

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C LCEK F R   L +HL +H K  +F
Sbjct: 342 FPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  CEK+F+R   LKRH  S HS +R F C  C  +  R DNL QHLK
Sbjct: 915 FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLK 964

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           FQC  C+K+F+R   LKRH+ S HS +R F C  C  K  R DNL QHLK
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H +  +F
Sbjct: 513 FPCMFCEKKFSRSDNLSQHLKTHKRHGDF 541

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 386 FKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           IF+C +CE+ FKR+  LKRH+ S H  +R +SC  CL    R DNL QH +
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKR 267

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 330 PQSAINQDII-FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHL 387
           P S  ++++  F+C  C K+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHL
Sbjct: 369 PMSGPDEEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 428

Query: 388 K 388
           K
Sbjct: 429 K 429

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 409 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  CEK+F+R   LKRH+ S HS +R F C  C  +  R DNL QHLK
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLK 515

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K F+R   LKRH+ S HSK+R F C  C  K  R DNL QHLK
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLK 486

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C+K+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLK 631

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 611 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS +R F C  C  K  R DNL QHLK
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 491

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  C+K F R   L +HL +H K  +F
Sbjct: 471 FHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
            F+C+ CEK+F+R   LKRH+ S HS +R F C  C  K  R DNL QHLK
Sbjct: 461 TFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLK 511

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C+ CEK F R   L +HL +H K  +F
Sbjct: 491 FPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           P S  +++  F+C  C K+F+R   LKRH+ S HS +R F+C  C  K  R DNL QHLK
Sbjct: 663 PGSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 722

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           F C  CEK F R   L +HL +H K  +F
Sbjct: 702 FACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS  R F C  C  K  R DNL QHLK
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C K+FKR   LKRH+ S HS++R + C  C  K  R DNL QHLK
Sbjct: 603 FHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 331 QSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           +S  +Q+  + C++C+K F R   L +HL +H +  +F
Sbjct: 623 RSVHSQERPYGCNICDKKFSRSDNLSQHLKTHKRHGDF 660

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS +R F C  C  K  R DNL QHLK
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 690

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS +R F C  C  K  R DNL QHLK
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS  R F C  C  K  R DNL QHLK
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K+F+R   LKRH+ S HS +R F C  C  K  R DNL QHLK
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLK 669

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 334 INQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           I  D  F+C+ CEK FKR   LKRH+ S HS +R + C  C     R DNL QHLK
Sbjct: 302 IYSDKPFKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNF 368
           + C  CEK+F R   L +HL +H +  +F
Sbjct: 337 YHCQFCEKNFSRSDNLSQHLKTHKRHGDF 365

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C + FKR+  LKRH+LS H  ++ F CP C     R DNL QH+K
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           P  A++    F C  CE+ FKR+  LKRH+ S H  ++ + C  C  K  R DNL QH+K
Sbjct: 450 PSPALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           P  A++    F C  CE+ FKR+  LKRH+ S H  ++ + C  C  K  R DNL QH+K
Sbjct: 504 PSPALDATKPFGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F C  C  K  R DNL QH+K
Sbjct: 340 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           +F C  C++ FKR+  LKRH+ S H  ++ FSC  C  K  R DNL QH+K
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHS 363
           F CH+CEK F R   L +H+ +HS
Sbjct: 332 FSCHICEKKFSRSDNLNQHIKTHS 355

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLK 388
           +QC LC K F R S L+ HLL+H+  R F CP   C      K N+++HLK
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ + C  C  K  R DNL QH+K
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F C  C  K  R DNL QH+K
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F C  C  K  R DNL QH+K
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 342 CHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           CHLC+K FKR   LKRH  + H + R F C  C  +  R DNL QH+++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRI 273

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +F C +C ++F R+  L RH  SH+K++ ++C  C  K  R+D LI+H +  H
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVH 167

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  CE+ FKR+  LKRH+ S H  ++ ++C  C     R DNL QH+K
Sbjct: 495 FACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ + C  C  K  R DNL QHLK
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ + C  C  K  R DNL QH+K
Sbjct: 264 FGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F+C  C  K  R DNL QH+K
Sbjct: 258 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHS 363
           F CH+C+K F R   L +H+ +HS
Sbjct: 287 FNCHICDKKFSRSDNLNQHIKTHS 310

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  CE+ FKR+  LKRH+ S H   + ++C  C  K  R DNL QH+K
Sbjct: 386 FGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           IF C  C + FKR+  LKRH  S H  ++ F C  C  K  R DNL QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHS 363
           F CH+C K F R   L +H+ +HS
Sbjct: 663 FDCHICNKKFSRSDNLAQHIKTHS 686

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           + C  CE+ FKR+  LKRH+ S H   + ++C  C  K  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +F C +C ++F R+  L RH  SH+K++ + C  C  +  R+D LI+H +  H
Sbjct: 124 LFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLH 176

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C+K+F R+  L RHL SH+ ++ F C  C     R+D LI+H
Sbjct: 49  FLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRH 95

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           +F C +C ++F R+  L RH  SH+K++ + C  C  K  R+D L++H
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +F C +C ++F R+  L RH  SH+K++ + C  C  K  R+D L++H +  H
Sbjct: 43  LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  CE+ FKR+  LKRH+ S H   + ++C  C     R DNL QH+K
Sbjct: 384 FGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C +C++ F     L RH  S HS ++ FSCP C  + KR+D+++QHL  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F+C  C     R DNL QH+K
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F+C  C     R DNL QH+K
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 339 IFQC---HLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
            F+C     C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 43  TFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 98

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 339 IFQC---HLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
            F+C     C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 40  TFKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F+C  C     R DNL QH+K
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +F C +C ++F R+  L RH  SH+ ++ + C  C  K  R+D L++H +  H
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           +F C +C ++F R+  L RH  SH+K++ + C  C  K  R+D L++H
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRH 132

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F+C  C     R DNL QH+K
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           +F C +C ++F R+  L RH  SH+K++ +SC  C     R+D L++H
Sbjct: 58  LFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRH 105

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 339 IFQC---HLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
            F+C     C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 40  TFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++ +SCP C  K KR+D+++QHL  K
Sbjct: 787 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 340 FQC---HLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F+C     C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +  H
Sbjct: 41  FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +F C  C+++F R+  L RH  SH+ ++ F C  C     R+D LI+H +  H
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C +C + F+R+  +KRH+ + H ++R ++C  C     R DNL QHL+
Sbjct: 413 FLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLR 462

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 20/29 (68%)

Query: 336 QDIIFQCHLCEKSFKRKSWLKRHLLSHSK 364
           Q+  + C++CEK+F R   L +HL +H++
Sbjct: 438 QERPYTCYVCEKTFSRSDNLNQHLRTHTR 466

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           +F C  C ++F R+  L RH  SH+K++ + C  C  +  R+D L++H
Sbjct: 29  LFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           +F C +C ++F R+  L RH  SH+K++ + C  C  +  R+D L++H
Sbjct: 58  LFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRH 105

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           I+ C+LC+K F R   LK HL +H+ +R FSC  C     R+ +  +H  L
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F C +C K+F R+   KRH   HS K+ + C           C  K  R D L +H K +
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++ +SCP C  K KR+D+++QHL  K
Sbjct: 755 VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHS 363
           F CH+C+K F R   L +H+ +HS
Sbjct: 427 FHCHICDKHFSRSDNLNQHIKTHS 450

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           FQC  C K F +   L+ H   H+ +R +SC  C  K  RK NL  H 
Sbjct: 536 FQCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHF 583

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C LC K F RK  L  H L+H K + + C
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVC 594

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C + F + + L+ H+ SH   + F C  C  +  +  NL  H +L
Sbjct: 509 ECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           C +C +  +R S LK H+L+H+ +R FSC  P C      + N+++H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHL 387
           P  A     + +CH+C K+F R S L  H L H+  + F C  P C  +   K NLI+H 
Sbjct: 101 PARAPPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHK 160

Query: 388 KL 389
           K+
Sbjct: 161 KI 162

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 858 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +F C +C ++F R   L RH   H+K++ + C  C  K+ R+D L++H+   H
Sbjct: 52  LFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMH 104

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++ +SCP C  + KR+D+++QHL  K
Sbjct: 759 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           ++ C LC+K F R   LK HL +H+ +R FSC  C     R+ +  +H  L
Sbjct: 412 VYACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL 462

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F C +C K+F R+   KRH   H+ ++ ++C           C  K  R D L +H K +
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTE 500

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           F+C +C K F R    +RH+ +H+ ++  SC  P C+ +  R D L +H++
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           QCH+C KS  R S L+ H+L H+  R F C    C  +   K N+ +H KL
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKL 542

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+CHLC KS+   S L+ H+ +H+ ++  SCP C  +     NL +H++
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKHIR 768

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 345 CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           C K F +K  L RHL  HSK + F C  C      +D L QHL++
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRV 713

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C  C K F  +  L +HL  HS +R F C  C   +    +L  H++
Sbjct: 692 FRCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIR 740

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           +F CH C ++F R+  L RH  SH+ ++ + C  C  +  R+D L++H
Sbjct: 48  LFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRH 95

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F C  C + F+R+  +KRH+ S H  ++ +SC  C     R DNL QH K
Sbjct: 171 FACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           ++C LC K F R    +RH+ +H+ ++  +C  P C+ +  R D L +HL++
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           QC LC K   R S L+ H+L H+  R FSC  P C      K N+ +HLKL
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH +SH+ ++ F C  C     RKD +++H
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F C +C ++F R+  LKRH  SH+ ++ + C  C     R+D LI+H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F C +C ++F R+  LKRH  SH+ ++ + C  C     R+D LI+H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           I+ C LC+K F R   LK HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 423 IYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLK 388
           F C++C K+F R+   KRH   H+ K+ + C           C  K  R D L +H K
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFK 509

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 336 QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQHLKL 389
           + I + C +C K FKR S L  H+  H+  + F+CP   C      K N+++H KL
Sbjct: 301 EKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339  IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
            I+ C  C++ F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 997  IYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 1049

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLKL 389
           C  C K F R S L+ H+L HS  + F C    C  K   K NLI+HLKL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 337 DIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           D  ++C  C K F +   LK H+  H+ ++ FSC  C  +  RK NL  HL
Sbjct: 413 DKPYKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQH 386
           F C  C K F RK  L  HL++H K R F C    C+    +  N+  H
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSH 492

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C++C K F + + L+ HL SH   + + C  C     +  NL  H++L
Sbjct: 389 ECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 339 IFQC---HLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           +FQC     C   F R+  L RH+  H+ ++ F C  CL    R DNL QH +  H
Sbjct: 14  LFQCTGYKECSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVH 69

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F C +C ++F R+  LKRH  SH+ ++ + C  C     R+D LI+H +  H
Sbjct: 110 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 161

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 717 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 331 QSAINQDIIFQ---CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           Q++ N+ +IF    C LC KSF R+S L+ HLL H+  + F C  C  +   K NL +H 
Sbjct: 159 QTSSNRGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHE 218

Query: 388 KL 389
           ++
Sbjct: 219 RI 220

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F CH+C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 340 FQCHL---CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F+C     CE SF R   L RH+  H+ ++ F C  CL    R DNL QH    H
Sbjct: 25  FKCTGYPGCEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVH 79

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 331 QSAINQDII-FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           Q  ++Q I  FQC +C + F RK+ L+RH+ SHS+ + F C  C      K  L +H
Sbjct: 71  QEVVHQGIKPFQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRH 127

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP 371
           ++D  F+C  C K    K  L+RH ++H+  R+F CP
Sbjct: 104 SEDKPFKCSYCGKGVTTKQQLRRHEITHT--RSFVCP 138

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C  C + F R+  LKRH  SH+++R F C  C     RKD +++H
Sbjct: 49  FLCPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRH 95

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           ++ C LC+K F R   LK HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 407 VYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F C +C K+F R+   KRH   H+ K+ ++C           C  K  R D L +H K +
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++  ++ C  C + F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 734 DKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 331 QSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLK 388
           +S    D  F C +C K F+R    KRH+ +H+ ++   C    C+ K  R D L +HLK
Sbjct: 4   ESVTEVDRPFICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLK 63

Query: 389 L 389
           +
Sbjct: 64  I 64

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 342 CHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           C  C +SF     L RH  + H  ++ FSCP C  + KR+D+++QHL  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F C +C ++F R+  LKRH  SH+ ++ + C  C     R+D LI+H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+CHLC+KSF   + LK H+ +H+ ++   C  C  +     NL +H+K
Sbjct: 668 FKCHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMK 716

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
            +C +C + F   S L +H+ +H  + NF CP C      +  +  H++ 
Sbjct: 696 LECKVCGRRFNESSNLSKHMKTH--EHNFKCPICSKGFNTQKRMETHMRF 743

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 342 CHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           C+ C +SF     L RH  + H  ++ FSCP C  + KR+D+++QHL  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C + F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 734 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F CH+C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 776 VYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           F+C +C K F R    +RH+ +H+ ++  +C  P C+ +  R D L +H++
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           FQC  C K F +   L+ H   H+ ++ +SC  C  +  RK NL  H+
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM 615

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C K F + + L+ H+ SH   + F C  C  +  +  NL  H +L
Sbjct: 541 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           FQC  C K F +   L+ H+  H+ +R + C  C  +  RK NL  H+
Sbjct: 519 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM 566

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C K F + + L+ H+ SH   + F C  C  +  +  NL  H++L
Sbjct: 492 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 540

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           ++C  C K F RK  L  H+L+H   + F C
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQC 577

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F C +C + F R+  LKRH  SH+ ++ F C  C     RKD +++HL+  H
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLH 78

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 345 CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C  +F R   L RH+  H+ ++ F C  CL +  R DNL QH +  H
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVH 73

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F CH+C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F CH+C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 340 FQCHL---CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F CH    C  +F R   L RH+  H+ ++ F C  C     R DNL QH +  H
Sbjct: 18  FTCHGYGDCHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVH 72

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           FQC  C K F +   L+ H+  H+ +R + C  C  +  RK NL  H+
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C K F + + L+ H+ SH   + F C  C  +  +  NL  H++L
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 536

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           ++C  C K F RK  L  H+L+H   + F C
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQC 573

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 333 AINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           A N +  F+C +C + F R    KRH+ +H+ ++   C  P C     R D L +HL+
Sbjct: 11  ADNDERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLR 68

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           + C  C++ F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C + F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 754 VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R   LKRH +SH+ ++ F C  C     RKD +++H
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 12/74 (16%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------C-CLSKH 377
           P++  N +  F CH C+  FK + +L RH+  H+ ++ F CP           C      
Sbjct: 112 PENKKNDEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGF 171

Query: 378 KRKDNLIQHLKLKH 391
            R+D    HLK +H
Sbjct: 172 SRRDTFKIHLKSRH 185

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C + F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 13/74 (17%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKH------------ 377
           P+ A N + +F CH C+  FK + +L RH+  H+ ++ + CP  + +             
Sbjct: 195 PEGA-NSEGLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGF 253

Query: 378 KRKDNLIQHLKLKH 391
            R+D    HL+ +H
Sbjct: 254 SRRDTYKTHLRTRH 267

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 331 QSAINQDI-IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           Q   +Q I  +QC  C + F +KS L+RHL SHS+ + FSC  C      +  L +H
Sbjct: 140 QQTAHQGIRAYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRH 196

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           I+ C LC+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDL 700

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F C +C K+F R+   KRH   H+ K+ + C           C  K  R D L +H K +
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           FQCHLC+K F   S LK H+ +H+ ++   C  C        NL +H+K
Sbjct: 766 FQCHLCDKRFTIASSLKIHIRTHTGEKPLKCKICGKAFNESSNLSKHIK 814

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 340 FQCHL--CEKSFKRKSWLKRHLLSHSKKRNFSCPCC 373
           +QCH   C K F ++  + RHL  HS  +   CP C
Sbjct: 708 YQCHWHGCSKKFTQRQKMVRHLKVHSGYKPCKCPVC 743

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           ++ C  C++ F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 764 VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C ++F R   L+RH  SH+ ++ + C  C     R+D L++H
Sbjct: 75  FVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRH 121

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+CHLC KSF   S LK H+ +H+ ++   C  C  +     NL +HLK
Sbjct: 763 FKCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKICGKRFNESSNLNKHLK 811

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 340 FQCHL--CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           + CH   C + F ++  + RHL  HS  + F C  CL     +D L QH++
Sbjct: 705 YHCHWKGCCRKFTQRQKMVRHLKVHSGYKPFKCQVCLKSFSSEDTLNQHMR 755

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
            QC +C K F   S L +HL +H KK  + C CC      ++    H
Sbjct: 791 LQCKICGKRFNESSNLNKHLKTHRKK--YKCSCCFRSFDTEEKFKAH 835

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLK 388
           F+C +C KSF  +  L +H+ +HS ++ F C  C        +L  H++
Sbjct: 735 FKCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHLCGKSFSVSSSLKIHIR 783

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C + F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           C  C + F R+  LKRH  +H+K++ F C  C     R+D +I+H
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRH 87

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C + F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 715 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 767

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 708 IYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 710 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 762

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C++ F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 709 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 761

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           I+ C  C + F     L RH  S HS ++  SCP C  + KR+D+++QHL  K
Sbjct: 849 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           N D  F+C +C + F R    KRH+ +H+ ++   C  P C     R D L +HL+
Sbjct: 9   NDDRPFRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLR 64

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQHLK 388
           QCH+C+K   R + LK HLL H+    F CP   C      K N+++HLK
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 337 DIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------CCLSKH-KRKDNLI 384
           D  F CH C+ SF+ + +L RH+  H+ ++ + CP           C  S    R+D   
Sbjct: 177 DGEFVCHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYK 236

Query: 385 QHLKLKH 391
            HLK++H
Sbjct: 237 THLKVRH 243

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 342 CHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           C  C++ F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 754 CQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           +QC+ C K F +   LK H   H+ ++ +SC  C  +  RK NL  H+
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHV 592

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 10/70 (14%)

Query: 330 PQSAINQDI----------IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKR 379
           PQ+ +N D+            QC  C + F + + L+ H+ SH   + + C  C  K  +
Sbjct: 497 PQTPVNNDLSPTRSRTKKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQ 556

Query: 380 KDNLIQHLKL 389
             NL  H +L
Sbjct: 557 GGNLKTHQRL 566

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C +C K F RK  L  H+L+H K + + C
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFC 603

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           F+C +C + F R     RH+++H+ ++   C  P C+ K  R D L +H K
Sbjct: 18  FKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAK 68

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 331 QSAINQDIIFQ---CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           Q++ N+ +IF    C LC KSF R+S L+ HLL H+  + F C  C  +   K NL +H 
Sbjct: 155 QTSSNRGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHE 214

Query: 388 KL 389
           ++
Sbjct: 215 RI 216

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           F C  C K F +   L+ H   H+ ++ +SC  C  K  RK NL  HL
Sbjct: 652 FACDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 699

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C +C+K F RK  L  HL++H K + F C
Sbjct: 680 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 710

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C + F + + L+ H+ SH   + F+C  C  +  +  NL  H +L
Sbjct: 625 ECPYCHRLFSQATHLEVHVRSHIGYKPFACDYCGKRFTQGGNLRTHERL 673

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           ++C +C + F R    KRHL +H+ ++   C  P C     R D L +HL+
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLR 70

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           I+ C LC K F R   LK HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 437 IYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNMCGKAFARQHDRKRHEDL 487

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLK 388
           F C++C K+F R+   KRH   HS K+ + C           C  K  R D L +H K
Sbjct: 466 FACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFK 523

>TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa]
           {ON} Anc_3.518 YGL209W
          Length = 339

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 334 INQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           I  D  F C +C + F R    KRH+ +H+ ++   C  P C+    R D L +HL+
Sbjct: 14  IKDDRPFICEICHRGFHRLEHKKRHIRTHTGEKPHKCVFPGCIKSFSRSDELKRHLR 70

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLKL 389
           I + C++C K FKR S L  H+  H+ ++ + CP   C      K N+++H KL
Sbjct: 268 IKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           FQC+ C K F +   L+ H   H+ ++ + C  C  +  RK NL  H KL H
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTH 678

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           ++C +C+K F RK  L  H L+H   + F C
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVC 686

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C + F + + L+ H+ SH   + F C  C  +  +  NL  H +L
Sbjct: 601 ECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQHLKL 389
           N++  F+C +C + F R    KRH+ +H+ ++   CP   C     R D L +H+K+
Sbjct: 11  NEERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           F C  C K F +   L+ H+  H+ ++ + C  C  K  RK NL  H KL H
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTH 601

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           FQC  C K F + + L+ H+ SH   + FSC  C  +  +  NL  H++L
Sbjct: 523 FQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL 572

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           C +C+++F+R     RHL +H+ ++  +C  P C  +  R D L +H ++
Sbjct: 31  CPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI 80

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 336 QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQHLKL 389
           Q + + C +C K FKR S L  H   H+  + +SCP   C      K N+++H KL
Sbjct: 272 QQMKYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKL 327

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           I+ C +CEK F R   L+ HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 419 IYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F C +C K+F R+   KRH   H+ K+ + C           C  K  R D L +H K +
Sbjct: 448 FVCTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFKTE 507

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------CCLSKH-KRKDNLIQHL 387
           F CH C+  F+ + +L RH+  H+ ++ F CP           C  S    R+D    HL
Sbjct: 61  FVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHL 120

Query: 388 KLKH 391
           K+KH
Sbjct: 121 KVKH 124

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHL 387
           P+SA       +C +C K+F R S L  H L H+  + ++C  P C  +   K NL++H 
Sbjct: 184 PRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243

Query: 388 KL 389
           K+
Sbjct: 244 KI 245

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH  SH+ ++ F C  C     R+D +++H
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRH 119

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +F C LC+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 391 MFACELCDKRFTRPYNLKSHLRTHTNERPFICSSCGKAFARQHDRKRHEDL 441

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 336 QDIIFQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           Q   + C  C+++F     L RH  S HS ++  SCP C  K KR+D+++QHL  K
Sbjct: 721 QGKTYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKK 776

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C ++F R+  LKRH  SH+ ++ F C  C     R+D +++H
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRH 98

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 331 QSAIN---QDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQ 385
           Q+ IN   +D  F C +C K FKR S L  H+  H+ ++ + CP   C      K N+++
Sbjct: 161 QAEINKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLR 220

Query: 386 HLKL 389
           H KL
Sbjct: 221 HYKL 224

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           F C  C K F +   L+ H   H+ ++ +SC  C  K  RK NL  HL
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C +C+K F RK  L  HL++H K + F C
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 679

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           ++ C +C+K F R   LK HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 396 LYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDL 446

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLK 388
           F C +C K+F R+   KRH   HS K+ ++C           C  K  R D L +H K
Sbjct: 425 FACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALGRHFK 482

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           F C  C K F +   L+ H   H+ ++ +SC  C  K  RK NL  HL
Sbjct: 622 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 669

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C +C+K F RK  L  HL++H K + F C
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 680

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           FQC  C K F +   L+ H+  H+ ++ + C  C  +  RK NL  H +L H
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH 581

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C K F + + L+ H+ SH   + F C  C  +  +  NL  H++L
Sbjct: 504 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 552

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRH 100

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 331 QSAINQDI-IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCC 373
           QS ++Q +  F+C  C KSF +KS L+RHL SHS  + F C  C
Sbjct: 70  QSTVHQGLRAFRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSYC 113

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP 371
           FQC  C K    +  LKRH ++H+K  +F CP
Sbjct: 108 FQCSYCGKGVTTRQQLKRHEVTHTK--SFVCP 137

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH  SH+ ++ F C  C     R+D +++H
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 121

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 332 SAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQHLKL 389
           SA ++ + + C +C K F+R S L+ H    S  R + CP   C      K N+++H KL
Sbjct: 231 SAFDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {ON}
           similar to Ashbya gossypii AEL278W
          Length = 431

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 331 QSAINQDII-FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           Q +++Q I  ++C  C+++F +KS L+RH  SHS K+ FSC  C      +  L +H
Sbjct: 71  QVSVHQGIKPYKCTECDRAFVKKSHLERHFFSHSDKKPFSCSKCGKGVTTRQQLARH 127

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           FQC  C K F +   L+ H+  H+ ++ + C  C  +  RK NL  H +L H
Sbjct: 514 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH 564

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C K F + + L+ H+ SH   + F C  C  +  +  NL  H++L
Sbjct: 487 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 535

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           I+ C +C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 498 IYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDL 548

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F C +C K+F R+   KRH   HS K+ + C           C  K  R D L +H K +
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           F CH C K F   S L+ H+ +H+ ++  SC  C  +     NL +H+K+
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKI 621

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRH 124

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           F C  C K F +   L+ H   H+ ++ +SC  C  K  RK NL  HL
Sbjct: 611 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 658

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C +C+K F RK  L  HL++H K + F C
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 669

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           QC  C K F R S L+ H L H+  R F C  P C      K N+++H +L
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------CCLSKH-KRKDNLIQHLKL 389
           CH C+ SF+  S+L RH+  H+ ++ F CP           C +S    RKD    HLK 
Sbjct: 15  CHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHLKC 74

Query: 390 KH 391
           +H
Sbjct: 75  RH 76

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           N +  F+C  C + F R    KRH+ +H+ ++   C  P C     R D L +HL+
Sbjct: 13  NDERPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLR 68

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 335 NQDIIFQC---HLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           NQ   F+C     C+ SF R   L RH+  H+ ++ F C  C     R DNL QH +  H
Sbjct: 15  NQPRSFKCTGYGSCDMSFTRAEHLARHIRKHTGEKPFQCEVCNRFFSRIDNLKQHRESVH 74

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           C +C +  +R S LK H+L+H+ +R F C  P C      + N+++H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 296

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 28/60 (46%), Gaps = 8/60 (13%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-------CCLSKH-KRKDNLIQHLKLKH 391
           FQC  C  SFK K +L RH+  H   ++F CP       C  S    RKD    HLK  H
Sbjct: 176 FQCAFCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHASGEFSRKDTYKTHLKSVH 235

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH  +H+ ++ F C  C     R+D +++H
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRH 78

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           FQC  C K F +   L+ H   H+ ++ ++C  C  +  RK NL  H
Sbjct: 437 FQCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAH 483

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           + C +C K F RK  L  H L+H K + + C
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYIC 495

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C + F + + L+ H+ SH   + F C  C  +  +  NL  H +L
Sbjct: 410 ECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRL 458

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  LKRH  SH+ ++ F C  C     R+D +++H
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRH 126

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C  C + F R+  LKRH  SH+ ++ F C  C     R+D +++H
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 117

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           C +C KS  R + L+ H+L H+  R F C  P C +    K N+ +H K
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLKL 389
           F+C LC++ F R    KRH+ +H+ ++ + C  P C     R D L +H K+
Sbjct: 17  FKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKI 68

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 337 DIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------C-CLSKHKRKDNLI 384
           D+ F CH C+  FK + +L RH+  H+ ++ + CP           C       R+D+  
Sbjct: 239 DMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYK 298

Query: 385 QHLKLKH 391
            HL+ +H
Sbjct: 299 THLRSRH 305

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 331 QSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLK 388
           +S + Q   + C +C K F     L RH   H+ ++N  CP   C  +  R DN +QH K
Sbjct: 192 RSPVEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYK 251

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           FQC  C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 452 FQCQYCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHV 499

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           ++C LC K F RK  L  H+++H K + F C
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFIC 510

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C + F + + L+ H+ SH   + F C  C  +  +  NL  H +L
Sbjct: 425 ECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRL 473

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHL 387
           P +++++     C +C KSF RK+ L+ H+L H+K + + CP   C      K NL +H 
Sbjct: 106 PANSVHKVSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHE 165

Query: 388 KL 389
           ++
Sbjct: 166 RI 167

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           + C  C + F R+  LKRH  SH+ ++ F C  C     R+D +++H +  H
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLH 156

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F C +C + F R+  L+RH  SH+ ++ F C  C     R+D +++H
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRH 129

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLK 388
           FQC  C  +F     L RH   H+ ++N+ CP   C  +  R DN IQH +
Sbjct: 212 FQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQHYR 262

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           +QC  C K F +   L+ H   H+ ++ + C  C  K  RK NL  HL
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           ++C LC+K F RK  L  HLL+H K + F C
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFIC 601

>ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} similar
           to uniprot|Q288C3 Torulaspora delbrueckii CRZ1
           Calcineurin-responsive zinc finger transcription factor
           and some similarites with YNL027W uniprot|P53968
           Saccharomyces cerevisiae YNL027W CRZ1 Transcription
           factor that activates transcription of genes involved in
           stress response nuclear localization is positively
           regulated by calcineurin-mediated dephosphorylation
          Length = 619

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           F C LC K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 508 FACELCGKRFTRPYNLKSHLRTHTNERPFECSICGKAFARQHDRKRHEDL 557

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP---------CCLSKHKRKDNLIQHLKLK 390
           F+C +C K+F R+   KRH   H+ K+ + C           C  K  R D L +H K +
Sbjct: 536 FECSICGKAFARQHDRKRHEDLHTGKKRYVCGGTLKNGSSWGCGKKFARSDALGRHFKTE 595

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQH 386
           F+C  C K F +   L+ H   H+ +R F C  C     R+ NL  H
Sbjct: 508 FECEFCGKRFTQAGNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +QC  C K F + + L  H+ +H   + F C  C  +  +  NL  H +L
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGKRFTQAGNLRTHRRL 529

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPC--CLSKHKRKDNLIQH 386
           F+C  C+K+F R+  L  H  +H   + + C    C  +  +  N+  H
Sbjct: 536 FKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 345 CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH 73

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           N++  F+C  C + F R    KRHL +H+ ++   C  P C     R D L +H++
Sbjct: 12  NENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMR 67

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHL 387
           FQC  C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 330 FQCQFCGKKFTQGGNLRTHQRLHTGEKPYQCESCGRRFSRKGNLAAHI 377

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC 370
           +QC  C + F RK  L  H+L+H   + F C
Sbjct: 358 YQCESCGRRFSRKGNLAAHILTHKNLKPFVC 388

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389
           +C  C + F + + L+ H+ SH   + F C  C  K  +  NL  H +L
Sbjct: 303 ECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQFCGKKFTQGGNLRTHQRL 351

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           + C  C K+F R     RH  SH+  + F+C  C     R+D L +H++  H
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVH 59

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 332 SAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           +A N +  F+C  C + F R    KRH+ +H+ ++   C  P C     R+D L +H++
Sbjct: 13  AADNDERPFRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIR 71

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 345 CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH 73

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C  C ++F R     RH  SH+  + + C  CL +  R+D L +H++  H
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVH 60

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 333 AINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP--CCLSKHKRKDNLIQHLK 388
           A N++  F+C LC + F R    KRH+ +H+ ++   C    C     R D L +HL+
Sbjct: 10  ADNEERPFKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLR 67

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 335 NQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------CCLSKH-KRKDN 382
           ++ + + CH C+  F+ + +L RH+  H+K++ + CP           C  S    R+D 
Sbjct: 200 SETLPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDT 259

Query: 383 LIQHLKLKH 391
              HLK +H
Sbjct: 260 YKTHLKSRH 268

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C  C K F R     RH  SH+  + FSC  C     R+D L +H++  H
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVH 59

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCP-----------C-CLSKHKRKDNLIQHL 387
           F CH C+  F+ + +L RH+  H+ ++ F CP           C       R+D    HL
Sbjct: 99  FVCHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHL 158

Query: 388 KLKH 391
           K++H
Sbjct: 159 KIRH 162

>CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly
           similar to uniprot|Q03833 Saccharomyces cerevisiae
           YDR096w GIS1 DNA damage-responsive repressor of PHR1
          Length = 625

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 340 FQCHLCEKSFKRKSWLKRHLLS-HSKKRNFSCPCCLSKHKRKDNLIQHLKLK 390
           F C +C+ +F     L RH  S HS ++ ++CP C    KRKD++ QHLK K
Sbjct: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 333 AINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           A N    F+C LC++ F R    KRH+ +H+ ++  +C  P C     R D L +H +
Sbjct: 10  ADNDQRPFRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSR 67

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 341 QCHLCEKSFKRKSWLKRHLLSHSKKRNFSC--PCCLSKHKRKDNLIQHLK 388
           QCH+C K   R S L+ H+L H+  + + C  P C      K N+I+H K
Sbjct: 286 QCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYK 335

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%)

Query: 345 CEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKH 391
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,707,119
Number of extensions: 779143
Number of successful extensions: 3544
Number of sequences better than 10.0: 593
Number of HSP's gapped: 3383
Number of HSP's successfully gapped: 791
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)