Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0H019805.349ON35935918370.0
Suva_2.4875.349ON3682155056e-60
TDEL0E027805.349ON3473654904e-58
Skud_4.5845.349ON3683764846e-57
YDR318W (MCM21)5.349ON3682484812e-56
Smik_4.5775.349ON3682484708e-55
SAKL0G08888g5.349ON3793874708e-55
ZYRO0D10120g5.349ON3293544582e-53
KNAG0C055205.349ON3853944579e-53
CAGL0H07139g5.349ON3583284471e-51
KAFR0C018705.349ON3413714224e-48
KLTH0H14806g5.349ON3462514224e-48
Kpol_1051.55.349ON3703744193e-47
TPHA0D020705.349ON3732693992e-44
Ecym_81845.349ON2482583675e-41
Kwal_34.159865.349ON2312443464e-38
AGR349W5.349ON2421913273e-35
NCAS0F028505.349ON2812912509e-24
NDAI0I015505.349ON2762782491e-23
KLLA0B10142g5.349ON2931762306e-21
ZYRO0D07788g5.51ON1030106830.11
Kwal_23.43435.51ON103138780.39
TBLA0B078705.51ON115551760.67
KLTH0B08756g5.51ON102338760.76
KNAG0K003705.51ON97972760.79
Ecym_51125.51ON98871741.2
ADR028W3.425ON832147722.1
NCAS0A095001.268ON103132722.4
NDAI0B008705.51ON102168712.6
CAGL0F08327g5.51ON99270712.8
KLLA0A09427g5.51ON101170703.4
Kwal_27.103648.822ON44396703.5
Kpol_298.25.51ON103720703.5
YER172C (BRR2)8.238ON216372703.7
Kwal_56.234948.238ON213051704.2
TDEL0G007505.51ON101220704.3
CAGL0L03586g1.268ON112331704.4
TPHA0C046602.331ON416106685.8
Smik_5.3448.238ON2161103686.3
Skud_5.3118.238ON215999679.2
KLTH0C10230g6.56ON78365679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0H01980
         (359 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   712   0.0  
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   199   6e-60
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   193   4e-58
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   191   6e-57
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   189   2e-56
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   185   8e-55
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   185   8e-55
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   181   2e-53
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   180   9e-53
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   176   1e-51
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   167   4e-48
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   167   4e-48
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   166   3e-47
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   158   2e-44
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   145   5e-41
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   137   4e-38
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   130   3e-35
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   100   9e-24
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   100   1e-23
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    93   6e-21
ZYRO0D07788g Chr4 (679071..682163) [3093 bp, 1030 aa] {ON} simil...    37   0.11 
Kwal_23.4343 s23 (675819..678914) [3096 bp, 1031 aa] {ON} YGR258...    35   0.39 
TBLA0B07870 Chr2 (1864978..1868445) [3468 bp, 1155 aa] {ON} Anc_...    34   0.67 
KLTH0B08756g Chr2 complement(708976..712047) [3072 bp, 1023 aa] ...    34   0.76 
KNAG0K00370 Chr11 (62596..65535) [2940 bp, 979 aa] {ON} Anc_5.51...    34   0.79 
Ecym_5112 Chr5 complement(243053..246019) [2967 bp, 988 aa] {ON}...    33   1.2  
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    32   2.1  
NCAS0A09500 Chr1 complement(1889764..1892859) [3096 bp, 1031 aa]...    32   2.4  
NDAI0B00870 Chr2 (201262..204327) [3066 bp, 1021 aa] {ON} Anc_5....    32   2.6  
CAGL0F08327g Chr6 complement(829426..832404) [2979 bp, 992 aa] {...    32   2.8  
KLLA0A09427g Chr1 complement(821244..824279) [3036 bp, 1011 aa] ...    32   3.4  
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    32   3.5  
Kpol_298.2 s298 complement(2201..5314) [3114 bp, 1037 aa] {ON} c...    32   3.5  
YER172C Chr5 complement(529530..536021) [6492 bp, 2163 aa] {ON} ...    32   3.7  
Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa] ...    32   4.2  
TDEL0G00750 Chr7 (155703..158741) [3039 bp, 1012 aa] {ON} Anc_5....    32   4.3  
CAGL0L03586g Chr12 complement(410092..413463) [3372 bp, 1123 aa]...    32   4.4  
TPHA0C04660 Chr3 (1007488..1008738) [1251 bp, 416 aa] {ON} Anc_2...    31   5.8  
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    31   6.3  
Skud_5.311 Chr5 complement(514651..521130) [6480 bp, 2159 aa] {O...    30   9.2  
KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} simila...    30   9.3  

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/359 (100%), Positives = 359/359 (100%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIPELQNVL 60
           MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIPELQNVL
Sbjct: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIPELQNVL 60

Query: 61  TSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISRLLSP 120
           TSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISRLLSP
Sbjct: 61  TSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISRLLSP 120

Query: 121 EVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKL 180
           EVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKL
Sbjct: 121 EVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKL 180

Query: 181 LSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKIN 240
           LSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKIN
Sbjct: 181 LSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKIN 240

Query: 241 NGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQISFLFKSIY 300
           NGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQISFLFKSIY
Sbjct: 241 NGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQISFLFKSIY 300

Query: 301 NIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPIKKLVSKLEQFRQSITEE 359
           NIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPIKKLVSKLEQFRQSITEE
Sbjct: 301 NIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPIKKLVSKLEQFRQSITEE 359

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  199 bits (505), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 148/215 (68%), Gaps = 1/215 (0%)

Query: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161
           Q  ++HK+FD +++ LL  E+++ PS+R++++ LE  N   + +L++ +ILE +YRM GI
Sbjct: 116 QPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGI 175

Query: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSI 221
           TFFP+VDP DL+  D+   + + REMLGIRLE++N+  S FEKPHYILLK+  KS  W +
Sbjct: 176 TFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFL 235

Query: 222 FKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFE 281
           FK+TIP+YID+ ++F   N G++ +  D +LFAK V+  L  I K+ Q FK LE  K+  
Sbjct: 236 FKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIH 295

Query: 282 NLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTI 316
           NL++DL    +SF  K +  + + LK+ +I++C+I
Sbjct: 296 NLDLDLQSSMVSFFVKDV-KVELFLKQNEIVSCSI 329

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  193 bits (490), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 126/365 (34%), Positives = 203/365 (55%), Gaps = 30/365 (8%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFP---NF----- 52
           MSE+ +L++ I  L  EI  L K+ + LK       E++ N   K  N P   NF     
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLK------DELRRNDADKLANHPVVKNFQSVFH 54

Query: 53  -IPELQNVLTSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFD 111
             P+L +VL+  +    +ES  +  S   +  ++ N  +  K      P     +H++FD
Sbjct: 55  QFPQLYDVLSEETTARHEESTQDPISLKRKRNTDVNSPKKDKSFRGDHPP--VFQHQMFD 112

Query: 112 DEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPTD 171
           + I++ +   +++ PS+ R+RMK  +   +  +  +N V+LE VYRM GIT+FPVVDPTD
Sbjct: 113 ESIAQFIDTNILTSPSKARRRMKDTK---YDEDAPRNQVLLENVYRMFGITYFPVVDPTD 169

Query: 172 LEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYID 231
           L+         I REM+GIRLE++N+ I+ FEKP+YILLK+  KS  W +FK+T+P +ID
Sbjct: 170 LKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKHTVPIFID 229

Query: 232 IHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQ 291
           +H+LF K N G I +  +I+LFAK VY  L  ++ ++Q  + L +  V +NL++DL    
Sbjct: 230 VHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDLEAAA 289

Query: 292 ISFLFKSIYNIRISLKEWDIITCTI--ESTESYINKETRTFYRKWEIQFQGPIKKLVSKL 349
           +SF  K+    R+ L +  I++C++  E+ +  +  +  T        F GP+ +L  KL
Sbjct: 290 VSF-SKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETI-------FLGPLHELEIKL 341

Query: 350 EQFRQ 354
           +   Q
Sbjct: 342 KHLDQ 346

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  191 bits (484), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 127/376 (33%), Positives = 206/376 (54%), Gaps = 44/376 (11%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIP------ 54
           MS++ +L++ I+ L  EIK L K             E+K N K K+ N  +  P      
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSR----------EELKLNIKNKRKNQDSTNPIIQEFE 50

Query: 55  ELQNVLTSNSNHNFDESKSNLNSDNNQLYSN-------------------DNEARIRKQK 95
           EL +     +N  FDE       D+    S                    DN+  + +Q+
Sbjct: 51  ELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQE 110

Query: 96  --LRSIPGQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILE 153
             LR+ P    ++H++FD  ++ LL  ++++ PS+R++++K+   +   R  L++ +I+E
Sbjct: 111 WVLRTQP---MVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIME 167

Query: 154 IVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQS 213
            VYRM GITFFP+VDP DL+  D    + + REMLGIRLE++++  S FEKPHYILLK+ 
Sbjct: 168 NVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKR 227

Query: 214 EKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKK 273
            KS  W +FK+TIP++ID+  +F + N G++ +  +++LFAK V+  L  I K+ Q FK 
Sbjct: 228 IKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKD 287

Query: 274 LENLKVFENLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRK 333
           LE  K+  +L++DL    +SF  K +  + + +K+ +I++C+I      I+  +R    K
Sbjct: 288 LEAKKIIHDLDLDLQSSMVSFFVKDV-KVELFVKQNEIVSCSILDE---IHDFSRKNKSK 343

Query: 334 WEIQFQGPIKKLVSKL 349
           WEI   G +  L  KL
Sbjct: 344 WEIVLLGSLDDLELKL 359

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  189 bits (481), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 159/248 (64%), Gaps = 4/248 (1%)

Query: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161
           Q  ++H++FD  ++ LL  ++++ PS+R++++K++  +   R  L+++++LE VYRM GI
Sbjct: 116 QPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGI 175

Query: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSI 221
           TFFP+VDP DL+  D    + + REMLGIRLE++++  S FEKPHY+LLK+  KS  W +
Sbjct: 176 TFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFL 235

Query: 222 FKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFE 281
           FK+TIP++ID+  +F   N G++ +  D +LFAK V+  L  + K+ Q FK LE  K+  
Sbjct: 236 FKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIH 295

Query: 282 NLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGP 341
           +L++DL    +SF  K I  + + +K+ +I++C+I      I+  ++    KWEI   G 
Sbjct: 296 DLDLDLESSMVSFFVKDI-KVELFVKQNEIVSCSILDD---IHDFSQNNKSKWEIALLGS 351

Query: 342 IKKLVSKL 349
           +  L  KL
Sbjct: 352 LDDLELKL 359

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  185 bits (470), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 157/248 (63%), Gaps = 4/248 (1%)

Query: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161
           Q  ++H++FD E++ LL  ++++ PS+R++++K+E  N   +  L++ +++E VYR+ GI
Sbjct: 116 QPMVQHQMFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGI 175

Query: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSI 221
           TFFP+VDP DL+  D    + + REMLGIRLE++++  S FEKPHYILLK+  KS  W +
Sbjct: 176 TFFPLVDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFL 235

Query: 222 FKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFE 281
           FK+T+P++ID+  +F   N G++ +  D +LFAK V+  L  I K+ Q FK LE  K+  
Sbjct: 236 FKHTVPSFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIH 295

Query: 282 NLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGP 341
           +LN+DL     SF  K +  + + +K+ +I++C+I      I+  +     KWEI   G 
Sbjct: 296 DLNLDLESSMASFFVKDV-KVELFVKQNEIVSCSILDD---IHDFSHNNKNKWEIALLGS 351

Query: 342 IKKLVSKL 349
           +  L  KL
Sbjct: 352 LDDLELKL 359

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  185 bits (470), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 135/387 (34%), Positives = 209/387 (54%), Gaps = 56/387 (14%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLK---KKFE-------YDSE----IKANSKYKK 46
           MS++ E ++ I  LN EI  LA+Q++ L    +K+E       ++SE    I+  +    
Sbjct: 1   MSKLQEHQQDIDALNREIASLAQQQDELHLHIQKYEDQLERLRHESEKVPVIELTTDEYG 60

Query: 47  PNFPNFIPELQNVLTSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKL-------RSI 99
           P F  F P L  +L+        + +SN   DN  L +      I  +K         S+
Sbjct: 61  PIFEAF-PHLHKLLSEK----LFQQESNRGHDNTALSTPKKSTTISPRKRVVNQVLPPSM 115

Query: 100 PG-------QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVIL 152
           P        Q  +EHK+FD +I+ L+  E+++ PS+R++++     N   ++ L ++V L
Sbjct: 116 PEHEWVLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLSKVHNN---KQNLIDYVRL 172

Query: 153 EIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQ 212
           E VYRM GIT FPVVDP+DL+     K   I REM+G+RLE++N+++S+FEKP+Y+LLK+
Sbjct: 173 ENVYRMTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKPYYVLLKK 232

Query: 213 SEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFK 272
           S K   W IFK+TIPNYIDI  LF K N GIIT  S  +LFAK VY  L   S K Q F+
Sbjct: 233 SSKRDSWDIFKHTIPNYIDIQLLFEKTNGGIITDYSGTYLFAKKVYQLLLQTSLKAQVFE 292

Query: 273 KL--ENLKVFE---NLNIDLIGIQISF---LFKSIYNIRISLKEWDIITCTIESTESYIN 324
            L  E+ ++ +   +L ++++  ++SF    FK++  +     +W+     +      +N
Sbjct: 293 VLAREDSRISQIESDLAVNVVSFKVSFKNLSFKTVLQM-----DWN----NVHGASIKLN 343

Query: 325 KETRTFYRKWEIQFQGPIKKLVSKLEQ 351
            E     R+WE    GP+ +   KL Q
Sbjct: 344 SE---HVRRWENYLLGPVDEFPRKLAQ 367

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  181 bits (458), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 206/354 (58%), Gaps = 36/354 (10%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLK-KKFEYDSEIKANSKYKK---PNFPNFIPEL 56
           M  V ELE+ I+ L  EI  L ++ + LK +KFE +    +N    K     F  F P+L
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKF-PKL 59

Query: 57  QNVLTSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISR 116
             VL +  N   D   SN N  +++  + D+ + ++++KL    G  ++++K+FD  I+ 
Sbjct: 60  YEVL-ARENQIVD---SNDNDTSDEPSTVDS-SFVKRRKLEFSDG--SVQNKMFDKSIAD 112

Query: 117 LLSPEVVSL-PSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPTDLEFL 175
           LL     S  P +RR +++  +        L++ V +E  YR+ GITFFP+VDP+D+ F 
Sbjct: 113 LLGDTSSSTSPGKRRSKLQNFKG-------LESQVSIENAYRLFGITFFPLVDPSDINFQ 165

Query: 176 DTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSL 235
                  I R+MLGIRLE++N+ +  FEKPHYILLKQ+ K   WS+FK+TIP +ID+ S+
Sbjct: 166 RN----DINRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWSLFKHTIPAFIDLESI 221

Query: 236 FLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQISFL 295
           F KI+NGIITT   ++LFAK VY  L  +S+++Q  ++L+++++  NL IDL    +SF 
Sbjct: 222 FQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEIDLQIAAVSFD 281

Query: 296 FKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPIKKLVSKL 349
            + +  +R+ L++  +I+C     +++ + E +           GP+K+L  KL
Sbjct: 282 IQGMKRVRLFLQDDQVISC-----DTFDDDELKML-------LLGPVKELKLKL 323

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  180 bits (457), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 126/394 (31%), Positives = 200/394 (50%), Gaps = 57/394 (14%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPN---------FPN 51
           M E+ +LE+ I  L +EI+ L K+   +K +   D  +  +      N         F  
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIR-DKRLGGSRTKDTTNVVIQEFESVFEK 59

Query: 52  FIPELQNVL-----------TSNSNHNFDESKSN-LNSDNNQLYS------NDNEARIRK 93
           F P+L ++L             N  ++ D + SN  N  NN+  S         + +  +
Sbjct: 60  F-PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQ 118

Query: 94  QKLRS----------IPGQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIR 143
           Q  RS          +  Q+ +EH++FD  +  LL  +++S PS+R++      P  H  
Sbjct: 119 QGNRSDEDLPEDEWVLKNQVPIEHQMFDQSVGDLLDTDILSSPSKRKRN-----PAQHGA 173

Query: 144 EI--LKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISS 201
           +   L   ++LE  YR+ GIT+FPVVDP DL+     + + I REMLG+R +++ND  S 
Sbjct: 174 DTSRLHEKILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDSK 233

Query: 202 FEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSAL 261
           FEKP Y+LLK++ K+K+W IFK+TIP  ID+HSLF  I  G+ T+++DI+LF+K+VY  L
Sbjct: 234 FEKPFYVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRL 293

Query: 262 SSISKKIQYFKKLENLKVFENLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTE- 320
              S ++++F  L+   + E+L  DL    +SF+    + I + L        TI++ E 
Sbjct: 294 VQSSLRLKHFNSLQERGLIEDLRGDLRSTNVSFMTGPRFMIDVKL--------TIQNNEV 345

Query: 321 --SYINKETRTFYRKWEIQFQGPIKKLVSKLEQF 352
              Y+ K       K  +   GPI  L  KL+Q 
Sbjct: 346 VSVYVKKGKEEVKSKLAMFLTGPIDDLEGKLKQL 379

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  176 bits (447), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/328 (32%), Positives = 191/328 (58%), Gaps = 19/328 (5%)

Query: 4   VSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSE-IKANSKYKKPNFPNFI---PELQNV 59
           V EL + ++ L  EI  L ++   L+++ ++  + IK +  +   +F +     P L+++
Sbjct: 6   VEELLQDVEALTSEINGLQEKSKKLREQLKHPEQFIKFDKAFG--DFNDIFEKNPGLRDL 63

Query: 60  LTSNSNHNFDESKSNLNSDNNQLYSNDNEAR--IRKQKLRSIP-------GQLTLEHKLF 110
           L     +  D+S ++++  N    +   ++R  +  +KL S+P        Q  +EH+LF
Sbjct: 64  LL---GYEIDKSATDVDDTNIIPVTPQKKSRSSVVNEKLHSLPEHEWVLKTQPLVEHRLF 120

Query: 111 DDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVDPT 170
           D+ +  ++  +++  PS+R+++++   PN    ++ K  +  E +YR+ GI++FP+VDP+
Sbjct: 121 DESVRDVIDTDILISPSKRKQKIQQLNPN-STGKVSKEPIQYENIYRLFGISYFPLVDPS 179

Query: 171 DLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYI 230
           DL F    + + + R+MLGIR +I+N+   SFEKPHYILLK+S KS  W +FKYT+PNYI
Sbjct: 180 DLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKSAKSDDWKLFKYTVPNYI 239

Query: 231 DIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGI 290
           D+  +F ++  G+I T  D++LFAK +Y  L  I  + + F +LE   + ++L++DL  +
Sbjct: 240 DVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFLQLEKDGIIDDLDMDLQSL 299

Query: 291 QISFLFKSIYNIRISLKEWDIITCTIES 318
            I    +    I   + ++ II CTI+S
Sbjct: 300 VIKCTLQGTTKIEFHIHQYSIIACTIKS 327

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  167 bits (422), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/371 (32%), Positives = 193/371 (52%), Gaps = 48/371 (12%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIPELQNVL 60
           MS + ELE+ I  L  E     +  N + ++FE   E+          F  F P+L+++L
Sbjct: 1   MSNIEELEQDIASLRRE----KQPANTVMREFE---EL----------FQQF-PQLRDLL 42

Query: 61  TSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRS---------IPGQLTLEHKLFD 111
                   DE+      D N +      +R R +   S         +  Q+ LEH LFD
Sbjct: 43  YKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFD 102

Query: 112 DEISRLLSPEVVSLPSQRRKRMK---------LERPNLHIREILKNFVILEIVYRMVGIT 162
             +  +L  E++S PS+RR+R+          L   NLH      + +++E ++R+ GIT
Sbjct: 103 KSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLH------DQIMVENIFRLFGIT 156

Query: 163 FFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIF 222
           FFPVVDP+DL+     + +   REMLGIRL+I+++L   ++KP YILLK+  KS  W IF
Sbjct: 157 FFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIF 216

Query: 223 KYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFEN 282
           K+TIP+YI +  +F +++ G+  +  DI+LF+K++Y  L   S +    KK E   +  N
Sbjct: 217 KHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISN 276

Query: 283 LNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPI 342
           L I L   ++SF   + + I + L++  II+C+    +   +   R+   KWE+ F GP+
Sbjct: 277 LRISLSSTKVSFSIGT-FEIELYLQDNIIISCSF--VKGIRDASVRS---KWEVLFNGPL 330

Query: 343 KKLVSKLEQFR 353
           + L  KL Q +
Sbjct: 331 EDLEYKLRQLK 341

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  167 bits (422), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 151/251 (60%), Gaps = 18/251 (7%)

Query: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161
           Q+ +EHK FD  ++ L+  ++++ PS +RKR    R +    E L   V +E +YRM+GI
Sbjct: 108 QVPVEHKFFDSAVADLIETDILTSPS-KRKRAAQSRAH----EELVQKVQIENIYRMLGI 162

Query: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSI 221
           + FPVVDP+DLE  +  ++ +I+R+MLG+RLE++N+L  SFE P+YIL KQ+ K+  W+I
Sbjct: 163 STFPVVDPSDLEGTEEDEI-NIKRKMLGLRLELFNELERSFEPPYYILFKQNPKNSYWNI 221

Query: 222 FKYTIPNYIDIHSLFLKI-NNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVF 280
           F++T+P+Y+ +  +F ++ +NG++   S+I+ FAK VY +L SIS K Q F++ E  +  
Sbjct: 222 FRHTVPSYVGVEQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEAI 281

Query: 281 ENLNIDLIGIQISFLFKSIYN-IRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQ 339
             L ID     +SF  + +   +++ L   D+I C+    E+            W  Q  
Sbjct: 282 SQLEIDPSCTSVSFHIEKLGCFVKLKLDATDVIACSCIPHENV----------SWNAQML 331

Query: 340 GPIKKLVSKLE 350
           GP+  L  ++E
Sbjct: 332 GPVVSLPDRIE 342

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  166 bits (419), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/374 (33%), Positives = 207/374 (55%), Gaps = 31/374 (8%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFI---PELQ 57
           MS++ ELE+ +  L  EI+ L K+ + +K K   +   +   K    +F +     P+L 
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 58  NVLTSNSNHNF----------DESKSNLNSD--NNQLYSNDNEARIRKQK--LRSIPGQL 103
           ++L+S+ + N           DE K ++ S+  N ++  N+ +  I + +  L+S P   
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDEGK-HMTSEISNKRVKPNEQDTDISEDEWILKSQP--- 116

Query: 104 TLEHKLFDDEISRLLSPEVVSLPSQRRKRMK-----LERPNLHIREILKNFVILEIVYRM 158
            ++HK+F+  IS +++ ++++ PS+R+ ++       E    + ++ L   + +E ++R+
Sbjct: 117 LVQHKMFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGNKQKNLNKKIRIENLFRL 176

Query: 159 VGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKI 218
            GITFFP+VDPTDL+     K + I+REMLGIRLEIYN+  S+FEKPHYILLK+  K   
Sbjct: 177 FGITFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDS 236

Query: 219 WSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLK 278
           W IFK+TIP+YIDI S +  INNG++ T  +I +FAK+VY  L   + + Q  +KL  L+
Sbjct: 237 WMIFKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQKIQKLTELE 296

Query: 279 VFENLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQF 338
              +   D+   ++       Y I + LK   I++C I +     ++       KW+I  
Sbjct: 297 YIRDCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPT-----DRMEPMLKNKWQIIL 351

Query: 339 QGPIKKLVSKLEQF 352
            G I +L +KL Q 
Sbjct: 352 LGTIDELPNKLSQL 365

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 154/269 (57%), Gaps = 26/269 (9%)

Query: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRK------------RMKLERPNLHIREILKNF 149
           Q  +EHK+F  E+S  ++ ++++ PS+R+K             M  + PNL+  E L+  
Sbjct: 114 QPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLN--EELERK 171

Query: 150 VILEIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYIL 209
           +I E  +R+ GI++FPVVDP DL    +   ++ +REM+GIRLE+++D +  FEKPHYIL
Sbjct: 172 IIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYIL 231

Query: 210 LKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQ 269
           LK+  KS  W +FKYTIPNYIDI+ +F +INNGI+ T  DI++FAK VY  L  I  + +
Sbjct: 232 LKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKK 291

Query: 270 YFKKLENLKVFE----NLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINK 325
              +L+   +      +LN+ LI + I     +   + + L++  + + +I S    I+ 
Sbjct: 292 NLMQLQEANIVSDILIDLNLKLIKMNI---INTTTKLTLYLEKDKVTSVSIYSETLDIHS 348

Query: 326 ETRTFYRKWEIQFQGPIKKLVSKLEQFRQ 354
           + R     W++   GP+  +  K+    Q
Sbjct: 349 QKR-----WKLTLLGPVSGISRKIRYLSQ 372

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  145 bits (367), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 140/258 (54%), Gaps = 14/258 (5%)

Query: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161
           Q  +EH++FD  I+     E+V  PS+R K MK    ++     L+ FV +E  YRM GI
Sbjct: 2   QHDVEHRMFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDNELEKFVEIENCYRMSGI 61

Query: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKS-KIWS 220
           TFFP+VDP  L         S+  E+LGIRLE++N+    +E P+YI+LK+  K+ +IW 
Sbjct: 62  TFFPLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWD 121

Query: 221 IFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVF 280
           ++K+TIP  IDI  ++    +GII+ D ++++FAK  Y  L +I  ++Q+   L+  ++F
Sbjct: 122 LYKHTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICNLDP-QLF 180

Query: 281 ENLNIDLIGIQISFLFKS--IYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQF 338
           EN+ +D   + +SF      I  +   L++  II C I+             + +W    
Sbjct: 181 ENIKVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCDIDIER----------HNEWSKII 230

Query: 339 QGPIKKLVSKLEQFRQSI 356
            GP+  L  K+   + S+
Sbjct: 231 LGPLVDLPDKILILQGSV 248

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  137 bits (346), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 138/244 (56%), Gaps = 18/244 (7%)

Query: 109 LFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVD 168
           +FD  ++ L + ++++ PS+R+K +   +   H +E++K   I E +YR +G++ FPVVD
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKVVNSRK---H-QELIKKLDI-ENLYRTIGLSTFPVVD 55

Query: 169 PTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPN 228
           P+D+E  D       RR M+G+RLEI+N+L  +FE PHY+L KQ+ K+  W+IF++TIP+
Sbjct: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114

Query: 229 YIDIHSLFLKINNGIITTD-SDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDL 287
           Y+ +  LF +        D   I+ F K VY++L SIS K Q FK L    +   L ID 
Sbjct: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174

Query: 288 IGIQISF-LFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEIQFQGPIKKLV 346
                SF + +   ++++ L E DI  C      S I + +    +KW     GP++ L 
Sbjct: 175 SCTSASFQMMQGSVSVKLKLSETDITAC------SSIPRSS----QKWTATILGPVQSLP 224

Query: 347 SKLE 350
            +L+
Sbjct: 225 RRLQ 228

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  130 bits (327), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 112/191 (58%), Gaps = 4/191 (2%)

Query: 109 LFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVD 168
           +FD  ++  L  E++  PS+R K +   RP    +  L+NF+ +E  YRM GITFFP+VD
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILS-TRPEQSKQRELRNFIEVENCYRMCGITFFPLVD 59

Query: 169 PTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEK-SKIWSIFKYTIP 227
           P  L   D K    I  EMLGIRLE++N+    F+ P+Y+LL++  K +  W +FK+T+P
Sbjct: 60  PGRLGGQD-KDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118

Query: 228 NYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDL 287
             +D   ++    NG I +DSD++LFAK  Y+ L  +  ++Q+  +L+   +FEN+  D 
Sbjct: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPY-LFENIRTDS 177

Query: 288 IGIQISFLFKS 298
               +SFL   
Sbjct: 178 YAAMLSFLISG 188

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  100 bits (250), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 86/291 (29%), Positives = 148/291 (50%), Gaps = 46/291 (15%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFI---PELQ 57
           M+E+ +LE+ I  L  E++ L K+ + LK K +      + S        + I   P+L 
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 58  NVL--------TSNSNHNFDES--KSNLNSDNNQLYSNDNEARIRKQKLRSIP------- 100
            +L        +S S  N +ES  K  L+++  Q + +  ++++  +    +P       
Sbjct: 61  EILLSKPSVTESSRSTSNEEESDKKRKLDNEKIQAFQDAKKSKLNNEN-DDLPEHEWVLK 119

Query: 101 GQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHI-REILKNFVILEIVYRMV 159
            Q  +EHK+FD  ++ +L+ E++S PS+RR  +K  +  +   + + K + +LE V+R+V
Sbjct: 120 NQRPVEHKMFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLENVFRIV 179

Query: 160 GITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKS--- 216
           GI+FF  VDP DLE            +M+GIRL+ +N       K +YI+LK+  K+   
Sbjct: 180 GISFFDAVDPNDLE-----------SDMIGIRLDPFN----QPSKVYYIILKKEAKNNRE 224

Query: 217 KIWSIFKYTIPNYIDIHSLFLKINNGI------ITTDSDIFLFAKDVYSAL 261
            +W+I K+TIP YI++ + F +           I    DI+L AK+VY  L
Sbjct: 225 GLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYVKL 275

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  100 bits (249), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 146/278 (52%), Gaps = 30/278 (10%)

Query: 1   MSEVSELEKSIQLLNEEIKLLAKQENVLK---KKFEYDSEI-KANSKYKKPNFPNFIPEL 56
           MS++++LE+ I  L  E++ L  + + LK   K  + D+ I + N+  +  +  +  P+L
Sbjct: 1   MSDITDLEQDIAALKVELEGLRAKRDALKDPGKDIQKDTSIAETNADRQLQSLLDQFPQL 60

Query: 57  QNVLTSNSN--------HNFDESKSNLNSDNNQLYSNDNEARIRKQKLRS--------IP 100
            ++L S++         HN  E  ++L S   +        + ++  L +        + 
Sbjct: 61  HDILLSDNAIDKSSPVLHNNGEDDTSLLSRKRKSEHGSPNTKHKRLSLSANLPEHEWVLK 120

Query: 101 GQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVG 160
            Q  +EHK+FD  ++ +L  +++S PS+R    K ER + +++  L   ++LE  Y+ +G
Sbjct: 121 MQPPIEHKMFDTSVADVLGTDILSSPSKRIIETK-ERQSDNLQRTL---ILLEDFYKKLG 176

Query: 161 ITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWS 220
           + F  + DP DLE  +  + L ++ +MLG+R E+ +   S   + +Y+LLK+   S  W 
Sbjct: 177 VNFLQLFDPNDLEMNEKMEALQMKGDMLGVRFELPS---SEGAQKYYLLLKKETASDYWI 233

Query: 221 IFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVY 258
            +K+++PN ID++  F+   N    +  DI+L AKD+Y
Sbjct: 234 PYKHSLPNIIDVNEYFV---NVAAESHEDIYLIAKDIY 268

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 99/176 (56%), Gaps = 20/176 (11%)

Query: 146 LKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKP 205
           + +FV  E   R++G++ FPV +  ++EF+             GIRLE++++L   ++ P
Sbjct: 107 ITDFVQWENSVRLIGVSLFPV-NYDNIEFM-------------GIRLELFDELSLKYDPP 152

Query: 206 HYILLKQSEKS-KIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSI 264
            Y++LK S K   IW +FK+ +P YI+IH  +  I     T+DS+I  FA   Y  L  +
Sbjct: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKV 212

Query: 265 SKKIQYFKKLE----NLKVFENLNIDLIGIQISF-LFKSIYNIRISLKEWDIITCT 315
             ++Q+F+KLE    N K +  L+ID +G+ +SF L   I  I++   + +II CT
Sbjct: 213 HSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRLGADIIKIKVDDGDDEIIDCT 268

>ZYRO0D07788g Chr4 (679071..682163) [3093 bp, 1030 aa] {ON} similar
           to uniprot|P07276 Saccharomyces cerevisiae YGR258C RAD2
           Single-stranded DNA endonuclease cleaves single-stranded
           DNA during nucleotide excision repair to excise damaged
           DNA subunit of Nucleotide Excision Repair Factor 3
           (NEF3) homolog of human XPG protein
          Length = 1030

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 19/106 (17%)

Query: 197 DLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKD 256
           DL+S F  P YI      +++  ++ +              ++ +G+IT DSD+FLF  +
Sbjct: 776 DLLSRFGVP-YITAPMEAEAQCATLMRD-------------RLVDGVITDDSDVFLFGGN 821

Query: 257 -VYSALSSISKKIQYFKKLENLKVFENLNIDLIG-IQISFLFKSIY 300
            VY  + S    ++Y+   +   +++NL +D  G I+++ L  S Y
Sbjct: 822 KVYKNMFSERNYVEYY---DAESIYKNLGLDRNGMIELAQLLGSDY 864

>Kwal_23.4343 s23 (675819..678914) [3096 bp, 1031 aa] {ON} YGR258C
           (RAD2) - homolog of xeroderma pigmentosum group G (XPG)
           protein, copufurifies with transcription factor, TFIIH,
           mRNA is cell cycle regulated and induced by DNA damage
           and by meiosis (different cis-sites utilized in damage
           and meiotic induction [contig 1] FULL
          Length = 1031

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 235 LFLKINNGIITTDSDIFLFAKD-VYSALSSISKKIQYF 271
           L LK+ +GIIT DSDIFLF  D VY  +      ++Y+
Sbjct: 798 LALKLVDGIITDDSDIFLFGGDKVYKNMFHEKNYVEYY 835

>TBLA0B07870 Chr2 (1864978..1868445) [3468 bp, 1155 aa] {ON}
           Anc_5.51 YGR258C
          Length = 1155

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 237 LKINNGIITTDSDIFLFAKD-VYSALSSISKKIQYFKKLENLKVFENLNID 286
           LK+ +GI+T DSD+FLF    VY  +      ++Y+   +N  +F NL +D
Sbjct: 926 LKLVDGIVTDDSDVFLFGGTKVYKNMFHEKHYVEYY---DNDVIFRNLGLD 973

>KLTH0B08756g Chr2 complement(708976..712047) [3072 bp, 1023 aa]
           {ON} similar to uniprot|P07276 Saccharomyces cerevisiae
           YGR258C RAD2 Single-stranded DNA endonuclease cleaves
           single-stranded DNA during nucleotide excision repair to
           excise damaged DNA subunit of Nucleotide Excision Repair
           Factor 3 (NEF3) homolog of human XPG protein
          Length = 1023

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 235 LFLKINNGIITTDSDIFLFAKD-VYSALSSISKKIQYF 271
           L L + +GIIT DSDIFLF  D VY  +      ++Y+
Sbjct: 790 LMLGLVDGIITDDSDIFLFGGDKVYKNMFQEKNYVEYY 827

>KNAG0K00370 Chr11 (62596..65535) [2940 bp, 979 aa] {ON} Anc_5.51
           YGR258C
          Length = 979

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 235 LFLKINNGIITTDSDIFLFAKD-VYSALSSISKKIQYFKKLENLKVFENLNIDLIG-IQI 292
           L L + +GIIT DSD+FLF    VY  L    K ++Y+   +   +  +L ID    I++
Sbjct: 747 LGLNLVDGIITDDSDVFLFGGTKVYKNLFQDRKYVEYY---DYETIVRSLGIDRAQMIEL 803

Query: 293 SFLFKSIYNIRI 304
           + L  S Y   I
Sbjct: 804 ALLLGSDYTPGI 815

>Ecym_5112 Chr5 complement(243053..246019) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AFR133C
          Length = 988

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 235 LFLKINNGIITTDSDIFLFAK-DVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQIS 293
           L LK+ +GIIT DSDIFLF   +VY  +      ++Y+   +++ +   LN D++ I ++
Sbjct: 757 LKLKLVDGIITDDSDIFLFGGSNVYKNMFYEKAFVEYYSS-DSISLNLGLNRDML-ISLA 814

Query: 294 FLFKSIYNIRI 304
            L  S Y   +
Sbjct: 815 ELLGSDYTTGV 825

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 69/147 (46%), Gaps = 37/147 (25%)

Query: 3   EVSELEKSIQLLNEE-----IKLLAKQENVLKKKFEYDSEIKANSKYKKPNFPNFIPELQ 57
           ++  LE S+  +++E      + L  +EN L+++ EYD E+ A  K             +
Sbjct: 684 QILALEASLAAIHDEQTALETEYLRSKENRLQRRSEYD-ELDATFK-------------R 729

Query: 58  NVLTSNSNHNFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISRL 117
           ++L+++      E  S L SD  QL++      +RK++L++  GQ T E   F ++  R 
Sbjct: 730 DILSAH------ERLSKLQSDLEQLHAKRERLLLRKERLQNDLGQYTQECDKFREQFLR- 782

Query: 118 LSPEVVSLPSQRRKRMKLERPNLHIRE 144
                      RR+R + ++   H++E
Sbjct: 783 -----------RRERARADKRQRHLQE 798

>NCAS0A09500 Chr1 complement(1889764..1892859) [3096 bp, 1031 aa]
           {ON} Anc_1.268
          Length = 1031

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 216 SKIWSIFKYTIPNYIDIHSLFLKINNGIITTD 247
           +K+WSI  + IP  I+  + F+KIN  ++ TD
Sbjct: 231 TKLWSILDHPIPLSIETSTYFMKINERLLDTD 262

>NDAI0B00870 Chr2 (201262..204327) [3066 bp, 1021 aa] {ON} Anc_5.51
           YGR258C
          Length = 1021

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 235 LFLKINNGIITTDSDIFLFAKD-VYSALSSISKKIQYFKKLENLKVFENLNIDLIG-IQI 292
           L L + +GI+T DSD+FLF    VY  +      ++++   ++  +  N+ +D I  I++
Sbjct: 790 LHLNLVDGIVTDDSDVFLFGGSKVYKNMFHEKNYVEFY---DSASILRNIGLDRINMIEM 846

Query: 293 SFLFKSIY 300
           + L  S Y
Sbjct: 847 AQLLGSDY 854

>CAGL0F08327g Chr6 complement(829426..832404) [2979 bp, 992 aa] {ON}
           similar to uniprot|P07276 Saccharomyces cerevisiae
           YGR258c RAD2 structure-specific nuclease of the
           nucleotide excision repairosome
          Length = 992

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 237 LKINNGIITTDSDIFLF-AKDVYSALSSISKKIQYFKKLENLKVFENLNIDL-IGIQISF 294
           LK+ +GIIT DSD+FLF  K VY  +      ++Y+   ++  +++ L +     I+++ 
Sbjct: 764 LKLVDGIITDDSDVFLFGGKKVYKNMFQEKNYVEYY---DSEDIYQGLGLTRETMIELAQ 820

Query: 295 LFKSIYNIRI 304
           L  S Y   I
Sbjct: 821 LLGSDYTTGI 830

>KLLA0A09427g Chr1 complement(821244..824279) [3036 bp, 1011 aa]
           {ON} similar to uniprot|P07276 Saccharomyces cerevisiae
           YGR258C RAD2 Single-stranded DNA endonuclease cleaves
           single-stranded DNA during nucleotide excision repair to
           excise damaged DNA subunit of Nucleotide Excision Repair
           Factor 3 (NEF3) homolog of human XPG protein
          Length = 1011

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 9/70 (12%)

Query: 235 LFLKINNGIITTDSDIFLFAK-DVYSALSSISKKIQYFKKLENLKVFE---NLNIDLIGI 290
           L LK+ +G+IT DSD+FLF    VY  +      ++Y+    +L +F+    L+ D + I
Sbjct: 780 LQLKLVDGVITDDSDVFLFGGTHVYKNMFQEKNYVEYY----SLDLFDQKLGLDRDKL-I 834

Query: 291 QISFLFKSIY 300
           Q++ L  S Y
Sbjct: 835 QLAQLLGSDY 844

>Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268C
           (PRP24) - U4/U6 snRNP protein [contig 36] FULL
          Length = 443

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 47/96 (48%), Gaps = 10/96 (10%)

Query: 160 GITFFPVV----DPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHY------IL 209
           G  FF V     D  +++ +D K++ +   ++  I  E +ND++S+  K H       I+
Sbjct: 51  GYNFFKVRKLFKDCGNIKHIDVKQVTNEDSKVARIEFEDFNDVLSALTKSHKRLGDQEII 110

Query: 210 LKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIIT 245
           ++QS+ S +W      +   +++  LF +    +++
Sbjct: 111 VEQSQNSTLWVTNYPPLFGELELQKLFSQFGGTVLS 146

>Kpol_298.2 s298 complement(2201..5314) [3114 bp, 1037 aa] {ON}
           complement(2201..5314) [3114 nt, 1038 aa]
          Length = 1037

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 235 LFLKINNGIITTDSDIFLFA 254
           L LK+ +GIIT DSD+FLF 
Sbjct: 806 LLLKLVDGIITDDSDVFLFG 825

>YER172C Chr5 complement(529530..536021) [6492 bp, 2163 aa] {ON}
           BRR2RNA-dependent ATPase RNA helicase (DEIH box);
           required for disruption of U4/U6 base-pairing in native
           snRNPs to activate the spliceosome for catalysis;
           homologous to human U5-200kD
          Length = 2163

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 71  SKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISRLLSPEVVSLPSQRR 130
           SK  L+S ++Q  S+  EA+  K    +IP  + LE   FD E S+L++   VSLP    
Sbjct: 397 SKRELDSGDDQPQSS--EAKRTKFSNPAIPPVIDLEKIKFD-ESSKLMTVTKVSLPEGSF 453

Query: 131 KRMKLERPNLHI 142
           KR+K +   +HI
Sbjct: 454 KRVKPQYDEIHI 465

>Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa]
           {ON} YER172C (BRR2) - putative ATP-dependent RNA
           helicase [contig 176] FULL
          Length = 2130

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 92  RKQKLRSIPGQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHI 142
           +K K+ SIP +L L++ +F D+ + L++   V+LP++  KR+K     +H+
Sbjct: 417 KKPKVSSIPQELDLKNLVF-DQGAELMTSARVTLPAESFKRVKQGYEEIHV 466

>TDEL0G00750 Chr7 (155703..158741) [3039 bp, 1012 aa] {ON} Anc_5.51
           YGR258C
          Length = 1012

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 235 LFLKINNGIITTDSDIFLFA 254
           L LK+ +GIIT DSD+FLF 
Sbjct: 782 LGLKLVDGIITDDSDVFLFG 801

>CAGL0L03586g Chr12 complement(410092..413463) [3372 bp, 1123 aa]
           {ON} similar to uniprot|P40856 Saccharomyces cerevisiae
           YJL098w SAP185 or uniprot|P36123 Saccharomyces
           cerevisiae YKR028w SAP190
          Length = 1123

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 217 KIWSIFKYTIPNYIDIHSLFLKINNGIITTD 247
           K+WSI +Y  P  I+I + F+KIN  ++  D
Sbjct: 277 KLWSIMQYPAPLPIEISTYFMKINERLLDMD 307

>TPHA0C04660 Chr3 (1007488..1008738) [1251 bp, 416 aa] {ON}
           Anc_2.331 YGL143C
          Length = 416

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 55/106 (51%), Gaps = 10/106 (9%)

Query: 189 GIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDS 248
           GI L+  N  + SF + H I  +   K    SI +    + +D+ ++  ++ NG++  D+
Sbjct: 22  GITLQ--NVTVGSFRRWHSIAAEAKFKELNPSIVQKAKQHCLDMKAMETEMYNGVVFDDN 79

Query: 249 DIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDLIGIQISF 294
              LFA+     +SSIS   Q +   +NL++++ L +D++   +S 
Sbjct: 80  RQKLFAR-----ISSISDSYQKYN--DNLELYKGL-LDMMKTDLSL 117

>Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {ON}
           YER172C (REAL)
          Length = 2161

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 16/103 (15%)

Query: 51  NFIPELQNVLTSNSN---------HNFDESKSNLNSDNNQLYSNDNEARIRKQKLRS--I 99
           N IP L N +T N            N  +SK  L+ D NQ  S    ++ ++ KL    +
Sbjct: 368 NEIPNLINEMTVNGLGDLVKQYELRNNVKSKRELDIDANQQQS----SKAKRAKLGDSIV 423

Query: 100 PGQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHI 142
           P  + LE   FD E S+L++   VSLP    KR+K +   +HI
Sbjct: 424 PPTIDLEKIKFD-ESSKLMTITKVSLPEGSFKRVKPQYDEIHI 465

>Skud_5.311 Chr5 complement(514651..521130) [6480 bp, 2159 aa] {ON}
           YER172C (REAL)
          Length = 2159

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 6/99 (6%)

Query: 67  NFDESKSNLNSDNNQLYSNDNEARIRKQKLRSIPGQLTLEHKLFDDEISRLLSPEVVSLP 126
           N   SK  L+SD ++  ++    R +     +IP  + LE   FD E S+L++   VSLP
Sbjct: 394 NIASSKRELDSDEDEPMAS-GAKRTKFCSDSAIPPIIDLEKIKFD-ESSKLMTITKVSLP 451

Query: 127 SQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFP 165
               KR+K +   +HI    K      I Y +  IT  P
Sbjct: 452 EGSFKRVKPQYDEIHIPAPKKPI----IDYELTKITSLP 486

>KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} similar
           to uniprot|Q99287 Saccharomyces cerevisiae YOR165W SEY1
           Synthetic Enhancement with YOP1
          Length = 783

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%)

Query: 169 PTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSIFKYTIPN 228
           P DL   +   L    +E+  + L+ Y+   S + KP Y+  ++    KI + FK TI  
Sbjct: 319 PVDLHCRELSDLAGKLQELKSLCLQEYDTYASRYAKPVYMDNRRDLSHKIENKFKETISK 378

Query: 229 YIDIH 233
           ++D+ 
Sbjct: 379 FLDVQ 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,294,873
Number of extensions: 2093968
Number of successful extensions: 19758
Number of sequences better than 10.0: 443
Number of HSP's gapped: 19970
Number of HSP's successfully gapped: 463
Length of query: 359
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 248
Effective length of database: 40,753,473
Effective search space: 10106861304
Effective search space used: 10106861304
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)