Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0I014602.530ON39336514080.0
NCAS0F009302.530ON4223587614e-97
Suva_8.582.530ON4523687611e-96
TPHA0G035002.530ON3923657472e-95
Skud_8.492.530ON4473697471e-94
NDAI0H014202.530ON4483637401e-93
YHR004C (NEM1)2.530ON4463667252e-91
TDEL0A030502.530ON3553357154e-91
SAKL0A09416g2.530ON3853457123e-90
CAGL0K02959g2.530ON4643577159e-90
KLTH0D06776g2.530ON4093567013e-88
KAFR0A018302.530ON4423557033e-88
Smik_8.532.530ON4463697026e-88
Kpol_348.82.530ON4223796936e-87
Kwal_26.80012.530ON4133556804e-85
ZYRO0B01958g2.530ON3363356474e-81
KNAG0C058502.530ON4433526442e-79
AGL070W2.530ON3433346311e-78
Ecym_72572.530ON3523346015e-74
KLLA0E18613g2.530ON3743525131e-60
YLR019W (PSR2)5.202ON3971722101e-17
TPHA0E030705.202ON4941722083e-17
Skud_12.875.202ON3921722064e-17
Smik_12.825.202ON3921722021e-16
Suva_10.995.202ON3851721993e-16
SAKL0G12870g5.202ON3991051994e-16
KLTH0B03388g5.202ON4091721977e-16
CAGL0D05610g5.202ON4471051961e-15
Kwal_33.151405.202ON4101631923e-15
CAGL0D03234g5.202ON4101721888e-15
Ecym_71045.202ON4921741881e-14
Kpol_478.165.202ON3501721861e-14
NDAI0I021705.202ON3911741852e-14
NDAI0D018605.202ON5141721862e-14
Kpol_2002.1005.202ON4771611853e-14
TPHA0N006705.202ON4521721843e-14
Smik_12.535.202ON4141831843e-14
KLLA0F15620g5.202ON4141051834e-14
Skud_12.575.202ON4151721835e-14
KAFR0J009905.202ON4831721827e-14
TDEL0E042705.202ON4531721818e-14
AAL158W5.202ON4781721828e-14
KNAG0M017405.202ON4811721819e-14
TBLA0H019905.202ON6881051811e-13
YLL010C (PSR1)5.202ON4271831782e-13
TBLA0C060905.202ON4841051782e-13
NCAS0D027405.202ON3981611772e-13
ZYRO0B10428g5.202ON4821051782e-13
SAKL0H10296g8.527ON4781021782e-13
NCAS0A068005.202ON4731051782e-13
YPL063W (TIM50)8.527ON4761021773e-13
Suva_10.655.202ON4151721754e-13
TDEL0B031908.527ON4771021755e-13
NCAS0C022108.527ON4911021721e-12
Kpol_457.58.527ON4891021721e-12
ZYRO0F09130g8.527ON4891021712e-12
Smik_16.1728.527ON4771021712e-12
Suva_16.2498.527ON4801021684e-12
NDAI0E029108.527ON4411021684e-12
Kwal_27.119908.527ON4741021684e-12
KLTH0E12254g8.527ON4761021675e-12
KLLA0E23101g8.527ON4801061651e-11
TBLA0A005408.527ON4851021631e-11
TPHA0I020008.527ON4781021622e-11
Ecym_11778.527ON4901021613e-11
CAGL0H05159g8.527ON4851021604e-11
Skud_16.2188.527ON4801021596e-11
ADR045W8.527ON4761011587e-11
KAFR0E010208.527ON4481021481e-09
KNAG0A020608.527ON4501021392e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0I01460
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   546   0.0  
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   297   4e-97
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   297   1e-96
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   292   2e-95
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   292   1e-94
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    289   1e-93
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   283   2e-91
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   280   4e-91
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   278   3e-90
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   280   9e-90
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   274   3e-88
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   275   3e-88
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   275   6e-88
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   271   6e-87
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   266   4e-85
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   253   4e-81
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   252   2e-79
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   247   1e-78
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   236   5e-74
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   202   1e-60
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    86   1e-17
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    85   3e-17
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    84   4e-17
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    82   1e-16
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    81   3e-16
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    81   4e-16
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    80   7e-16
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    80   1e-15
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    79   3e-15
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    77   8e-15
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    77   1e-14
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    76   1e-14
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     76   2e-14
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     76   2e-14
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    76   3e-14
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    75   3e-14
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    75   3e-14
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    75   4e-14
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    75   5e-14
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    75   7e-14
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    74   8e-14
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    75   8e-14
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    74   9e-14
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    74   1e-13
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    73   2e-13
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    73   2e-13
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    73   2e-13
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    73   2e-13
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    73   2e-13
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    73   2e-13
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    73   3e-13
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    72   4e-13
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    72   5e-13
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     71   1e-12
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    71   1e-12
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    70   2e-12
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    70   2e-12
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    69   4e-12
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    69   4e-12
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    69   4e-12
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    69   5e-12
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    68   1e-11
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    67   1e-11
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    67   2e-11
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    67   3e-11
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    66   4e-11
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    66   6e-11
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    65   7e-11
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    62   1e-09
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    58   2e-08

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/365 (76%), Positives = 281/365 (76%)

Query: 29  IQSKPSNTSXXXXXXXXXXXXXXYKLFAILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTP 88
           IQSKPSNTS              YKLFAILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTP
Sbjct: 29  IQSKPSNTSQQPPPQPQPQLPLLYKLFAILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTP 88

Query: 89  PLIDPKIASSSATDLDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLV 148
           PLIDPKIASSSATDLDDLNSNDEIILQTDSIKGSLLEKKN                  LV
Sbjct: 89  PLIDPKIASSSATDLDDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLV 148

Query: 149 IKQKKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXX 208
           IKQKKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETL     
Sbjct: 149 IKQKKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMS 208

Query: 209 XXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDL 268
                    NYHLIEVKF                    YYVYKRPYCDHFLNLVSDWYDL
Sbjct: 209 RNISSSTISNYHLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDL 268

Query: 269 IIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNE 328
           IIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNE
Sbjct: 269 IIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNE 328

Query: 329 LILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGER 388
           LILIDNSPISFAMNVDNAIQVQGWI                  RHTTDVRNILALKNGER
Sbjct: 329 LILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGER 388

Query: 389 AFHFA 393
           AFHFA
Sbjct: 389 AFHFA 393

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  297 bits (761), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 209/358 (58%), Gaps = 56/358 (15%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQ-------------HTNRKYKDTPPLIDPKIASSSATDL 103
           +++KPL+FLW+I TFPL L+E+               ++K  +  P   P++     T  
Sbjct: 96  LIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTE 155

Query: 104 DDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLT 163
           DDL   DEI LQ D+IKGSLL+  +                      ++   +K+V S++
Sbjct: 156 DDLAGGDEIYLQRDTIKGSLLKATSA---------------------KQLSSSKTVKSIS 194

Query: 164 SN--FIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHL 221
           SN     SK MG+FLFPKKLIP SI++TN+RKKL+LDLDETL                H+
Sbjct: 195 SNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHI 254

Query: 222 IEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADP 281
           +EVKF                    YYV+KRPYCD FL+ VS WYDLIIFTASMKEYADP
Sbjct: 255 VEVKFSVSGVSTL------------YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADP 302

Query: 282 VIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ--------STLNELILID 333
           VIDWLEDS    F +RLYR  CILRDG+GYIKDLSV++  +          +L E+I+ID
Sbjct: 303 VIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIID 362

Query: 334 NSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAFH 391
           NSPIS+AMNV+NAIQV+GWI                  R TTDVRN+LALKNGE+AF+
Sbjct: 363 NSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVLALKNGEKAFY 420

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  297 bits (761), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 215/368 (58%), Gaps = 52/368 (14%)

Query: 55  FAILIKPLIFLWYIFTFPLLLIEQ---HTNRKYKDTP-PLIDPKIASSSATDL------- 103
           + ++IKPL+ LW++FTFPL +IE+   HT++++K++     +P   SS + D        
Sbjct: 106 YYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAK 165

Query: 104 ------------DDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQ 151
                       DDLN++DEIILQ D++KGSLL+  +                  L    
Sbjct: 166 NRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASL---- 221

Query: 152 KKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXX 211
                 + +S  +   G+K MGRFLFPKKLIP SIL T K+KKL++DLDETL        
Sbjct: 222 ------TNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGT 275

Query: 212 XXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIF 271
                   HL+EVKF                    Y+++KRPYCD FL   S WYDLIIF
Sbjct: 276 THSNSSQGHLVEVKFGISGISTL------------YFIHKRPYCDLFLTKASKWYDLIIF 323

Query: 272 TASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ-------S 324
           TASMKEYADPVIDWLE SF  +F KR YR+ C+LRDG+GYIKDLS+L +  +       S
Sbjct: 324 TASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLS 383

Query: 325 TLNELILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALK 384
           +L+++I+IDNSP+S+AMNVDNAIQV+GWI                  R++TDVRNILALK
Sbjct: 384 SLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALK 443

Query: 385 NGERAFHF 392
           +GE+AF+ 
Sbjct: 444 HGEKAFNM 451

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  292 bits (747), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 172/365 (47%), Positives = 205/365 (56%), Gaps = 60/365 (16%)

Query: 60  KPLIFLWYIFTFPLLLIEQHT--NRKYKDTPPLIDPKIASSSATD--------------- 102
           KPL+F WY+ TFPL L EQ+   N + +D+        ASS A +               
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 103 ------LDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQN 156
                 L+D     E+ILQ D++KGSLL   N                           N
Sbjct: 111 QNLDSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGK--------------NN 156

Query: 157 KSVYSLTSNF-IGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXX 215
            +V S++S+   G+K MGRFLFPKKLIP SIL + ++KKL+LDLDETL            
Sbjct: 157 SAVKSMSSSVAFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSN 216

Query: 216 XXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASM 275
               HL+EVKF                    YYV+KRPYCD FL+ VS WYDLIIFTASM
Sbjct: 217 NAQAHLVEVKFQISGISTL------------YYVHKRPYCDLFLSNVSKWYDLIIFTASM 264

Query: 276 KEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDN----------QST 325
           KEYADPVIDWLE SF GNF KR YRNHCILRDG+GYIKDLS++N  N           S 
Sbjct: 265 KEYADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSI 324

Query: 326 LNELILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKN 385
           L+E+ILIDNSP+S+AMNVDNAIQV+GWI                  R+TTDVRNIL+LKN
Sbjct: 325 LHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKN 384

Query: 386 GERAF 390
           GERAF
Sbjct: 385 GERAF 389

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  292 bits (747), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 217/369 (58%), Gaps = 60/369 (16%)

Query: 55  FAILIKPLIFLWYIFTFPLLLIEQ---HTNRKYKDTPPLIDPKIASSSATDL-------- 103
           + ++IKPL+ LW++FTFPL +IE+   HT++++K+  P     ++S+S+ +         
Sbjct: 105 YYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKE--PGNSGNVSSTSSGNGNDSNEKAG 162

Query: 104 --------------DDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVI 149
                         DDLN++DEIILQ D++KGSLL+ ++                     
Sbjct: 163 SKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTN---- 218

Query: 150 KQKKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXX 209
                     +S T+   G+K MGRFLFPKKLIP SIL T K+KKL++DLDETL      
Sbjct: 219 ----------HSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASR 268

Query: 210 XXXXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLI 269
                     HL+EVKF                    Y+++KRPYCD FL  VS WYDLI
Sbjct: 269 STTHSNSSQGHLVEVKFGISGIPTL------------YFIHKRPYCDFFLTKVSRWYDLI 316

Query: 270 IFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ------ 323
           IFTASMKEYADPVIDWLE SF  NF KR YR+ C+LRDG+GYIKDLS++ +  +      
Sbjct: 317 IFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSS 376

Query: 324 -STLNELILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILA 382
            S+L+++I+IDNSP+S+AMNVDNAIQV+GWI                  R++TDVRNILA
Sbjct: 377 PSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILA 436

Query: 383 LKNGERAFH 391
           LK+GE+AF+
Sbjct: 437 LKHGEKAFN 445

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  289 bits (740), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 165/363 (45%), Positives = 210/363 (57%), Gaps = 61/363 (16%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKY------KDTPPLID--------------PKIA 96
           ++IKP++FLWYI TFPL LIE+ T  +       KD+ P  D               K+ 
Sbjct: 116 LIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPEEPSKLD 175

Query: 97  SSSATDLDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQN 156
           + +    DDL S D I LQ D++KGSLL+  +                    ++Q  + +
Sbjct: 176 AINELTEDDLVSGDGIYLQRDNVKGSLLKASS--------------------VRQPSL-S 214

Query: 157 KSVYSLTSN--FIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXX 214
           +S+ ++ SN     SK MG+FLFPKKLIP SI +T +RKKL+LDLDETL           
Sbjct: 215 RSMKTMVSNNTSFSSKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHT 274

Query: 215 XXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTAS 274
                H++EVKF                    YYV+KRPYCD FL+ V  WYDLIIFTAS
Sbjct: 275 NVSQGHIVEVKFSSSGVSML------------YYVHKRPYCDFFLSKVCKWYDLIIFTAS 322

Query: 275 MKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ------STLNE 328
           MKEYADPVIDWLE SF G F +R YR  CI RDG+GYIKDL+++  D+       STL+E
Sbjct: 323 MKEYADPVIDWLEASFQGTFTERYYRTDCIRRDGVGYIKDLTIIKDDSNVSVPQTSTLSE 382

Query: 329 LILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGER 388
           +I++DNSPIS+AMN DNAIQV+GWI                  R+TTDVR+ILALKNGER
Sbjct: 383 VIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGER 442

Query: 389 AFH 391
           AF+
Sbjct: 443 AFY 445

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  283 bits (725), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 161/366 (43%), Positives = 214/366 (58%), Gaps = 55/366 (15%)

Query: 55  FAILIKPLIFLWYIFTFPLLLIEQ---HTNRKYKDTP------PLIDPKIASSSATD--- 102
           + ++IKPL+ LW++FTFPL +IE+   HT+++ + +       P+    I  SS      
Sbjct: 105 YYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPK 164

Query: 103 -----------LDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQ 151
                       DDLN++DEIILQ D++KGSLL  ++                       
Sbjct: 165 NCNLNTIPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSY--------------S 210

Query: 152 KKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXX 211
           K   + S +S ++   G+K MGRFLFPKKLIP S+L T K+KKL++DLDETL        
Sbjct: 211 KSELSLSNHSSSNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRST 270

Query: 212 XXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIF 271
                   HL+EVKF                    Y+++KRPYCD FL  VS WYDLIIF
Sbjct: 271 THSNSSQGHLVEVKFGLSGIRTL------------YFIHKRPYCDLFLTKVSKWYDLIIF 318

Query: 272 TASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ------ST 325
           TASMKEYADPVIDWLE SF  +F KR YR+ C+LRDG+GYIKDLS++    +      S+
Sbjct: 319 TASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLSIVKDSEENGKGSSSS 378

Query: 326 LNELILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKN 385
           L+++I+IDNSP+S+AMNVDNAIQV+GWI                  R++TDVRNILALK+
Sbjct: 379 LDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKH 438

Query: 386 GERAFH 391
           GE+AF+
Sbjct: 439 GEKAFN 444

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  280 bits (715), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 152/335 (45%), Positives = 197/335 (58%), Gaps = 39/335 (11%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQH-TNRKYKDTPPLIDPKIASSSATDLDDLNSNDEIILQ 115
           ++IKP   +W+I + PLLLIE    +R  + +       + S S  + DDL   DEI LQ
Sbjct: 57  LIIKPTQLIWWIISLPLLLIEYGLKSRLQRKSTKRSTGTLQSISELEEDDLAGGDEIFLQ 116

Query: 116 TDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNFIGSKNMGRF 175
            D++KGSL   K                           +++S    ++  +G+K MGRF
Sbjct: 117 RDAVKGSLAPAKYR-------------------------RSRSGSRSSTVMLGTKRMGRF 151

Query: 176 LFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXX 235
           LFPKKLIP S+L   KRK+L++DLDETL                H++E++F         
Sbjct: 152 LFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTL- 210

Query: 236 XXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQ 295
                      YYV+KRP+CD FL+ VS WYDL++FTASM+EYADPVIDWLE SF+G F 
Sbjct: 211 -----------YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFS 259

Query: 296 KRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGWIXX 355
           KRLYRN+CILRDG+GYIKDLS++      TL E+IL+DNSPIS+AMNVDNAIQV+GWI  
Sbjct: 260 KRLYRNNCILRDGVGYIKDLSIV-CGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWISD 318

Query: 356 XXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
                           R+TTDVR+ILALKN E+AF
Sbjct: 319 PSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  278 bits (712), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 200/345 (57%), Gaps = 44/345 (12%)

Query: 58  LIKPLIFLWYIFTFPLLLIEQ-----HTNRKYKDTPPLID----PKIASSSATDLDDLNS 108
           +IKP++F WYI TFPL LIE         R  ++     D    P I      D +DL +
Sbjct: 73  IIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSINIIVEEDEEDL-A 131

Query: 109 NDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSV--YSLTSNF 166
            DEIILQTD++KGSL                         +K  K   +S      T   
Sbjct: 132 GDEIILQTDAVKGSL-----------------STISESQQVKTIKASTRSSIRSGSTGTA 174

Query: 167 IGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKF 226
           +GS+ MGRFLFPKKLIP S+L   K+K L+LDLDETL                H++EVKF
Sbjct: 175 LGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKF 234

Query: 227 XXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWL 286
                               Y+V+KRPYCD FL+ V+ WY L++FTASMKEYADPVIDWL
Sbjct: 235 ------------AVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWL 282

Query: 287 EDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNA 346
           E SF+G+F +RLYR  CILRDG+GYIKDLS++   ++ +LNE+I++DNSPIS+AMNVDNA
Sbjct: 283 ESSFSGSFSQRLYRQDCILRDGVGYIKDLSLI---SKKSLNEIIIVDNSPISYAMNVDNA 339

Query: 347 IQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAFH 391
           IQV+GWI                  R TTD+RN+L+LK+GE+AF+
Sbjct: 340 IQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLSLKSGEQAFN 384

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  280 bits (715), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 158/357 (44%), Positives = 204/357 (57%), Gaps = 48/357 (13%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATD-------------- 102
           ILIKP +F+W+I TFPL LIE    R+ K T    +  ++ S AT+              
Sbjct: 136 ILIKPTLFVWFILTFPLSLIEHSVRRRGKATE---NEHLSQSPATNKDNSPSKRLNVIEE 192

Query: 103 --LDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVY 160
              DDL S + + LQ D++KGSLL                         K +  +  S  
Sbjct: 193 AIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQ-------------KDRGKKTTSTP 239

Query: 161 SLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYH 220
           S TSN +G+K+MGRF FPKKLIP SIL + K+K L++DLDETL                H
Sbjct: 240 SHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAH 299

Query: 221 LIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYAD 280
           +IEV+F                    YYV+KRPYCD FL+ V  WY+LIIFTASMKEYAD
Sbjct: 300 IIEVRFAISGVSTL------------YYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYAD 347

Query: 281 PVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLN---TDNQS-TLNELILIDNSP 336
           PVIDWLE SF+G+F +R+YRNHCI RDG+GYIKDL  +    + N +  L ++++IDNSP
Sbjct: 348 PVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSP 407

Query: 337 ISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAFHFA 393
           +S+AM+VDNAIQV+GWI                  R+TTDVRN+LALKN E+AF  +
Sbjct: 408 VSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQLS 464

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  274 bits (701), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 201/356 (56%), Gaps = 36/356 (10%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHT--------------NRKYKDTPPLIDPKIAS--SSA 100
           I++KP++F+W++ TFPL LIE+ +              + K + +   I PK +S  S+ 
Sbjct: 65  IVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTI 124

Query: 101 TDLDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVY 160
           T+ +D  + +E+ILQ D++KGSL                          K  +   K+  
Sbjct: 125 TEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKTSS 184

Query: 161 SL------TSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXX 214
                       +GS+ MGRFLFPKKLIP S+L   KR+ L+LDLDETL           
Sbjct: 185 VRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSS 244

Query: 215 XXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTAS 274
                H++EVKF                    Y+V+KRPYCD FL  ++ WY+L++FTAS
Sbjct: 245 NSSQGHMVEVKFATSGISTL------------YHVHKRPYCDLFLTKIAKWYELVVFTAS 292

Query: 275 MKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDN 334
           MKEYADPVIDWLE SF G F +RLYR  CILRDG+GYIKDLSV+  +  ++L+++ +IDN
Sbjct: 293 MKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPN--ASLSDIFIIDN 350

Query: 335 SPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
           SP+S+AM+VDNAIQV+GWI                  R TTD+RN+LALK+GE AF
Sbjct: 351 SPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  275 bits (703), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 155/355 (43%), Positives = 204/355 (57%), Gaps = 47/355 (13%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQH---TNRKYK-------DTPPLIDPKIASSSATDLDDL 106
           + + PLI++W+I T PL L+E+     +RK K            + P + S S    +DL
Sbjct: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSP-LRSISEVGEEDL 171

Query: 107 NSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNF 166
           +++DE  LQ D+IKGSLL   +                  +  + K    +   ++ +N 
Sbjct: 172 STSDEFFLQRDTIKGSLLRASSDKPP--------------VFQRYKSTIKQDHEAMNTNI 217

Query: 167 IGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKF 226
            G+K MGRFLFPKKLIP SIL   ++K L++DLDETL                HL+EVKF
Sbjct: 218 FGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKF 277

Query: 227 XXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWL 286
                               YYV+KRP+CD FL+ VS WY+++IFTASMKEYADPVIDWL
Sbjct: 278 SINGISTL------------YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWL 325

Query: 287 EDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQST----------LNELILIDNSP 336
           E SF GNF KRLYR++C+LRDG+GYIKDLSVL   N +           L+E+I+IDNSP
Sbjct: 326 EGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSP 385

Query: 337 ISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAFH 391
           +S+A+NVDNAIQV+GWI                  R+TTDVRN+LALKNGE+ F 
Sbjct: 386 VSYALNVDNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMFE 440

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  275 bits (702), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 216/369 (58%), Gaps = 63/369 (17%)

Query: 55  FAILIKPLIFLWYIFTFPLLLIEQ---HTNRKYKDTPP-------------LIDPKIASS 98
           + ++IKPL+ LWY+FTFPL +IE+   HT+++ K++                   KI S 
Sbjct: 105 YYLVIKPLMSLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSK 164

Query: 99  -------SATDLDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQ 151
                  S T  DDLN++DEIILQ D++KGSLL  ++                  + ++ 
Sbjct: 165 NCNLNTISETVEDDLNASDEIILQRDNVKGSLLRAQS------------------VKLRS 206

Query: 152 KKIQNKSV----YSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXX 207
           +      V    +S T+   G+K MGRFLFPKKLIP S+L T K+KKL++DLDETL    
Sbjct: 207 RSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSA 266

Query: 208 XXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYD 267
                       HL+EVKF                    Y+++KRPYCD FL  VS WY+
Sbjct: 267 SRSTTHSNSSQGHLVEVKFGISGIRTL------------YFIHKRPYCDLFLTKVSKWYE 314

Query: 268 LIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQ---- 323
           LIIFTASMKEYADPVIDWLE SF  +F +R YR+ C+LRDG+GYIKDLS++    +    
Sbjct: 315 LIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYIKDLSIIKNSEENEKG 374

Query: 324 --STLNELILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNIL 381
             S+L+++I+IDNSP+S+AMNVDNAIQV+GWI                  R++TDVRNIL
Sbjct: 375 SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNIL 434

Query: 382 ALKNGERAF 390
           ALK+GE+AF
Sbjct: 435 ALKHGEKAF 443

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  271 bits (693), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 203/379 (53%), Gaps = 78/379 (20%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDL--DDLNSNDEIIL 114
           +L+KP+ FLW++ TFP+ L EQ  N+K   +   +D    S +   L  +DL+   EIIL
Sbjct: 75  LLVKPIFFLWFLITFPITLFEQK-NKKLPKSSANLDTMSKSKNLNILVEEDLSGGGEIIL 133

Query: 115 QTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNFIG--SKNM 172
           Q D++ GSLL+ +                       Q+          +S+ +G  SK +
Sbjct: 134 QRDTLNGSLLKSR---------------------ANQQHSHQSRHAKSSSSSVGLISKKI 172

Query: 173 GRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXX 232
           GRFLFPKKLIP SIL + ++KKL+LDLDETL                HL+EVKF      
Sbjct: 173 GRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGIS 232

Query: 233 XXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNG 292
                         YYV+KRPYCD FL+ V  WYDLIIFTASMKEYADPVIDWLE SF G
Sbjct: 233 TL------------YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRG 280

Query: 293 NFQKRLYRNHCILRDGIGYIKDLSVLNTDNQS---------------------------- 324
           +F KR YRN CILRDG+GYIKDLS++N    S                            
Sbjct: 281 SFSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNN 340

Query: 325 ------------TLNELILIDNSPISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXR 372
                        L+E+ILIDNSP+S+AMNVDNAIQVQGWI                  R
Sbjct: 341 DTNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLR 400

Query: 373 HTTDVRNILALKNGERAFH 391
           +TTDVRNIL+LKNGERAF+
Sbjct: 401 NTTDVRNILSLKNGERAFN 419

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  266 bits (680), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 148/355 (41%), Positives = 194/355 (54%), Gaps = 35/355 (9%)

Query: 57  ILIKPLIFLWYIFTFPLLLIE---------------QHTNRKYKD-----TPPLIDPKIA 96
           +++KP++F+W++ TFPL LIE               Q T   Y D     T   +  K  
Sbjct: 70  LVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPR 129

Query: 97  SSSATDLDDLNSNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQN 156
            ++  + DD    DEI LQ D++KGSL                            K    
Sbjct: 130 INTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSRQSPKAASV 189

Query: 157 KSVYSLTSN-FIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXX 215
           +S  S ++   +GS+ MGRFLFPKKLIP S+L   K + L+LDLDETL            
Sbjct: 190 RSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSMSRGTSSSN 249

Query: 216 XXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASM 275
               H++EVKF                    Y+V+KRPYCD FL  +++WY+L++FTASM
Sbjct: 250 SSQGHMVEVKFAISGISTL------------YHVHKRPYCDLFLTTIANWYELVVFTASM 297

Query: 276 KEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNS 335
           KEYADPVIDWLE SF G F +RLYR  CILRDG+GYIKDLS +  +  + L+++ +IDNS
Sbjct: 298 KEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN--TLLSDIFIIDNS 355

Query: 336 PISFAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
           P+S+AM+VDNAIQV+GWI                  R TTDVRNILALK+GE AF
Sbjct: 356 PVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAF 410

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  253 bits (647), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 181/335 (54%), Gaps = 57/335 (17%)

Query: 56  AILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDLDDLNSNDEIILQ 115
           +I +KP   +W++ T PL+LIE     K K        +I      D DDL + DE+ LQ
Sbjct: 58  SIFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEVD-DDL-AEDEMFLQ 115

Query: 116 TDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNFIGSKNMGRF 175
            D++KG L  K                                         G+K MGRF
Sbjct: 116 RDTVKGGLRGKA---------------------------------------FGTKKMGRF 136

Query: 176 LFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXX 235
           LFPKKL+P SIL   ++K+L++DLDETL                H++EV+F         
Sbjct: 137 LFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTL- 195

Query: 236 XXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQ 295
                      YYV+KRP+CD FL+ VS WYDLIIFTASMKEYADPVIDWLE SF G F 
Sbjct: 196 -----------YYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFC 244

Query: 296 KRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGWIXX 355
           KRLYR++C++R+G+GYIKDLSV+       L+E++LIDNSP S+A N DNAIQV+GWI  
Sbjct: 245 KRLYRHNCVVREGVGYIKDLSVVT----EVLDEVVLIDNSPTSYARNEDNAIQVEGWISD 300

Query: 356 XXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
                           R+ TDVR+IL LKNGE+A 
Sbjct: 301 PSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKAL 335

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  252 bits (644), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/352 (44%), Positives = 196/352 (55%), Gaps = 40/352 (11%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQH---TNRKYKDTPP-----LIDP-KIASSSATDLDDLN 107
           ++ KPL+ LW++ T PL L+E+     NR    T       L DP K+ S +    +DL 
Sbjct: 115 LIYKPLLLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSINEEVEEDLA 174

Query: 108 SNDEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSL--TSN 165
           + DE  LQ D +KGSLL+                     L  K+   QN+        S 
Sbjct: 175 AGDEFYLQRDIVKGSLLK------------ATTNKHHTPLKSKKNSAQNQHGNETHPNST 222

Query: 166 FIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVK 225
             G+K MGRFLFPKKLIP SIL   K+K L++DLDETL                H++EVK
Sbjct: 223 VFGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVK 282

Query: 226 FXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDW 285
           F                    YYV+KRPYCD FL  VS WYD++IFTASMKEYADPVIDW
Sbjct: 283 FSISGVSTL------------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDW 330

Query: 286 LEDSFNGNFQKRLYRNHCILRDGIGYIKDLS-VLNTDNQST----LNELILIDNSPISFA 340
           LE SF G F +RLYRN CILRDG+GYIKDL  V    N  T    L ++I++DNSP+S+A
Sbjct: 331 LESSFAGKFSRRLYRNDCILRDGVGYIKDLKMVTRGSNLGTSPDRLEDVIIVDNSPVSYA 390

Query: 341 MNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAFHF 392
           +NVDNAIQV+GWI                   +TTDVRNIL+LKNGE+AF+ 
Sbjct: 391 LNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNI 442

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  247 bits (631), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/334 (40%), Positives = 186/334 (55%), Gaps = 52/334 (15%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDLDDLNSNDEIILQT 116
           +++KP++ +W++ TFPL LIEQ ++++    P     +    +    DD  + + ++LQ 
Sbjct: 61  LVVKPVVLVWFVLTFPLSLIEQTSSKEADGAPGPEAAEEEQLAEAVEDDDLAGESMVLQE 120

Query: 117 DSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNFIGSKNMGRFL 176
           DS+K                                     S  S + +   S  +G+FL
Sbjct: 121 DSVK------------------------------------SSRPSTSRSSYTSTRLGKFL 144

Query: 177 FPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXX 236
           FPKKLIP SIL+T+++K L+LDLDETL                H++EV F          
Sbjct: 145 FPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVSTL-- 202

Query: 237 XXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQK 296
                     YYV+KRPYCD FL+ VS WYDL+IFTASMKEYADPVIDWLE   +  F +
Sbjct: 203 ----------YYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQ 252

Query: 297 RLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGWIXXX 356
           R YR+ C+LRDG+GY+KDLS+++ +    L ++I++DNSPIS+AMNVDNAIQV+GWI   
Sbjct: 253 RRYRSDCLLRDGVGYVKDLSIISKN----LQDIIIVDNSPISYAMNVDNAIQVEGWISDP 308

Query: 357 XXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
                          R TTD RNIL+LKNGERAF
Sbjct: 309 TDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  236 bits (601), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 135/334 (40%), Positives = 183/334 (54%), Gaps = 49/334 (14%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDLDDLNSNDEIILQT 116
           ++IKP+  +W++ TFPL LIE HT+ K        D  +        +   S    +++ 
Sbjct: 67  LIIKPIWLIWFVLTFPLNLIE-HTSSK--------DGSVEEEEVIPTNSQGSGGGEVIED 117

Query: 117 DSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNFIGSKNMGRFL 176
           D + G                         +V+ +  I++    +  S++  S  +G+FL
Sbjct: 118 DDLVGE-----------------------SMVLHEDSIKSSRPSTSRSSYT-STRLGKFL 153

Query: 177 FPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXX 236
           FPKKLIP SIL+T+++K L+LDLDETL                H++EV F          
Sbjct: 154 FPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSL-- 211

Query: 237 XXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQK 296
                     YYV+KRPYCD FL+ V  WYDL+IFTASM+EYADPVIDWLE   +  F K
Sbjct: 212 ----------YYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTK 261

Query: 297 RLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGWIXXX 356
           R YR+ CILRDGIGY+KDL++++ + Q T    I++DNSP+S+AMNVDNAIQV+GWI   
Sbjct: 262 RKYRSDCILRDGIGYVKDLTMISKNLQDT----IIVDNSPVSYAMNVDNAIQVEGWISDP 317

Query: 357 XXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
                          R TTD RNIL+LKNGE AF
Sbjct: 318 TDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  202 bits (513), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 170/352 (48%), Gaps = 78/352 (22%)

Query: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATD-------LDDLNSN 109
           +LIKP+I +WY+ TFPL L+E +T         LI     + S T+        +DL+  
Sbjct: 81  LLIKPIITIWYVITFPLNLMETNTQGNKG----LIQVGSETDSRTEKLSKYVVEEDLSPT 136

Query: 110 DEIILQTDSIKGSLLEKKNXXXXXXXXXXXXXXXXXXLVIKQKKIQNKSVYSLTSNFIGS 169
           DEII+  D +K   +                                            +
Sbjct: 137 DEIIINQDKMKPRPI--------------------------------------------T 152

Query: 170 KNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXN---------YH 220
           + +G+F FPKKL+P S+L +  RK L+LDLDETL              +          H
Sbjct: 153 EYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIH 212

Query: 221 LIEVKFXXXXXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYAD 280
           L+EV+F                    Y V KRPYCD FL   S WYD+ IFTASMKEYAD
Sbjct: 213 LVEVRFPQTNISTL------------YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYAD 260

Query: 281 PVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQST--LNELILIDNSPIS 338
           PVIDWL+ + +  F  R YR  C LR G+GY+KD+  + T  +++  L+++I+IDNSPIS
Sbjct: 261 PVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPIS 320

Query: 339 FAMNVDNAIQVQGWIXXXXXXXXXXXXXXXXXXRHTTDVRNILALKNGERAF 390
           +AM++DNAIQV GWI                  RH TD R ILALK+G  + 
Sbjct: 321 YAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRASI 372

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 83/172 (48%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P  + +  ++K LILDLDETL                  +   F              
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETL------------------VHSSFKYMHSADFVLPVEI 257

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FLN VS  Y++++FTAS+  YA+P++D L+   NG    RL+R
Sbjct: 258 DDQVHNVYVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFR 315

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E I++DNSP S+  +  +A+ +  W
Sbjct: 316 EACYNYEG-NYIKNLSQIG----RPLSETIILDNSPASYIFHPQHAVPISSW 362

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 81/172 (47%), Gaps = 24/172 (13%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L P  I +  ++K LILDLDETL                  +   F              
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETL------------------VHSSFKYVDSADFVIPVTI 353

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  VS+ Y++++FTAS+  Y DP+++ L D  N     RL+R
Sbjct: 354 DNQTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNIL-DPANTIIHHRLFR 412

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  Y+K+LS L       LNE+I++DNSP S+  +  +AI +  W
Sbjct: 413 ESCYTYEG-NYVKNLSQLG----RPLNEIIILDNSPASYIFHPQHAIPISSW 459

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 83/172 (48%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P  + +  ++K LILDLDETL                  +   F              
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETL------------------VHSSFKYMQTADFVLPVEI 252

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL+ VS  Y++++FTAS+  YA+P++D L+   NG    RL+R
Sbjct: 253 DDQVHNVYVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFR 310

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E I++DNSP S+  +  +A+ +  W
Sbjct: 311 EACYNYEG-NYIKNLSQIG----RPLSETIILDNSPASYIFHPQHAVPISSW 357

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 82/172 (47%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P  + K  ++K LILDLDETL                  +   F              
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETL------------------VHSSFKYMHTADFVLPVEI 252

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL+ V   Y++++FTAS+  YA+P++D L+   NG    RL+R
Sbjct: 253 DDQVHNVYVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFR 310

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E I++DNSP S+  +  +A+ +  W
Sbjct: 311 EACYNYEG-NYIKNLSQIG----RPLSETIILDNSPASYIFHPQHAVPISSW 357

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 82/172 (47%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P  +L   ++K LILDLDETL                  +   F              
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETL------------------VHSSFKYLHTADFVLPVEI 245

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL+ VS  Y++++FTAS+  YA+P++D L+   N     RL+R
Sbjct: 246 DDQVHNVYVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP--NRTIHHRLFR 303

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E I++DNSP S+  +  +A+ +  W
Sbjct: 304 EACYNYEG-NYIKNLSQIG----RPLSETIILDNSPASYIFHPQHAVPISSW 350

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 7/105 (6%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  D FL  V   Y++++FTAS+  Y DP++D L+    G    RL+R+ C   D
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDP--RGAVHHRLFRDSCYNYD 324

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           G  YIK+LS +       L++LI++DNSP S+ ++  +AI +  W
Sbjct: 325 G-NYIKNLSQIG----RPLSDLIILDNSPASYILHPQHAIPISSW 364

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 81/172 (47%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P    + + +K L+LDLDETL                  +   F              
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETL------------------VHSSFKFLRTADFVIPVEI 269

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL LV   Y++++FTAS+  Y DP++D L+   N     RL+R
Sbjct: 270 DNQVHNVYVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQ--NHCIHHRLFR 327

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           + C   DG  YIK+LS +       L++LI++DNSP S+  +  +AI +  W
Sbjct: 328 DSCYNYDG-NYIKNLSQIG----RPLSDLIILDNSPASYIFHPQHAIPISSW 374

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (60%), Gaps = 7/105 (6%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  D FL  V + Y++++FTAS+  Y DP++D L+ S   N   RL+R+ C   +
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYE 372

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           G  YIK+LS +       L+E+I++DNSP S+  +  +AI +  W
Sbjct: 373 G-NYIKNLSQIGR----PLSEIIILDNSPPSYIFHPQHAIPISSW 412

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 77/163 (47%), Gaps = 25/163 (15%)

Query: 190 NKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYV 249
           N +K L+LDLDETL                  +   F                     YV
Sbjct: 238 NGKKCLVLDLDETL------------------VHSSFKFLRTADFVIPVEIDNQIHNVYV 279

Query: 250 YKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGI 309
            KRP  D FL LV   Y++++FTAS+  Y DP++D L+ +       RL+R+ C   DG 
Sbjct: 280 IKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG- 336

Query: 310 GYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
            YIK+LS +       L++LI++DNSP S+  +  +AI +  W
Sbjct: 337 NYIKNLSQIG----RPLSDLIILDNSPASYIFHPQHAIPISSW 375

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 80/172 (46%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P    +   +K L+LDLDETL                  +   F              
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETL------------------VHSSFKYLRTADFVLPVNI 270

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  V + Y++++FTAS+  Y DP++D L+   + +   RL+R
Sbjct: 271 DDQVHNVYVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQ--HKSIHHRLFR 328

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E+I++DNSP S+  +  +AI V  W
Sbjct: 329 EACYNYEG-NYIKNLSQIG----RPLSEIIILDNSPASYIFHPQHAIPVSSW 375

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 82/174 (47%), Gaps = 25/174 (14%)

Query: 179 KKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXX 238
           + L+P    +  +RK L+LDLDETL                  +   F            
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETL------------------VHSSFKYLHTADFVIPV 350

Query: 239 XXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRL 298
                    YV KRP  D FL  V + Y++++FTAS+  Y DP++D L D  N     RL
Sbjct: 351 EIDNQVHNVYVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDIL-DKHN-VVHHRL 408

Query: 299 YRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +R+ C   +G  YIK+LS +       L++LI++DNSP S+  +  +AI +  W
Sbjct: 409 FRDSCYNYEG-NYIKNLSQIG----RPLSDLIILDNSPASYIFHPHHAIPISSW 457

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 82/172 (47%), Gaps = 24/172 (13%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P        RK L+LDLDETL                  +   F              
Sbjct: 168 LLPPIQQSLQNRKCLVLDLDETL------------------VHSSFKYVSTADFVLPVDI 209

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL   S  ++++IFTAS+++Y +P++D L DS N     RL+R
Sbjct: 210 DDQFQNVYVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDIL-DSTNDLVHHRLFR 268

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           + C   +G  YIK+L+ L       L+++I++DNSP S+  + ++AI +  W
Sbjct: 269 DACYNYNG-NYIKNLAQLG----RPLSDIIILDNSPTSYLFHPNHAIPISSW 315

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 81/174 (46%), Gaps = 25/174 (14%)

Query: 179 KKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXX 238
           + L+P    +   +K L+LDLDETL                  +   F            
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETL------------------VHSSFKYLHTADFVLPV 249

Query: 239 XXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRL 298
                    YV KRP  D FL  V+  Y++++FTAS+  Y DP++D L+ S   +   RL
Sbjct: 250 DIDDQIHNVYVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRL 307

Query: 299 YRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +R  C   +G  Y+K+L+ +       L+E++++DNSP S+  +  +AI +  W
Sbjct: 308 FREACYNYEG-NYVKNLAQIG----RPLSEIVILDNSPASYMFHPQHAIPISSW 356

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 78/172 (45%), Gaps = 24/172 (13%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L P   +K   +K L+LDLDETL                  +   F              
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETL------------------VHSSFKYLPNADFNLPVNI 373

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  V   ++++IFTAS+  Y DP++D L D    +   RL+R
Sbjct: 374 DDQIHNVYVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRL-DPKGKSIHHRLFR 432

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E+I++DNSP S+  +  +AI +  W
Sbjct: 433 EACYNYEG-NYIKNLSQMG----RPLSEIIILDNSPASYIFHPQHAIPISSW 479

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 76/161 (47%), Gaps = 25/161 (15%)

Query: 192 RKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYK 251
           +K L+LDLDETL                  +   F                     YV K
Sbjct: 307 KKCLVLDLDETL------------------VHSSFKYIDTADFVLPVTIDDQTHQVYVIK 348

Query: 252 RPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGY 311
           RP  D FL  V   +++++FTAS+  Y DP++D L+ S   +   RL+R  C + DG  Y
Sbjct: 349 RPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NY 405

Query: 312 IKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +K+LS +       L+++I++DNSP S+  +  +AI +  W
Sbjct: 406 VKNLSQIGR----PLSDIIILDNSPASYIFHPQHAIPISSW 442

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 81/172 (47%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P    K   RK L+LDLDETL                  +   F              
Sbjct: 271 LLPPIEKKFADRKCLVLDLDETL------------------VHSSFKYLNIADFVLPVDI 312

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL +V D Y++I+FTAS+  Y +P++D L+   +     RL+R
Sbjct: 313 DNQVQNVYVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP--HKYIHHRLFR 370

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           + C + +G  Y+K+LS +       L ++I++DNSP S+  +  +AI +  W
Sbjct: 371 DSCYVYEG-NYVKNLSQIG----RPLGDIIILDNSPASYIFHPQHAIPISSW 417

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 83/183 (45%), Gaps = 27/183 (14%)

Query: 172 MGRFLFP--KKLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXX 229
            G++  P  K L+P     T  +K LILDLDETL                  +   F   
Sbjct: 222 QGQYHAPGYKTLLPPQDENTKGKKCLILDLDETL------------------VHSSFKYL 263

Query: 230 XXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDS 289
                             YV KRP  + FL  V   +++++FTAS+  Y DP++D L+  
Sbjct: 264 RSADFVLPVEIDDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-- 321

Query: 290 FNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQV 349
            +     RL+R  C   +G  YIK+LS +       L+++I++DNSP S+  +  +AI +
Sbjct: 322 ADKVIHHRLFREACYNYEG-NYIKNLSQIGR----PLSDIIILDNSPASYIFHPQHAIPI 376

Query: 350 QGW 352
             W
Sbjct: 377 SSW 379

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 7/105 (6%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  D FL  +++ Y++++FTAS+  Y DP++D L+   +     RL+R+ C   +
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDK--DKTIHHRLFRDSCYNYE 339

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           G  YIK+LS +       L+++I++DNSP S+  +  +AI +  W
Sbjct: 340 G-NYIKNLSQIG----RPLSDMIILDNSPASYIFHPQHAIPISSW 379

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P     T  +K LILDLDETL                  +   F              
Sbjct: 234 LLPPQGESTKGKKCLILDLDETL------------------VHSSFKYLRSADFVLPVEI 275

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  + FL  V   +++++FTAS+  Y DP++D L+   N     RL+R
Sbjct: 276 DDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD--TNKVIHHRLFR 333

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+++I++DNSP S+  +  +AI +  W
Sbjct: 334 EACYNYEG-NYIKNLSQIG----RPLSDIIILDNSPASYIFHPQHAIPISSW 380

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 80/172 (46%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P      +++K L+LDLDETL                  +   F              
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETL------------------VHSSFKYLKSADFVLPVDI 343

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  V + +++++FTAS+  Y DP++D L+     +   RL+R
Sbjct: 344 DDQIHNVYVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFR 401

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS L       L+++I++DNSP S+  +  +AI +  W
Sbjct: 402 EACYNYEG-NYIKNLSQLG----RPLSDIIILDNSPASYIFHPQHAIPISSW 448

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P      N +K L+LDLDETL                  +   F              
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETL------------------VHSSFKYLRTADFVLPVDI 313

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  V   Y++++FTAS+  Y DP++D L+   +     RL+R
Sbjct: 314 DDQIHNVYVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDK--HKTIHHRLFR 371

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+++I++DNSP S+  +  +AI +  W
Sbjct: 372 ESCYNYEG-NYIKNLSQIG----RPLSDIIILDNSPASYIFHPQHAIPISSW 418

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 80/172 (46%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P    +   RK L+LDLDETL                  +   F              
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETL------------------VHSSFKYLHTADFVIPVEI 338

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  V + +++++FTAS+  Y DP++D L D +      RL+R
Sbjct: 339 DNQVHNVYVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDIL-DQYKA-VHHRLFR 396

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           + C   +G  YIK+LS +       L++LI++DNSP S+  +  +A+ +  W
Sbjct: 397 DSCYNYEG-NYIKNLSQIGR----PLSDLIILDNSPASYIFHPQHAVPISSW 443

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P      + RK L+LDLDETL                  +   F              
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETL------------------VHSSFKYLKSADFVLPVDI 341

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  D FL  V   Y++++FTAS+  Y DP++D L+   + +   RL+R
Sbjct: 342 DDQIHNVYVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDK--DKSIHHRLFR 399

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+ +I++DNSP S+  +  +AI +  W
Sbjct: 400 EACYNYEG-NYIKNLSQIG----RPLSNIIILDNSPASYIFHPQHAIPISSW 446

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 62/105 (59%), Gaps = 7/105 (6%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  D FL  VS  +++++FTAS+  Y DP++D L+   +     RL+R  C   +
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDK--HRCIHHRLFREACYDYE 613

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           G  YIK+LS +       L+ELI++DNSP S+  +  +AI +  W
Sbjct: 614 G-NYIKNLSQIG----RPLSELIILDNSPASYIFHPQHAIPISSW 653

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 82/183 (44%), Gaps = 27/183 (14%)

Query: 172 MGRFLFPK--KLIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXX 229
            G++  P    L+P     T  +K LILDLDETL                  +   F   
Sbjct: 235 QGQYHAPGYNTLLPPQDESTKGKKCLILDLDETL------------------VHSSFKYL 276

Query: 230 XXXXXXXXXXXXXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDS 289
                             YV KRP  + FL  V   +++++FTAS+  Y DP++D L+  
Sbjct: 277 RSADFVLSVEIDDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD-- 334

Query: 290 FNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQV 349
            +     RL+R  C   +G  YIK+LS +       L+++I++DNSP S+  +  +AI +
Sbjct: 335 TDKVIHHRLFREACYNYEG-NYIKNLSQIG----RPLSDIIILDNSPASYIFHPQHAIPI 389

Query: 350 QGW 352
             W
Sbjct: 390 SSW 392

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  D FL  V  WY+++IFTAS+  YA+P++D L+   N     RL+R+ C   +
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNL-INHRLFRDACYNYE 409

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
              +IK+LS +       L+++I++DNSP S+  +  +AI +  W
Sbjct: 410 N-NFIKNLSQIGR----PLHDIIILDNSPASYIFHPQHAIPISSW 449

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 76/161 (47%), Gaps = 25/161 (15%)

Query: 192 RKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXXXXXXXXYYVYK 251
           +K L+LDLDETL                  +   F                     YV K
Sbjct: 228 KKCLVLDLDETL------------------VHSSFKYVRTADFVLPVEIEDQIHNVYVIK 269

Query: 252 RPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGY 311
           RP  D FL  V + Y++++FTAS+  Y DP+++ L+ S   +   RL+R  C   +G  Y
Sbjct: 270 RPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-NY 326

Query: 312 IKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           IK+L+ +       L+++I++DNSP S+  +  +AI +  W
Sbjct: 327 IKNLAQIG----RPLSDIIILDNSPASYMFHPQHAIPISSW 363

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 62/105 (59%), Gaps = 7/105 (6%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  D FL  V   ++++IFTAS+  Y DP++D L+   + +   RL+R  C   +
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDK--HKSVHHRLFREACYNYE 407

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           G  YIK+LS +       L+E+I++DNSP S+  +  +AI +  W
Sbjct: 408 G-NYIKNLSQIGR----PLSEIIILDNSPASYIFHPQHAIPISSW 447

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 63/102 (61%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   YA+ V + + D  +      LY+ HC+ +DG+ 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKM-DPIHAFVTYNLYKEHCLYKDGV- 273

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L + ++ID  P S+ +  +NAI V+ W
Sbjct: 274 HIKDLSKLNRD----LGKTMIIDTDPNSYKLQPENAIPVKPW 311

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 6/105 (5%)

Query: 248 YVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRD 307
           YV KRP  + FL  V + +++++FTAS+  Y DP++D L D        RL+R  C   +
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDIL-DPGRQLIHHRLFREACYNYE 398

Query: 308 GIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           G  YIK+LS +       L+E+I++DNSP S+  +  +AI +  W
Sbjct: 399 G-NYIKNLSQMGR----PLSEIIILDNSPASYIFHPQHAIPISSW 438

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 65/102 (63%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y+D + + L D  +      L++ HC+ +DG+ 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 274

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L+++I+ID  P S+ +  +NAI ++ W
Sbjct: 275 HIKDLSKLNRD----LSKVIIIDTDPNSYKLQPENAIPMEPW 312

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 77/172 (44%), Gaps = 25/172 (14%)

Query: 181 LIPNSILKTNKRKKLILDLDETLXXXXXXXXXXXXXXNYHLIEVKFXXXXXXXXXXXXXX 240
           L+P        +K LILDLDETL                  +   F              
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETL------------------VHSSFKYLRSADFVLPVEI 275

Query: 241 XXXXXXYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYR 300
                  YV KRP  + FL  V   +++++FTAS+  Y DP++D L+   +     RL+R
Sbjct: 276 DDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD--TDKVIHHRLFR 333

Query: 301 NHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
             C   +G  YIK+LS +       L+E+I++DNSP S+  +  +AI +  W
Sbjct: 334 EACYNYEG-NYIKNLSQIGR----PLSEIIILDNSPASYIFHPQHAIPISSW 380

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 63/102 (61%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP CD+FL  +S +Y++++F+++   YA+ + + L D  +      L++ HC+ +DG+ 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 265

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKD+S LN D    L +++ ID  P ++ +  +NAI +  W
Sbjct: 266 HIKDISKLNRD----LGKVVTIDTDPNTYKLQPENAIPMDPW 303

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 64/102 (62%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y + + + L D  +      L++ HC+ +DG+ 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKL-DPLHAFISYNLFKEHCVYKDGV- 285

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    +N++++ID  P ++ +  +NAI V+ W
Sbjct: 286 HIKDLSKLNRD----VNKVLIIDTEPNNYKLQPENAIPVKPW 323

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 63/102 (61%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y++ + + L D  +      LY+ HC+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKL-DPIHAFISYNLYKEHCVYKEG-D 283

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L ++I++D  P S+ +  +NAI +Q W
Sbjct: 284 HIKDLSKLNRD----LGKVIIVDTDPASYKLQPENAIPMQPW 321

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP CD+FL  +S +Y++++F+++   Y+D + + L D  +      L++ HC+ +DGI 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKL-DPIHAFISYNLFKEHCVYKDGI- 278

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKD+S +N D    + ++++ID  P  +    +NAI  + W
Sbjct: 279 HIKDISKMNRD----VGKVVMIDTDPNCYKSQPENAIPAKPW 316

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 64/102 (62%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S ++++++F+++   Y+D + + L D  +      L++ HC+ +DG+ 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 274

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L+++I+ID  P S+ +  +NAI +  W
Sbjct: 275 HIKDLSKLNRD----LSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 65/102 (63%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S ++++++F+++   Y++ + + L D  +      L++ HC+ +DG+ 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKL-DPIHAFVSYNLFKEHCVYKDGV- 279

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L+++I+ID  P S+ +  +NAI ++ W
Sbjct: 280 HIKDLSKLNRD----LSKVIIIDTDPNSYKLQPENAIPMEPW 317

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 64/102 (62%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y + + + L D  +      L++ HC+ +DG+ 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKL-DPLHAFISYSLFKEHCVYKDGV- 293

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    +N++++ID  P ++ +  +NAI ++ W
Sbjct: 294 HIKDLSKLNRD----VNKVLIIDTDPNNYKLQPENAIPMEPW 331

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 63/102 (61%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y+D V + L D  +      L++ HC+ +DG+ 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKL-DPIHAFITYNLFKEHCLYKDGV- 269

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L + ++ID  P ++ +  +NAI ++ W
Sbjct: 270 HIKDLSKLNRD----LGKTVIIDCDPNAYKLQPENAIPMKPW 307

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 63/102 (61%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y+D V + L D  +      L++ HC+ +DG+ 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKL-DPIHAFITYNLFKEHCLYKDGV- 270

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L + I++D  P ++ +  +NAI ++ W
Sbjct: 271 HIKDLSKLNRD----LGKTIIVDCDPNAYKLQPENAIPMRPW 308

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 64/106 (60%), Gaps = 6/106 (5%)

Query: 247 YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILR 306
           +   KRP  D+FL  +S +Y++++F+++   YA+ + + L D  +      L++ HC+ +
Sbjct: 216 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKL-DPIHAFITYNLFKEHCLYK 274

Query: 307 DGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           DG+ +IKDLS LN D    L ++++ID    SF +  +NAI ++ W
Sbjct: 275 DGV-HIKDLSKLNRD----LGKVLIIDTDENSFKLQPENAIYLEPW 315

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y+D + + L D  +      L++ HC+ +DG+ 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKL-DPIHAFVSYNLFKEHCLYKDGV- 278

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D +  L    +ID  P S+ +  +NAI ++ W
Sbjct: 279 HIKDLSKLNRDEKKVL----IIDVDPNSYKLQPENAIPMKPW 316

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 63/102 (61%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y++ + + L D  +      LY+ HC+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKL-DPIHAFVSYNLYKEHCVYKEGT- 274

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L+++++ID  P ++    +NAI V+ W
Sbjct: 275 HIKDLSKLNRD----LDKVLIIDCDPNNYKFQPENAIPVKPW 312

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   +++ + + L D  +      L++ HC+ +DGI 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKL-DPIHAFITYNLFKEHCVYKDGI- 284

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L + I+ID    +F +  +NAI  + W
Sbjct: 285 HIKDLSHLNRD----LGKTIIIDTDANAFKLQPENAIHAEPW 322

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   YA+ + + + D  +      L++ HC+ +DG+ 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKM-DPIHAFISYNLFKEHCVYKDGV- 280

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    L ++++ID    S+ +  +NAI +  W
Sbjct: 281 HIKDLSKLNRD----LKKVMIIDTDENSYKLQPENAIPMDPW 318

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  ++FL  +S +Y++++F+++   Y++   + L D  +      L++ HC+ +DG+ 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKL-DPIHAFVSYNLFKEHCVYKDGV- 277

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS L  D    L+++I+ID  P S+ +  +NAI +  W
Sbjct: 278 HIKDLSKLKRD----LSKVIIIDTDPNSYKLQPENAIPMDPW 315

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query: 252 RPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGY 311
           RP  D+ L  +SD+Y+ ++F ++   Y+  V++ L D         L+++HC+ +DGI +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKL-DPIRAFITYNLFKDHCVYKDGI-H 274

Query: 312 IKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           IKDLS LN D    L + ++ID  P S  + ++NAI  + W
Sbjct: 275 IKDLSHLNRD----LGKTLIIDTDPNSVKLQMENAILAEPW 311

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y++ + + L D  +      L++ HC+ + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKL-DPIHAFISYNLFKEHCVYKKG-K 248

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    +N++I+ID    ++ +  +NAI ++ W
Sbjct: 249 HIKDLSKLNRD----VNKVIIIDTDKNNYKLQPENAIPMKPW 286

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 251 KRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIG 310
           KRP  D+FL  +S +Y++++F+++   Y++ + + L D  +      L++ HC+ +D + 
Sbjct: 211 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKL-DPLHAFISYNLFKEHCVYKDHV- 268

Query: 311 YIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGW 352
           +IKDLS LN D    + +++++D    S+ +  +NA+ +  W
Sbjct: 269 HIKDLSKLNRD----VRKVVIMDTDANSYKLQPENALPMAPW 306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,060,170
Number of extensions: 1245866
Number of successful extensions: 3995
Number of sequences better than 10.0: 72
Number of HSP's gapped: 3898
Number of HSP's successfully gapped: 77
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)