Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0H019705.352ON84084037650.0
KAFR0C018505.352ON6463768981e-109
Kpol_339.135.352ON6863138891e-107
NCAS0F028705.352ON7003538861e-107
TDEL0E027505.352ON5643858621e-105
ZYRO0D10186g5.352ON6353858651e-104
NDAI0C043205.352ON7063508511e-101
CAGL0H07095g5.352ON6613658322e-99
YDR320C (SWA2)5.352ON6683078253e-98
Suva_2.4895.352ON6593658201e-97
Smik_4.5795.352ON6673478156e-97
Skud_4.5865.352ON6423628084e-96
KNAG0C055005.352ON5853117991e-95
TPHA0E011105.352ON6934128002e-94
SAKL0G08822g5.352ON5823816994e-81
Kwal_34.159775.352ON5973236383e-72
Ecym_81815.352ON6613186124e-68
KLLA0B10197g5.352ON6213046096e-68
KLTH0H14872g5.352ON6233095613e-61
AGR352C5.352ON6483055456e-59
NCAS0H008306.21ON3381691135e-05
KAFR0J025706.328ON121731065e-05
SAKL0A01672g6.328ON128781065e-05
Ecym_55825.617ON584961146e-05
Kwal_55.199355.617ON593731146e-05
TPHA0D032203.481ON513741138e-05
TDEL0B051402.152ON5991091093e-04
Kpol_1028.516.328ON1171021003e-04
TBLA0I023106.328ON11673976e-04
NCAS0F034903.481ON512731030.001
KLTH0E02178g5.617ON593641040.001
SAKL0G07084g5.617ON585641020.002
CAGL0K09240g6.328ON14266950.002
YCR060W (TAH1)6.328ON11169930.002
TPHA0D038606.328ON12070930.002
NDAI0F009105.617ON583681000.003
ZYRO0A05676g5.617ON57268990.003
Ecym_20906.328ON17264950.003
Suva_3.956.328ON11164900.004
TDEL0A048405.617ON57668970.006
Kpol_505.413.481ON51375970.006
ZYRO0G06512g2.152ON604109960.008
TBLA0E033005.617ON58294960.009
KNAG0B032005.617ON57968960.009
NCAS0G008105.617ON58468950.010
KLLA0A07062g5.617ON58168950.011
NDAI0D008106.21ON349149940.011
Kwal_56.224336.21ON322132930.014
Skud_3.1356.328ON11870870.014
TDEL0D055003.481ON51269930.019
CAGL0H07425g8.506ON38073920.022
CAGL0H08195g5.617ON58368920.024
AAR054C6.328ON13381860.024
KAFR0F007202.152ON608125920.026
AEL224W5.617ON58068910.031
Skud_2.2828.506ON38573900.037
SAKL0F03102g3.481ON513101900.045
YBR155W (CNS1)8.506ON38573890.049
ZYRO0B04224g3.481ON51384890.050
YOR027W (STI1)5.617ON58968890.059
Skud_15.1925.617ON58968890.059
TPHA0D028805.617ON58568890.063
Suva_8.805.617ON58668880.084
TBLA0C039503.481ON51277870.088
NDAI0B057903.481ON52369870.095
Smik_3.1596.328ON11559800.10
KAFR0B066103.481ON51175860.11
YOR007C (SGT2)6.21ON34692840.16
Kpol_1018.695.617ON59068850.17
NDAI0I004406.328ON12877800.17
Smik_15.2055.617ON58968850.18
KLTH0F14542g3.481ON513117840.19
NCAS0B070102.152ON625108850.19
Kpol_513.28.506ON37480840.20
YNL121C (TOM70)2.152ON617121840.22
KAFR0C058905.617ON57568840.25
Suva_4.4058.506ON38573820.29
Smik_2.2958.506ON38573820.29
KLLA0F24046g2.152ON60471820.36
CAGL0L04048g2.152ON58769810.50
CAGL0E02739g6.21ON34392800.54
Kpol_1048.212.152ON597121810.54
KLLA0C08910g6.328ON11569740.68
CAGL0D05060g3.481ON51074800.69
TDEL0G044806.21ON343143790.69
Suva_15.1826.21ON34677790.79
KNAG0H035302.152ON614103790.79
Ecym_23748.698ON66143790.84
SAKL0E01210g6.21ON323113780.86
Kwal_26.89328.713ON404129780.91
AGR028C3.274ON57980790.92
Smik_15.1766.21ON345138780.93
TPHA0I015102.152ON603103790.94
Kwal_27.118908.506ON33473771.2
NCAS0D045006.328ON12166731.3
Suva_7.4083.481ON51369771.3
TBLA0G010506.21ON350138771.3
TBLA0H033808.506ON37580771.3
Smik_14.2072.152ON617121771.5
KLLA0D01155g6.21ON33563761.6
KLTH0D11770g8.698ON65243771.6
NCAS0B024008.506ON38073761.8
Kpol_1072.48.698ON66153761.9
Skud_15.1686.21ON34883752.1
TDEL0B013108.506ON38080752.1
TDEL0A064308.698ON66643762.2
SAKL0E10956g2.152ON600103752.4
TBLA0C055302.152ON610103752.8
Smik_6.2153.481ON51369752.8
Kwal_55.211753.481ON51172743.1
Kwal_26.88798.698ON65643743.1
TPHA0J003406.21ON33876733.3
YGR123C (PPT1)3.481ON51369743.5
Skud_10.2511.456ON39385733.7
NDAI0K012308.698ON68037743.9
ZYRO0C07788g6.21ON334129734.0
TBLA0B037308.698ON69343744.0
Smik_10.3061.456ON39432734.1
TBLA0A072706.21ON37365734.1
NCAS0C012208.698ON66953734.3
KLTH0C11220g6.21ON327133724.5
Suva_14.2192.152ON617121734.5
Suva_12.1141.456ON37085724.5
KLLA0D11110g2.102ON53061734.9
KLTH0H02068g7.313ON37065725.0
KLTH0B05170g2.152ON59363725.4
Kwal_33.147672.152ON594103725.6
CAGL0G07469g8.698ON66843725.8
KAFR0E029808.506ON38073716.1
TBLA0D046907.203ON46720717.2
Kpol_1037.266.21ON34285707.9
SAKL0H05984g8.698ON65853718.5
AGL268C8.506ON37973709.1
YJR032W (CPR7)1.456ON39332709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0H01970
         (840 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...  1454   0.0  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   350   e-109
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   347   e-107
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   345   e-107
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   336   e-105
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   337   e-104
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   332   e-101
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   325   2e-99
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   322   3e-98
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   320   1e-97
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   318   6e-97
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   315   4e-96
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   312   1e-95
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   312   2e-94
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   273   4e-81
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   250   3e-72
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   240   4e-68
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   239   6e-68
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   220   3e-61
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   214   6e-59
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    48   5e-05
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    45   5e-05
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    45   5e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    49   6e-05
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    49   6e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    48   8e-05
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    47   3e-04
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    43   3e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    42   6e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    44   0.001
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    45   0.001
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    44   0.002
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    41   0.002
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    40   0.002
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    40   0.002
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     43   0.003
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    43   0.003
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    41   0.003
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    39   0.004
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    42   0.006
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    42   0.006
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    42   0.008
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    42   0.009
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    42   0.009
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    41   0.010
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    41   0.011
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    41   0.011
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    40   0.014
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    38   0.014
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    40   0.019
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    40   0.022
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    40   0.024
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    38   0.024
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    40   0.026
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    40   0.031
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.037
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    39   0.045
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    39   0.049
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    39   0.050
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    39   0.059
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    39   0.059
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    39   0.063
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    39   0.084
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    38   0.088
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    38   0.095
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    35   0.10 
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    38   0.11 
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    37   0.16 
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    37   0.17 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    35   0.17 
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    37   0.18 
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    37   0.19 
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    37   0.19 
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    37   0.20 
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    37   0.22 
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    37   0.25 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    36   0.29 
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    36   0.29 
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    36   0.36 
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    36   0.50 
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    35   0.54 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    36   0.54 
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    33   0.68 
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    35   0.69 
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    35   0.69 
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    35   0.79 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    35   0.79 
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    35   0.84 
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    35   0.86 
Kwal_26.8932 s26 (1011029..1012243) [1215 bp, 404 aa] {ON} YOR26...    35   0.91 
AGR028C Chr7 complement(766474..768213) [1740 bp, 579 aa] {ON} S...    35   0.92 
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    35   0.93 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    35   0.94 
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    34   1.2  
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   1.3  
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    34   1.3  
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    34   1.3  
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    34   1.3  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    34   1.5  
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    34   1.6  
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    34   1.6  
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    34   1.8  
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    34   1.9  
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    33   2.1  
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    33   2.1  
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    34   2.2  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    33   2.4  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    33   2.8  
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    33   2.8  
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    33   3.1  
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    33   3.1  
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    33   3.3  
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    33   3.5  
Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032...    33   3.7  
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    33   3.9  
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    33   4.0  
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    33   4.0  
Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032...    33   4.1  
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    33   4.1  
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     33   4.3  
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    32   4.5  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    33   4.5  
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    32   4.5  
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    33   4.9  
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    32   5.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    32   5.4  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    32   5.6  
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    32   5.8  
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    32   6.1  
TBLA0D04690 Chr4 complement(1162517..1163920) [1404 bp, 467 aa] ...    32   7.2  
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    32   7.9  
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    32   8.5  
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    32   9.1  
YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}  CPR7Pepti...    32   9.5  

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 1454 bits (3765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/840 (86%), Positives = 727/840 (86%)

Query: 1   MSDPFANLLSSFKGDTPNSTSASISKNASLDVLASQRRAQSDLSSLSAKLTPSLKTNSDT 60
           MSDPFANLLSSFKGDTPNSTSASISKNASLDVLASQRRAQSDLSSLSAKLTPSLKTNSDT
Sbjct: 1   MSDPFANLLSSFKGDTPNSTSASISKNASLDVLASQRRAQSDLSSLSAKLTPSLKTNSDT 60

Query: 61  QRVLNTTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDFEDLFGK 120
           QRVLNTTH                                          LDDFEDLFGK
Sbjct: 61  QRVLNTTHTNSSPIYTSNIISTSTATTSASINITSNSNATTTTSNRSKSTLDDFEDLFGK 120

Query: 121 IDQRQALRTEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPMTTEKNTSLLE 180
           IDQRQALRTEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPMTTEKNTSLLE
Sbjct: 121 IDQRQALRTEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPMTTEKNTSLLE 180

Query: 181 GFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAHM 240
           GFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAHM
Sbjct: 181 GFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAHM 240

Query: 241 YYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASD 300
           YYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASD
Sbjct: 241 YYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASD 300

Query: 301 FLNKGKGIVDQFSTYHEEDYRPXXXXXXXXXXXXIHSEKHKSPDTTPISVYENDHAPLTE 360
           FLNKGKGIVDQFSTYHEEDYRP            IHSEKHKSPDTTPISVYENDHAPLTE
Sbjct: 301 FLNKGKGIVDQFSTYHEEDYRPFRSTNFSSRNNSIHSEKHKSPDTTPISVYENDHAPLTE 360

Query: 361 YENGKVPILRRKEVKDTKNNEKLSKNGYPSRSNRKFMDATQYTTDYSTTEGKNYSKXXXX 420
           YENGKVPILRRKEVKDTKNNEKLSKNGYPSRSNRKFMDATQYTTDYSTTEGKNYSK    
Sbjct: 361 YENGKVPILRRKEVKDTKNNEKLSKNGYPSRSNRKFMDATQYTTDYSTTEGKNYSKRDSN 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXNTLNIVQTQTSPISLPHTNVIEGDLLGDFGSNLKNHNE 480
                                 NTLNIVQTQTSPISLPHTNVIEGDLLGDFGSNLKNHNE
Sbjct: 421 VRVSSPVPSSTSGTSLSSRFSPNTLNIVQTQTSPISLPHTNVIEGDLLGDFGSNLKNHNE 480

Query: 481 SLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPIST 540
           SLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPIST
Sbjct: 481 SLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPIST 540

Query: 541 IELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEY 600
           IELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEY
Sbjct: 541 IELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEY 600

Query: 601 SQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYD 660
           SQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYD
Sbjct: 601 SQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYD 660

Query: 661 SYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRIXXXXXXXXXXXXINVNKN 720
           SYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRI            INVNKN
Sbjct: 661 SYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQSTASTSSINVNKN 720

Query: 721 VXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAIN 780
           V                     DSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAIN
Sbjct: 721 VERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAIN 780

Query: 781 ASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMNS 840
           ASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMNS
Sbjct: 781 ASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMNS 840

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  350 bits (898), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/376 (50%), Positives = 245/376 (65%), Gaps = 17/376 (4%)

Query: 466 DLLGDFGSNLK--NHNESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTAKAD 523
           DLL +F +NLK  ++ E L      + S+L D D+D  T +  K   S TS +++    D
Sbjct: 286 DLLDNFQNNLKLDDNKEEL-----SKESVLLDIDNDDSTLLKSK---SLTSDSLLFQ--D 335

Query: 524 EKDLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLR 583
           E  L N+  I K+PIS+IELSGY E+ + G+ FFK GDY SAL EY+KSLNTLPQ HPLR
Sbjct: 336 ENVLENS-NIPKIPISSIELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLR 394

Query: 584 LISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVL 643
           +I+YSNI AA+LK+GEYS  VK  D AL+LFPK + +W   IQDS+P K+YK+IW K+VL
Sbjct: 395 IIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVL 454

Query: 644 RKAEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRIX 703
           RKAEA EH+E +++AY  Y  L+  NVF+DKIM GKRRCQKVLNPE  K      +S   
Sbjct: 455 RKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNPEIAKKTQQKPSSSKP 514

Query: 704 XXXXXXXXXXXINVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYL 763
                          ++V                     D V AKI  W +NK +DIR+L
Sbjct: 515 AAVPTPSTQKY----ESVERIKEQNRQEEENEAEKLKLYDIVEAKINAWKSNKPEDIRHL 570

Query: 764 LSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFS 823
           L+N+  +LTW+ WK I+ +DLVMPKKVKV Y+KA+AKTHPDKIS  L++E+KMIAE+ FS
Sbjct: 571 LANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFS 630

Query: 824 ILSVAWEKFKTANKMN 839
            LSVAW+KFK  N MN
Sbjct: 631 TLSVAWDKFKEENNMN 646

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 6/112 (5%)

Query: 213 QQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKY-- 270
           Q SVVDEVKDMEIA+LMSLGLSI+KA+ YY+KG   D +L+K++ +++  +    T    
Sbjct: 121 QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGSRKGRDTPTFG 180

Query: 271 -DDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEEDYR 321
            +  K   +  KL +S+    N  LFS+AS   NKGK  +DQ + Y EE  R
Sbjct: 181 GNTNKDDKAYAKLFDSSE---NTNLFSMASGLFNKGKEFIDQMTAYPEETDR 229

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  347 bits (889), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 213/313 (68%), Gaps = 9/313 (2%)

Query: 530 TLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSN 589
           +LP  KVPIS IEL GY EF+  GTE FK GDY +AL  Y+KSLNTLP KHPLR+I+ SN
Sbjct: 380 SLP--KVPISEIELLGYKEFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSN 437

Query: 590 ILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEAC 649
           ILA+  K GEY +S++    ALE FP + KQW +FIQDS+PQ+TYK+IWPKIVL++AEA 
Sbjct: 438 ILASMSKTGEYRKSIEISTSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAF 497

Query: 650 EHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRIXXXXXXX 709
           EH+E Y+ A ++YQ ++ KN FNDK+M+GKRRCQ V+NP  P   +S+   R        
Sbjct: 498 EHIESYENALETYQQMIEKNFFNDKVMSGKRRCQHVINPVKPTKSNSSALPR----QTNT 553

Query: 710 XXXXXINVNK---NVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSN 766
                 N NK   NV                     DSV A+I KW  NK+DDIR+LLSN
Sbjct: 554 KPKKESNQNKAYENVEKLKQKNKLEAEIESQRLALYDSVEAQINKWKANKDDDIRHLLSN 613

Query: 767 VHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILS 826
           + ++LTW NW  +  SDLVMPKKVK+ YMKAVA+THPDKI  DL +E KMIAE+IFS+LS
Sbjct: 614 LQLILTWGNWNPVPPSDLVMPKKVKITYMKAVARTHPDKIPSDLELEKKMIAENIFSVLS 673

Query: 827 VAWEKFKTANKMN 839
            AWEKFK  N MN
Sbjct: 674 KAWEKFKKDNNMN 686

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 99/218 (45%), Gaps = 58/218 (26%)

Query: 112 DDFEDLFGKIDQRQALRTEK-IPSTAP-------DSMDELDRAMNTFNSNTPSVTKNGSK 163
           DD  DLFG   + + +   K I ++ P       + +D+LD AMN FN ++P  +  GS 
Sbjct: 63  DDIADLFGLSSESKPINASKPINASKPINTSKPSEGIDDLDAAMNFFN-DSPQESLRGST 121

Query: 164 SNYFPPMTTEKNTSLLEGFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDM 223
               P                                          E Q  VVDEVKDM
Sbjct: 122 VTTSP------------------------------------------EVQDIVVDEVKDM 139

Query: 224 EIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLN 283
           EIAKLMSLGL ID+A  +Y+ G L + ++ K++       S  + + +D+  RN + +  
Sbjct: 140 EIAKLMSLGLDIDEATTHYDNGILYETLVSKIRTS----NSRITAQRNDSG-RNDI-RAE 193

Query: 284 NSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEEDYR 321
               P  +N  F+    F +KGK +VDQ++ YHEED R
Sbjct: 194 PMRKPRTSNGSFTFTGLF-DKGKQLVDQWTVYHEEDDR 230

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  345 bits (886), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/353 (50%), Positives = 231/353 (65%), Gaps = 13/353 (3%)

Query: 490 SSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTIELSGYTEF 549
           S+ L DFD DS         N++ +  +        ++ ++LP++  PIS IELSGY EF
Sbjct: 356 STTLLDFDDDSSF-------NASNTPFVNGNNNINNNVNSSLPVI--PISHIELSGYAEF 406

Query: 550 RANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDV 609
           R  GT++FK GDY S+  EY+KSLNTLP  HPLR+I+YSNI+A++LK+GEYS+S+K+   
Sbjct: 407 RNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNSSS 466

Query: 610 ALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKN 669
           ALE+FP +  QWT  IQDSDPQ+TYK+IWPK+ LR+AEA EH+E ++ A  SYQ L+ K 
Sbjct: 467 ALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKAALSSYQELIEKG 526

Query: 670 VFNDKIMAGKRRCQKVLNPETPKLKSSANTSRIXXXXXXXXXXXXIN----VNKNVXXXX 725
             NDKIM GKRRCQKVLNP  P +  +   S               N    V ++V    
Sbjct: 527 FANDKIMDGKRRCQKVLNPTPPPVVKTPRISTPKQSPSPVPRKATSNSKDAVYESVERLK 586

Query: 726 XXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAINASDLV 785
                            D V AK++ W N K+ DIR+LL+N+ IVLTW +WK + ASDLV
Sbjct: 587 KENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLANLSIVLTWCDWKPVAASDLV 646

Query: 786 MPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKM 838
           MPKKVK+ YMKAVAKTHPDK+ + L +ENKMIAE++FS+LSVAW+KFK  N M
Sbjct: 647 MPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLSVAWDKFKIENNM 699

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 141/338 (41%), Gaps = 113/338 (33%)

Query: 1   MSDPFANLLSSFKGDTPNSTSASISKNASLDVLASQRRAQS--DLSSLS-AKLTPSLKTN 57
           MSDPFA+LL+SFK    N+ S     N S    A+Q+ A +  ++S LS   L PS   N
Sbjct: 1   MSDPFADLLTSFKNGKDNAKSEPTKSNIS----ATQKPASASPNISQLSITPLVPSPSPN 56

Query: 58  SDTQRVLNTTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDFEDL 117
                                                                 DDF+DL
Sbjct: 57  VSIH--------------------------------------------------DDFDDL 66

Query: 118 FGKIDQRQALRTEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPMTTEKNTS 177
           FG    +    T     T     D++D A N F + TPS +                   
Sbjct: 67  FGVSLGQNGTNTIVPKQTVKTETDDIDAAFNVFQA-TPSQSI------------------ 107

Query: 178 LLEGFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDK 237
                  KP     N+              +D ++++ VVDEVKDME+A+LMSLGLSID+
Sbjct: 108 -------KPEASAPND--------------IDRDEEEYVVDEVKDMEVARLMSLGLSIDE 146

Query: 238 AHMYYNKGYLSDDVL------------RKMQAQKHKRQSNYSTKYD--DTKIRNSLDKLN 283
           A+ +Y+KG L +++L            RK++ Q  KR SN  +  +  + +  N+   + 
Sbjct: 147 ANDHYDKGILYENLLAKMKQNQRQKERRKVETQPTKRNSNPPSANNRLNDRFDNTYANIR 206

Query: 284 NSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEEDYR 321
           +S +  G+  LFS+A+DFL KGK  VDQ   Y EE+ R
Sbjct: 207 DSRTRGGD--LFSMATDFLYKGKEFVDQLIAYPEENNR 242

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  336 bits (862), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 225/385 (58%), Gaps = 28/385 (7%)

Query: 455 ISLPHTNVIEGDLLGDFGSNLKNHNESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATS 514
           +  P   V EG+LLG+F   + N  E   S      + L DFD            N    
Sbjct: 208 VEPPTVEVEEGNLLGEFQEKI-NLEEPKRSPTPPPQATLLDFD------------NGTPP 254

Query: 515 KNIVTAKADEKDLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLN 574
           + I T             I  VPIS +E+SGY E++  GTEFFK GDY SA  EY+KSLN
Sbjct: 255 ERIKT-------------ITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLN 301

Query: 575 TLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTY 634
           +LPQ H LR+++YSN+ AA  KVGEY + + D + ALE+FPK+   W + IQDS P +T+
Sbjct: 302 SLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTF 361

Query: 635 KEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLK 694
           KE+WPKIV R+AEA EH+E Y+ A   YQ L+ KN FNDKIM GKRRCQKVLNP  PK  
Sbjct: 362 KEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPK-A 420

Query: 695 SSANTSRIXXXXXXXXXXXXINVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTN 754
           +S N S                   NV                     D+V  +I+ W  
Sbjct: 421 TSPNRSPTPVPKVSEDTKQP-KTYANVERVKQENQRNELQEAEKAALYDTVFQQIESWKA 479

Query: 755 NKEDDIRYLLSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIEN 814
            K DDIR+LL+N+  VLTW +WK ++ SDLVMPKKVK+ YMKAVAKTHPDKI   L +E 
Sbjct: 480 GKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEK 539

Query: 815 KMIAESIFSILSVAWEKFKTANKMN 839
           +MIAE +FS LSVAWEKFK AN +N
Sbjct: 540 RMIAEDVFSSLSVAWEKFKLANDIN 564

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 63/111 (56%), Gaps = 7/111 (6%)

Query: 211 EDQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKY 270
           E  + VVDEVKDME+AKLMSL L ID+A  YY +G L + + R+ + Q+  R+     + 
Sbjct: 87  ESPEMVVDEVKDMEVAKLMSLNLDIDQATDYYERGVLYEQLSRQRREQELIRRREQMLRQ 146

Query: 271 DDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEEDYR 321
              + +   +K ++ +        FS+AS  L KG+  VDQFS + +E  R
Sbjct: 147 QQQQQQTPEEKFDSGS-------FFSLASGILEKGRQFVDQFSGFPQEQDR 190

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  337 bits (865), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 236/385 (61%), Gaps = 22/385 (5%)

Query: 458 PHTNVIEGDLLGDFGSNLK---NHNESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATS 514
           P     EGDLLGDF   L      N+S  +  S  +  L DFD+ S  S         TS
Sbjct: 270 PTIQAQEGDLLGDFQDKLSLRSQGNKSTSASQSPSNETLLDFDAPSANS---------TS 320

Query: 515 KNIVTAKADEKDLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLN 574
            ++  ++  +  +V T     VPI+ IELSGY EF+    E FK GDY +AL EY+KS N
Sbjct: 321 ASVSVSR--QGSVVPT-----VPITEIELSGYNEFKDRAGELFKTGDYVAALQEYEKSAN 373

Query: 575 TLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTY 634
           TLP  HPLR+ISYSN++A+QLK G+Y +S+    +AL+LFP++  QWTQ IQ+S+P KTY
Sbjct: 374 TLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTY 433

Query: 635 KEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLK 694
           +++WPKIV R+AEA EH E +Q A+++YQ L+ KN   +KIM GKRRCQKVLNPE PK+ 
Sbjct: 434 RDMWPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQKVLNPEKPKVV 493

Query: 695 SSANTSRIXXXXXXXXXXXXINVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTN 754
                S                  KN+                     D V  +I+ W +
Sbjct: 494 QKKPASSKSPSPSPNHSDKKY---KNLQKVKEDNRKQAEEDTQRHALYDRVYDQIKLWES 550

Query: 755 NKEDDIRYLLSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIEN 814
            K +DIR+LLSN+  VLTW +WK ++ +DLVMPKKVK+ Y++AVAKTHPDKIS  L ++ 
Sbjct: 551 GKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKISDSLPLDK 610

Query: 815 KMIAESIFSILSVAWEKFKTANKMN 839
           KMIAES+FS LS AWEKFK+ N +N
Sbjct: 611 KMIAESVFSSLSSAWEKFKSENDIN 635

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 99/220 (45%), Gaps = 32/220 (14%)

Query: 169 PMTTEKNTSLLEGFDDKPTIDTHNNTQNSNIQ-LPLS------DDNLDM----------- 210
           P+TT  N  + + F+    I ++ NT NS++   P +      D  +D+           
Sbjct: 49  PVTTASNYKIDDDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAIDLLQITPEKQRQS 108

Query: 211 --EDQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQK-HKRQSNYS 267
              + + +VDEV+DME+AKLMSLG SID A+  Y +G L DDV+ + + +K H+R+    
Sbjct: 109 AEREPEQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKKKKLHRRE--LQ 166

Query: 268 TKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEED-----YRP 322
               +T       + NN  S   N  LFSIAS   NKGK IVD  S + +E+     YR 
Sbjct: 167 RLMAETNWERETPETNNDESGKNNVDLFSIASGIFNKGKKIVDHLSLFPDEENDLLPYRS 226

Query: 323 XXXXXXXXXXXXIHSEKHKSPDTTPISVYENDHAPLTEYE 362
                       +     K P   P         P  EYE
Sbjct: 227 ERLKQRQTFEPELPRRPRKDPTPNP----RTQGTPQVEYE 262

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  332 bits (851), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/350 (48%), Positives = 219/350 (62%), Gaps = 6/350 (1%)

Query: 493 LFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNT-LPIVKVPISTIELSGYTEFRA 551
           L DFD  S  +     N S   KN  ++ A         + I  VPIS IELSG+ EF+ 
Sbjct: 360 LLDFDGLSTVTAPGSSNISVNKKNTSSSSATSPSPSPASITIATVPISHIELSGHIEFKT 419

Query: 552 NGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVAL 611
            G+E FK GDY SAL EY+KSLNTLPQ HPLR+ISYSNI+A QLK+GEYS+S++DC +AL
Sbjct: 420 RGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIAL 479

Query: 612 ELFPKND--KQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKN 669
            LFPK      W Q I DS PQ+++K+IW K+++R+AE+ EH+E Y++A DSYQ L+   
Sbjct: 480 SLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENG 539

Query: 670 VFNDKIMAGKRRCQKVLNPETPKLKSSANTSRIXXXXXXXXXXXXINVNKNVXXXXXXXX 729
             N KIM GKRRCQK+LNP  P   S + T                    +V        
Sbjct: 540 FTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDT---TTASVQRLQDENA 596

Query: 730 XXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAINASDLVMPKK 789
                        D V +KI  W  +K+ DIR+LLSN+  VLTW +W +I+ +DLVMPKK
Sbjct: 597 KSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKK 656

Query: 790 VKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMN 839
           VK+ Y+KA+ KTHPDKI + L +ENKMIAE++FSILS+AW+KFK  N MN
Sbjct: 657 VKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 79/124 (63%), Gaps = 19/124 (15%)

Query: 212 DQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQS------- 264
           +++ +VDEVKDME+A+LMSLGLSID+A+ YY+KG L +D++RK + +K K+QS       
Sbjct: 140 EEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNA 199

Query: 265 -------NYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHE 317
                   YS  +D+T       + N S +  GN  LFS+A+D L KGK +VDQ + Y E
Sbjct: 200 QDKNNTQKYSDLFDNTYANK---RFNESQNNTGN--LFSMATDILYKGKELVDQLTAYPE 254

Query: 318 EDYR 321
           E+ R
Sbjct: 255 ENNR 258

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  325 bits (832), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 167/365 (45%), Positives = 232/365 (63%), Gaps = 29/365 (7%)

Query: 487 SQESSI-----LFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTI 541
           S+ESS+     L DFD+D          N A+S  + T+        NT+ I ++PIS I
Sbjct: 314 SRESSMPGEGTLLDFDND----------NHASSPVVNTSNQ------NTVSITQIPISHI 357

Query: 542 ELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYS 601
           E+SGY EF+A GT++FK GDY SA+ EY+KSLNTLP KHPLR+I+YSNI+A+++K+G++S
Sbjct: 358 EISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHS 417

Query: 602 QSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDS 661
           QSV D   A++L P+    WT  IQ+SDP ++Y +IWPKI+LR+AE+ E +EKY++A D+
Sbjct: 418 QSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDA 477

Query: 662 YQLLLHKNVFNDKIMAGKRRCQKVLN----PETPKLKSSANTSRIXXXXXXXXXXXXINV 717
           YQ LL KN+F++K++AGKRRCQ  L     P++     SA  +              + V
Sbjct: 478 YQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAPRRAPTVNRQTEV-V 536

Query: 718 NK---NVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWS 774
           NK   N                      D V   I  W N K+DDIRYLLSN+  V+TW+
Sbjct: 537 NKKSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNLQAVITWT 596

Query: 775 NWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKT 834
            WK + +S+LV+P+KVK+ YMKAVAK HPDK+   L++E +MIAES+FS LS +WE FK 
Sbjct: 597 QWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSDSWENFKK 656

Query: 835 ANKMN 839
           +N +N
Sbjct: 657 SNDIN 661

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 134/323 (41%), Gaps = 99/323 (30%)

Query: 1   MSDPFANLLSSFK-GDTPNSTSASISKNASLDVLASQRRAQSDLSSLSAKLTPSLKTNSD 59
           MSDPF +LL+S K G+ P+S   S   + +   L  Q++          KLTP L T S 
Sbjct: 1   MSDPFGHLLASLKEGNVPSSKPGSKENSVTPGALTPQKK----------KLTP-LHTESI 49

Query: 60  TQRVLNTTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDFEDLFG 119
                N                                              DD +DLFG
Sbjct: 50  VHGNGNVVSNTNIH--------------------------------------DDLDDLFG 71

Query: 120 KIDQRQALRTEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPMTTEKNTSLL 179
            I ++     E +      S+D LD     F S++  V+K            TE +   +
Sbjct: 72  SIPKK-----EDVVQDNHTSIDGLD----LFQSSSHVVSK------------TEPDNQEI 110

Query: 180 EGFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAH 239
             FD+                 P   ++      + V+DEV+DME+AKLMSLGL+IDKA 
Sbjct: 111 NPFDN-----------------PFETEHKSESPTEEVIDEVRDMELAKLMSLGLNIDKAS 153

Query: 240 MYYNKGYLSDDVLRKMQAQK---HKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFS 296
            YY +G   +DVLRK + +    ++++SN   K    +IRN  D   +     G+  LF 
Sbjct: 154 SYYERGITFEDVLRKRKQKASNGYQQRSNIDRKQGGGEIRNIFDTRGS-----GSESLF- 207

Query: 297 IASDFLNKGKGIVDQFSTYHEED 319
             S  LNKGK +V+Q STY EE+
Sbjct: 208 --SGILNKGKELVNQLSTYTEEE 228

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  322 bits (825), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 152/307 (49%), Positives = 207/307 (67%), Gaps = 5/307 (1%)

Query: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595
           +PIS IELSGY EF+A GT  FK GDY ++L EY+KSLNTLP  HPLR+I+ SNI+A+QL
Sbjct: 364 IPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQL 423

Query: 596 KVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           K+GEYS+S+++  +ALELFP +  +W   I +SDP++++ +IWPKI++R+AE+ EH+E +
Sbjct: 424 KIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESF 483

Query: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRIXXXXXXXXXXXXI 715
           + A ++YQ L+ KN F+DKIM GKRRCQ  +NP  P +K S    +             +
Sbjct: 484 KKALETYQELIKKNFFDDKIMQGKRRCQDFINP--PPVKKSMPVKKKTTTTSPATKKQNL 541

Query: 716 NV---NKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLT 772
                N  +                     D V  KI  W + K+DDIR+LL+N+  +LT
Sbjct: 542 TASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLT 601

Query: 773 WSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKF 832
           W NWK ++  DLVMPK+VK+ YMKAVAKTHPDKI + LS+ENKMIAE+IFS LS+AW+KF
Sbjct: 602 WCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKF 661

Query: 833 KTANKMN 839
           K  N +N
Sbjct: 662 KLQNDIN 668

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 215 SVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTK 274
           ++VDEVKDMEIA+LMSLGLSI++A  +Y      +  L  +++ K K +++ + +  ++ 
Sbjct: 137 ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKS-KQKERNDLAIRKKESG 195

Query: 275 IRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEE 318
           I+     L+N      NN LFS+A+DF NKGK +VDQ++++  E
Sbjct: 196 IKMEKSGLSNIVGTDSNN-LFSMATDFFNKGKKLVDQWTSFPPE 238

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 11/68 (16%)

Query: 1  MSDPFANLLSSFKGD---------TPNST-SASISKNASLDVLASQRRAQSDLSSLSA-K 49
          MSDPFA+LL+S K           TP S+ S SI+ +A  DV  + +     L S+SA  
Sbjct: 1  MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60

Query: 50 LTPSLKTN 57
          L PS K +
Sbjct: 61 LIPSPKVD 68

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  320 bits (820), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/365 (45%), Positives = 230/365 (63%), Gaps = 30/365 (8%)

Query: 480 ESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPIS 539
           ++L     Q    L DF +D+++S     NNSA S+          +  NT P+   PIS
Sbjct: 320 DALRKEEPQREDNLLDFSTDNISST----NNSAISR----------EDGNTNPVA--PIS 363

Query: 540 TIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGE 599
            IELSGY EF+A GT  FK GDY ++L EY+KSLN+LP KHPLR+I+ SNI+A+QLK+GE
Sbjct: 364 DIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGE 423

Query: 600 YSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAY 659
           YS+S+++ D AL LFP N   W   I  SDPQ++Y +IWPKI++R+AE+ EH+E ++ A 
Sbjct: 424 YSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

Query: 660 DSYQLLLHKNVFNDKIMAGKRRCQKVLNPE-----TPKLKSSANTSRIXXXXXXXXXXXX 714
           ++YQ L+ +N F+DKIM GKRRCQ  +NP      +P  K++   + +            
Sbjct: 484 ETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPAPMKKPTSTPSPAPV 543

Query: 715 INVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWS 774
            N ++                       D+V+ KI  W   K+DDIR+LL+N+  +LTW 
Sbjct: 544 DNASR---------VKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWC 594

Query: 775 NWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKT 834
           NWK ++  +LVMPKKVK+ YMKAVAKTHPDKI K LS+ENKMIAE++F+ LS AW+KFK 
Sbjct: 595 NWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQ 654

Query: 835 ANKMN 839
            N +N
Sbjct: 655 QNDIN 659

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 67/106 (63%), Gaps = 8/106 (7%)

Query: 216 VVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLR--KMQAQKHK-RQSNYSTKYDD 272
           +VDEVKDMEIA+LMSLGLSI+KA  +YN     +  L   K++ +KHK R +++      
Sbjct: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSS 196

Query: 273 TKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEE 318
           +K  +  +  + + +      LFS+A+DF NKGK +VDQ++++  E
Sbjct: 197 SKNASLFNNASPNNN-----NLFSMATDFFNKGKELVDQWTSFPPE 237

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  318 bits (815), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 218/347 (62%), Gaps = 13/347 (3%)

Query: 493 LFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTIELSGYTEFRAN 552
           L DF   +VT     ++NS+ S ++           N  P   +PIS IELSGY EF+A 
Sbjct: 334 LLDFSEGNVT-----KSNSSESNSLFNG--------NRNPNSAIPISDIELSGYNEFKAK 380

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G+ FFK GDY ++L EY+KSLN+LP  HPLR+I+ SNI+A+QLKVGEYS+S+++  +AL 
Sbjct: 381 GSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSSMALA 440

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672
           LFP     W+  I DSDPQ+++ +IWPKI++R+AE+ EH+E +  A ++YQ L++KN F+
Sbjct: 441 LFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQELINKNFFD 500

Query: 673 DKIMAGKRRCQKVLNPETPKLKSSANTSRIXXXXXXXXXXXXINVNKNVXXXXXXXXXXX 732
           +KIM GKRRCQ  +NP   K  S    +               +   +            
Sbjct: 501 EKIMQGKRRCQNFINPPPVKKFSPVKKATSTQSPTEKSTPTSSSSTSSNSPDTTSKIKKQ 560

Query: 733 XXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAINASDLVMPKKVKV 792
                     D V  +I  W N+K DDIR+LL+N+  +LTW NWK I   DLVMPK+VK+
Sbjct: 561 ELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLLTWCNWKDIPMQDLVMPKRVKI 620

Query: 793 NYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMN 839
            YMKAVAKTHPDKI + LS+ENKMIAE++FS LS+AW+KFK  N +N
Sbjct: 621 TYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDKFKQQNDIN 667

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 71/112 (63%), Gaps = 14/112 (12%)

Query: 214 QSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHK------RQSNYS 267
           +++VDEVKDMEIA+LMSLGLSI+KA  +YN     +  L+ +++ + K      R+S   
Sbjct: 136 EALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKVLKSNQKKSKDRTARESPGD 195

Query: 268 TKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEED 319
             ++ +++ N+    NN+        LFSIA++F NKGK +VDQ++++  E+
Sbjct: 196 VNFERSELSNNFGSENNN--------LFSIATNFFNKGKELVDQWTSFPPEE 239

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  315 bits (808), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 224/362 (61%), Gaps = 33/362 (9%)

Query: 486 GSQESSI---LFDFDSDSVTSMHIKQNNS--ATSKNIVTAKADEKDLVNTLPIVKVPIST 540
           G +ESS+   L DF  ++ T     +NN+    S N V+                VPIS 
Sbjct: 306 GKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSV---------------VPISD 350

Query: 541 IELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEY 600
           IELSGY+EF+A G   FK GDY ++L EY+K+LN+LP  HPLR+I  SNI+A+QLKVGEY
Sbjct: 351 IELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEY 410

Query: 601 SQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYD 660
           S+S+ + D+AL LFP     W   I +SDPQ+++ +IWPKI++R+AE+ EH+E ++ A +
Sbjct: 411 SKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALE 470

Query: 661 SYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSA---NTSRIXXXXXXXXXXXXINV 717
           +YQ L+ +N F+DKIM GKRRCQ  ++P  P ++ S     T+              I++
Sbjct: 471 TYQELISRNFFDDKIMQGKRRCQNFISP--PLVRKSTPVKKTTPTLKKPAPDPSPAPIDI 528

Query: 718 NKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWK 777
              V                     D V  KI  W   KEDDIR+LLSN+  +LTW NWK
Sbjct: 529 PSKV--------KEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWK 580

Query: 778 AINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANK 837
            ++  DLVMPKKVK+ YMKAVAKTHPDKI + LS+ENKMIAE+IFS LS+AW+KFK  N 
Sbjct: 581 DVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQND 640

Query: 838 MN 839
           +N
Sbjct: 641 IN 642

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (61%), Gaps = 4/102 (3%)

Query: 219 EVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQA-QKHKRQSNYSTKYDDTKIRN 277
           EVKDMEIA+LMSLGLS+ KA  +YN     +  L  +++ QK  R      K +D KI+ 
Sbjct: 136 EVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKK 195

Query: 278 SLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEED 319
                NN+ S   NN L SIA+DF NKGK ++DQ++++  E+
Sbjct: 196 P-GLFNNTDS--DNNNLLSIATDFFNKGKELMDQWTSFPPEE 234

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  312 bits (799), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 148/311 (47%), Positives = 205/311 (65%), Gaps = 4/311 (1%)

Query: 531 LPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNI 590
           LPIV  PIST+ELSGY EFRA GTE FKKGDY +A+ EY+KSLNTLP+KHPLR+I+ SN+
Sbjct: 277 LPIV--PISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNM 334

Query: 591 LAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACE 650
           +   LK+GEY++ +K   +ALEL P++   W   IQ S+P++TY++IW K+V+R AEA E
Sbjct: 335 MLPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQE 394

Query: 651 HMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNP--ETPKLKSSANTSRIXXXXXX 708
           H E Y  A+D+YQLL+   + N+K+M GKRRCQKVLNP  +  +  +   T ++      
Sbjct: 395 HAENYTGAFDNYQLLVANGITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPART 454

Query: 709 XXXXXXINVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVH 768
                   V +N                      D V  K+  W  +KE DIRYLLS++ 
Sbjct: 455 PDPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDIRYLLSHLT 514

Query: 769 IVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVA 828
            ++TW  W +++ +DLVMPK+VK+ Y+KA+AK HPDKI  DL +E +MIA+++FS+L+ A
Sbjct: 515 EIVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVFSVLNNA 574

Query: 829 WEKFKTANKMN 839
           WEKFK  N +N
Sbjct: 575 WEKFKLDNNIN 585

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 78/141 (55%), Gaps = 18/141 (12%)

Query: 182 FDDKPTIDTHNNTQNSNIQLP---LSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKA 238
           FDD    D  N+   + ++ P    SD+++   +  +VVDEV+DME+AK+MSLG  IDKA
Sbjct: 71  FDD--VFDLFNSEPAAEVKEPDRVPSDESV--HENVAVVDEVRDMEVAKIMSLGFGIDKA 126

Query: 239 HMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIA 298
             +Y+ G L D+++ + + ++H R          T  R+S+ ++       GN+  FS A
Sbjct: 127 VEFYDSGVLYDELVER-RDRRHIRH---------THTRHSVREVTEVPKHTGNS-FFSAA 175

Query: 299 SDFLNKGKGIVDQFSTYHEED 319
              LNKGK  VD  + Y +E+
Sbjct: 176 VGLLNKGKDFVDHLTAYPDEE 196

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  312 bits (800), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 174/412 (42%), Positives = 238/412 (57%), Gaps = 43/412 (10%)

Query: 447 IVQTQTSPISLPHTNVIEGDLLGDFGSNL-----------------KNHNESLVSHGSQE 489
           I   Q SP  L  +N +EGDLL  F  N+                 K ++E +      +
Sbjct: 304 ITHKQKSPADLT-SNELEGDLLDSFEENIVIGESFTNIPPRITERQKPNDERI------Q 356

Query: 490 SSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTIELSGYTEF 549
            + L DF ++ ++S            N+  + + ++     +P++   I+ IELSGY EF
Sbjct: 357 DNTLLDFGNEDLSS----------PANVSISSSGQE----CIPVIS--INQIELSGYNEF 400

Query: 550 RANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDV 609
           +  GTE+FKKGDY SA  +Y+KSLN+L + HPLR+I+ SN+LA+ LK G+Y+  +     
Sbjct: 401 KDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTS 460

Query: 610 ALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKN 669
           AL+LFPK  K W   IQ+S+P KTYKEIW K+V R+AEA E +E YQ AYDSYQLL+  N
Sbjct: 461 ALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENN 520

Query: 670 VFNDKIMAGKRRCQKVLNPET---PKLKSSANTSRIXXXXXXXXXXXXINVNKNVXXXXX 726
           +FN+KIMAGK RCQKVLNPET   P  K  A T+                 + N+     
Sbjct: 521 IFNEKIMAGKLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTSSGNLKKIQE 580

Query: 727 XXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAINASDLVM 786
                           D V  K+  W   K+DDIR+LLS +  ++TW+ W  + +SDLVM
Sbjct: 581 QNKRTEKYEEEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLVM 640

Query: 787 PKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKM 838
           PKKVK+ Y+KAVAKTHPDK+  +L  E++M+AE+IFSILS  WEKFK  N +
Sbjct: 641 PKKVKITYLKAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNNI 692

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 96/212 (45%), Gaps = 51/212 (24%)

Query: 111 LDDFEDLFGKIDQRQALRTEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPM 170
           LDDF+DLFG    + ++ T     T     D+LD  M+ F+               F P 
Sbjct: 82  LDDFDDLFGP--SKPSVTTNTFKGTDQGERDDLDDIMDMFD---------------FTPS 124

Query: 171 TTEKNTSLLEGFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMS 230
            +  N  ++     K   +  ++++N                 + +VDEVKDMEIAKLMS
Sbjct: 125 PSHCNQEVMPS---KTNAEAQSSSKN-----------------EVIVDEVKDMEIAKLMS 164

Query: 231 LGLSIDKAHMYYNKGYLSDDVLRKMQ-AQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPP 289
           LGLSID+A   +  G L D V  + Q AQ+    SN       T I NS    NNS+   
Sbjct: 165 LGLSIDEAIKSFEHGILYDTVASRQQAAQRFSSSSNRR----GTPIANS--GTNNSS--- 215

Query: 290 GNNVLFSIASDFLNKGKGIVDQFSTYHEEDYR 321
           G  +  SI    + K K ++D ++  H+ED R
Sbjct: 216 GGGLFSSI----IGKSKQLIDDWTVNHDEDDR 243

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  273 bits (699), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 217/381 (56%), Gaps = 35/381 (9%)

Query: 461 NVIEGDLLGDFGSNLKNHNESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTA 520
           +VIEGDLLG F           +S  S +   L DF+     ++   Q  S++++  ++ 
Sbjct: 235 SVIEGDLLGGFDE---------LSVSSPQHETLLDFEQ----AVSPPQLRSSSARPPIS- 280

Query: 521 KADEKDLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKH 580
                            IS +ELSG+ EF++ G E F  G+Y SAL EY+KSLNTLP  H
Sbjct: 281 -----------------ISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGH 323

Query: 581 PLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPK 640
           PLR+IS SNI+  QLK+GE S ++++ + AL L  +++ Q T  I  S+P K+Y+E W K
Sbjct: 324 PLRIISLSNIITTQLKLGESSSALQNIETALRLIGEDELQLT--IPASNPPKSYREFWGK 381

Query: 641 IVLRKAEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTS 700
           I +RKAEA EH+E Y  A + Y+ L+ K     K+M GKRRCQKVL+P  P+        
Sbjct: 382 ITMRKAEALEHVENYVSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVAR 441

Query: 701 RIXXXXXXXXXXXXI-NVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDD 759
           +             +   + N+                     D V+ +I+ W+  KE+D
Sbjct: 442 KKPSPNVLDTSSSTLPKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKEND 501

Query: 760 IRYLLSNVHIVLTWSN-WKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIA 818
           +R LL+++  VLTWSN WK +  SDLVMPKKVK+ Y+KA+AKTHPDK++  L +E+KM+A
Sbjct: 502 LRQLLADLPKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLA 561

Query: 819 ESIFSILSVAWEKFKTANKMN 839
           E IFSILS AWE FK  N ++
Sbjct: 562 EDIFSILSKAWEAFKEENNIS 582

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 6/100 (6%)

Query: 216 VVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKH--KRQSNYSTKYDDT 273
           VVDEVKDMEIA+LMSLG+S+++A  YY +G L DDVLR+ + +KH  KRQ+  +++ D T
Sbjct: 75  VVDEVKDMEIARLMSLGVSLERALQYYERGILYDDVLRR-RHEKHEAKRQAAAASR-DFT 132

Query: 274 KI--RNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQ 311
           K+    S + L +  S      LFS+A+   NKGK  +++
Sbjct: 133 KLFDNGSSNILGSDGSDDKQQDLFSMATGLFNKGKSFMEE 172

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  250 bits (638), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 130/323 (40%), Positives = 188/323 (58%), Gaps = 18/323 (5%)

Query: 526 DLVNTLPIVKVPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLI 585
           D V++     + +S +E   Y EF+  GT  F  GDY +A   ++KS+N+LP  HPLR I
Sbjct: 284 DAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAI 343

Query: 586 SYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRK 645
           S SN++  +LK+GEY ++++D  VAL+L   +  +    I  SDP KT+KEIW KIV  K
Sbjct: 344 SLSNMIICRLKLGEYRKAIEDSSVALKLI--SCAKLDDVIPASDPPKTFKEIWCKIVGNK 401

Query: 646 AEACEHMEKYQIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPE-------TPKLKSSAN 698
           AEA EH+E Y  A   YQLL+ +   + K+M G+RRCQK++ PE       TP L +S +
Sbjct: 402 AEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTP-LSTSPS 460

Query: 699 TSR--IXXXXXXXXXXXXINVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNK 756
            SR  +            +   +N+                     D V  ++++W  N 
Sbjct: 461 VSRKDVAVAATSQVPSEKLERVQNI------NKKEKELERQKFLLHDKVQDRVREWCQNS 514

Query: 757 EDDIRYLLSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKM 816
           EDD+R LLS  H+++ W +WK ++ +DLVMPK+VK+ Y+KAV KTHPDKI     +E KM
Sbjct: 515 EDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKM 574

Query: 817 IAESIFSILSVAWEKFKTANKMN 839
           +AE++F ILS AWE FK  NK++
Sbjct: 575 VAENVFVILSKAWELFKEQNKLS 597

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 13/108 (12%)

Query: 203 LSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKR 262
           L  +++D E  Q +VDE+KDMEIA+LMSLGLS  KA  YY +G L DD+L + + Q+ + 
Sbjct: 82  LPQNHMDPE-PQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERKRQQRTRE 140

Query: 263 QSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVD 310
           ++   T  D+ +            S P    L S+AS +LN+G+  +D
Sbjct: 141 EAPQKTS-DEGRF--------TQGSEPD---LLSVASSWLNRGRTFLD 176

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  240 bits (612), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 188/318 (59%), Gaps = 26/318 (8%)

Query: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595
           VPIS IE+SGY EF  NG ++F+ GDY +A  +Y KSLNTLP  HPLR+++YSNI+  QL
Sbjct: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415

Query: 596 KVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           K+GE+++S+K+ + A +L   +       IQ ++P KTYKE W KI+ +KAE  E++E Y
Sbjct: 416 KIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473

Query: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQK-------------VLNP-ETPKLKSSANTSR 701
             A   Y+ L+ K VF+ KI+ GK RCQK              L P +  K+  S N+S 
Sbjct: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSI 533

Query: 702 IXXXXXXXXXXXXINVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIR 761
                        I   + +                     D V++KIQ W + KE D+R
Sbjct: 534 PERRIRSQKAEELIKKRQEM----------KELEKQKFRLHDKVHSKIQSWIDGKETDLR 583

Query: 762 YLLSNVHIVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESI 821
           +LLS + +VLTW+NW  I A+DLV+PKKVK+ YMKA++K HPDK+   L +E+KM+AE I
Sbjct: 584 HLLSRLSLVLTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDI 643

Query: 822 FSILSVAWEKFKTANKMN 839
           FS+L  AW  FK  N +N
Sbjct: 644 FSVLGNAWNVFKLNNDIN 661

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 1  MSDPFANLLSSFKGDTPNSTSASISKNASLDVL 33
          M DPFA LLS+FKG+      +S  +NASL+ +
Sbjct: 1  MGDPFATLLSNFKGEKKELVQSS-PRNASLNAI 32

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  239 bits (609), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 187/304 (61%), Gaps = 10/304 (3%)

Query: 538 ISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKV 597
           IS  EL+ + EF+ NG ++F  GDY +AL E++KS NTLP KHPLR+IS SNI++ QLK+
Sbjct: 325 ISDFELTSFNEFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKL 384

Query: 598 GEYSQSVKDCDVALELFPKND--KQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           GE S++++   +AL+L   +D     +  I+ S P++T+K++  KI L+ AE  EH+E Y
Sbjct: 385 GENSKALESVKLALDL---SDLAPNASDIIEHSVPERTFKQMINKIQLKHAEIQEHLENY 441

Query: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPK-LKSSANTSRIXXXXXXXXXXXX 714
           + A   Y  L+   +   K+M GKRRC+K++NPE  K  K   ++  I            
Sbjct: 442 EKALSLYANLISNGITEQKVMDGKRRCEKIVNPEKFKPAKEKISSPTIPVRSKTSISADT 501

Query: 715 INVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWS 774
           + VN+                       D V+ KI +WT N E+D+RYLL+N+  +L W+
Sbjct: 502 VAVNR----VKEENKKQEEEEEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWA 557

Query: 775 NWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKT 834
           +WK ++  DLVM KKVK+ Y+KA+AKTHPDKI  D S+E  MIAE++++IL+ AWE FK+
Sbjct: 558 SWKEVSPQDLVMTKKVKICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKS 617

Query: 835 ANKM 838
            N +
Sbjct: 618 QNNI 621

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 128/315 (40%), Gaps = 101/315 (32%)

Query: 1   MSDPFANLLSSFKG-DTPNSTSASISKNASL-DVLASQRRAQSDLSSLSAKLTPSLKTNS 58
           MSDPFA+LLSSFKG ++    ++S +KNASL D+L+S     S LS  S    P     S
Sbjct: 1   MSDPFADLLSSFKGVNSSTGNNSSANKNASLNDLLSSHSALTSPLSRKSPSNVP-----S 55

Query: 59  DTQRVLNTTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDFEDLF 118
            T   ++ T                                            D F+DL 
Sbjct: 56  KTPESISITSMTASQ--------------------------------------DFFDDLL 77

Query: 119 GKIDQRQALR---TEKIPSTAPDSMDELDRAMNTFNSNTPSVTKNGSKSNYFPPMTTEKN 175
               Q   LR   ++  PSTA +  D+ D A  +FNS TP V     + +  P       
Sbjct: 78  AAPSQVTPLRESPSQVAPSTATEK-DDFDLAFESFNS-TPHVDLVQPQPDPIP------- 128

Query: 176 TSLLEGFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSI 235
                                               + Q +VDEVKDMEIA+LMSLGLS 
Sbjct: 129 ------------------------------------EPQPLVDEVKDMEIARLMSLGLSF 152

Query: 236 DKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLF 295
           DKA  YY+KG + ++++   + +K  R SN +  +   ++R    +    +SP       
Sbjct: 153 DKAVHYYDKGIMYEELIESQKKRKQSR-SNVNNDFGQQQLRKQESR---DSSP----AFI 204

Query: 296 SIASDFLNKGKGIVD 310
           S+AS+  N GK  ++
Sbjct: 205 SVASNLFNMGKEFIE 219

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  220 bits (561), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 175/309 (56%), Gaps = 9/309 (2%)

Query: 538 ISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKV 597
           ++ +E   + EF+  G   F+ GDY +A   Y+KSLN+LP  HPLR++S+SNI+  +LKV
Sbjct: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376

Query: 598 GEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQI 657
           GEY +++ D   AL+L P+        I + +P KTYKE W KI+  KA A E +E Y+ 
Sbjct: 377 GEYREALSDASSALKLIPQGSM--NSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434

Query: 658 AYDSYQLLLHKNVFNDKIMAGKRRCQKVL----NPETPKLKSSANTSRIXXXXXXXXXXX 713
           A ++YQ L+   V + K++  +R+CQK +     P +   KS  +  +            
Sbjct: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPA 494

Query: 714 XI---NVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIV 770
            +   N ++ +                     D V++ IQ+W    +D++R LL+  H +
Sbjct: 495 KVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTI 554

Query: 771 LTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           + W NWK ++ +DLV+PKK KV Y+KAVAKTHPDKI     ++ KMIAE++F +LS AWE
Sbjct: 555 VDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWE 614

Query: 831 KFKTANKMN 839
            FK  N+++
Sbjct: 615 TFKEKNQLS 623

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 14/124 (11%)

Query: 187 TIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGY 246
             D  N    S +  P  D +L     Q VVDEVKDMEIA+LMSLGL  DKA  YY +G 
Sbjct: 72  AFDMLNGPVASRLAAP--DVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGI 129

Query: 247 LSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGK 306
           L + V+ + + +  + +    T    +++R               + LFS+AS++LNKG+
Sbjct: 130 LYEQVVDRQKRRTARTERPLRTSPQSSQLREE------------ESDLFSVASNWLNKGR 177

Query: 307 GIVD 310
             +D
Sbjct: 178 TFLD 181

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  214 bits (545), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 173/305 (56%), Gaps = 3/305 (0%)

Query: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595
           V I+ +ELSGY +F     E +KKGDY +A  +Y KSLNTLP  HPLR+I+ SNI+  QL
Sbjct: 346 VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQL 405

Query: 596 KVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           K+GE+++S+K+ + A+EL    D  +   IQD+ P +TYKE W KI+ +KAE  E  + Y
Sbjct: 406 KIGEHTESMKNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNY 463

Query: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSAN-TSRIXXXXXXXXXXXX 714
           + A   YQ L+ +      I+ GK RCQK  N +   + S+   T++             
Sbjct: 464 EAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATA 523

Query: 715 INVNKNVXXXXXXXXXXXXXXXXXXXXXDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWS 774
               + V                     D V ++I+ WT  K  D+R+LL  +  +L W 
Sbjct: 524 KGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDLRHLLLGLPALLPWL 583

Query: 775 NWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKT 834
           N   + ASDLVMPK+VK++Y+KAV+KTHPDK+ + L +E KM+AE +F  L+ AW  FK 
Sbjct: 584 NSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKE 643

Query: 835 ANKMN 839
            N ++
Sbjct: 644 ENSLS 648

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 28/129 (21%)

Query: 215 SVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDV-LRKMQ--AQKHKRQSNYSTKYD 271
           ++ DE +D E+AKLMSLGL I  A+ YY++G   + + +R+ +    +  R SN     D
Sbjct: 118 TIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSD 177

Query: 272 DTKIRN-----------------SLDKLNNSASP-------PGNNVLFSIASDFLNKGKG 307
             + R+                  L +  +S +P         +N L S AS+  N+G+ 
Sbjct: 178 FCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRD 237

Query: 308 IV-DQFSTY 315
            + DQ +T+
Sbjct: 238 FIEDQLATH 246

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 1  MSDPFANLLSSFKGDTPNSTSASISKNASLDVLASQRRAQSDLSSLS 47
          MSDPFANLL+ FKG       A  SKN SL+ L     AQ  +SSLS
Sbjct: 1  MSDPFANLLTKFKGKE-KPADAQTSKNRSLNDLL----AQHSVSSLS 42

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 78/169 (46%), Gaps = 13/169 (7%)

Query: 465 GDLLGDFGSN-LKNHNESLVSHGSQESSI-----LFDFDSDSVTSMHIKQNNSATSKNIV 518
           G L+ DF S  +KN   S  S  S   +I      F+F+ D+V      + +  T K I+
Sbjct: 9   GSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFSGKTLKEIL 68

Query: 519 TAKADEKDLVNTLPIVKV--PISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNT 575
           ++ +           VKV  P+   E+    E F+  G +     DY  A+ +Y +++ T
Sbjct: 69  SSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKT 128

Query: 576 LPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWTQF 624
           LP      +I Y+N  AA   V EY  ++KD + A+E+ P   K +++ 
Sbjct: 129 LPT----NVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRL 173

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           +  F+  G ++FK+G+Y SA+  Y+K +   P+ +P   I YSN   A +K  +  ++V+
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEINPE-NP---IGYSNKAMALIKANKNQEAVR 58

Query: 606 DCDVALELFPKND 618
            C   L+   KND
Sbjct: 59  TCQDGLKRVSKND 71

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 5/78 (6%)

Query: 543 LSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQ 602
           +  +   +A G  FFKK DY++A+  Y+K++   P  +P   I YSN     +K+ ++S+
Sbjct: 1   MEDFDTLKAKGNVFFKKCDYETAVLYYQKAITADPS-NP---IGYSNNAMGLIKLEKWSE 56

Query: 603 SVKDCDVALELF-PKNDK 619
           +V  C+  L++  P+NDK
Sbjct: 57  AVDACNKGLKMICPENDK 74

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 10/96 (10%)

Query: 526 DLVNTLPIVKVPISTIELSGYTE------FRANGTEFFKKGDYDSALSEYKKSLNTLPQK 579
           D++N L  ++  I   E   Y +       R +G E+F KGD+ SA+  Y + +   P  
Sbjct: 366 DVLNKLRNLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAP-- 423

Query: 580 HPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFP 615
           H  R   YSN  AA  K+  +  ++KDCD A+E+ P
Sbjct: 424 HDAR--GYSNRAAALSKLMSFPDAIKDCDKAIEIDP 457

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 539 STIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVG 598
           S I+     E R  G EFF KGD+ SA+S Y + +   P+        YSN  A   K+ 
Sbjct: 394 SYIDPEKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPED----ARGYSNRAAVLAKLM 449

Query: 599 EYSQSVKDCDVAL 611
            +  ++KDCDVA+
Sbjct: 450 SFPDAIKDCDVAI 462

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           +F+  G E+ KK DYDSA+  Y K++         + I +SN   A LK   +  +V DC
Sbjct: 14  DFKNKGNEYIKKSDYDSAIEFYSKAIAL----DSTQSIYFSNRALAHLKQDNFYSAVVDC 69

Query: 608 DVALELFPKNDKQW 621
           D AL+L PKN K +
Sbjct: 70  DNALKLDPKNIKAY 83

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 52/109 (47%), Gaps = 26/109 (23%)

Query: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
           T  +  G EFFKK DYD+AL  Y  +L  + +K P   + YSNI A  + +G+  + V++
Sbjct: 102 TALKDRGNEFFKKKDYDNALKYYNYAL--VVKKDP---VFYSNISACYVSLGQLDKVVEN 156

Query: 607 CDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
              ALEL P                      + K +LR+A A E +E Y
Sbjct: 157 STKALELKPD---------------------YSKALLRRASANESLENY 184

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 52/102 (50%), Gaps = 16/102 (15%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           + E++  G  +FK G+Y  A+  YKK +   P+ +P   I YSN   + +K+ +Y+++++
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPE-NP---IGYSNSAMSLIKLTKYTEALE 58

Query: 606 DCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAE 647
            C   L           +++ D+D Q  YK++  +  L   E
Sbjct: 59  SCGTGL-----------KYVNDADSQ-VYKKLQYRYNLADTE 88

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           + E +A G   FK G Y  A+S Y + ++  P  +P   I YSN   A LK   + +++ 
Sbjct: 3   FEELKAKGNISFKNGSYSEAISWYNRCISIDPS-NP---IGYSNKAMALLKADRFDEAIT 58

Query: 606 DCDVALELFPKND 618
            C+  L+L  K D
Sbjct: 59  TCEKGLQLISKED 71

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G  + K+ +Y  A+  Y +++    +  P + I +SN   AQLK+  +   + DCD
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAI----ELDPTQSIFFSNRALAQLKLDNFQSCMNDCD 70

Query: 609 VALELFPKNDKQW 621
           VAL L PKN K +
Sbjct: 71  VALRLDPKNIKAY 83

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F KGD+ +A+  Y      + ++ P     YSN  AA  K+  + +++KDC
Sbjct: 403 EARLQGKEYFTKGDWPNAVKAY----TEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC 458

Query: 608 DVAL 611
           D+A+
Sbjct: 459 DMAI 462

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F KGD+ +A+  Y + +   P+        YSN  AA  K+  + +++KDC
Sbjct: 395 EARLQGKEYFTKGDWPNAVKSYTEMIKRAPED----ARGYSNRAAALSKLMSFPEAIKDC 450

Query: 608 DVAL 611
           +VA+
Sbjct: 451 NVAI 454

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           +  F+  G E FKKG+YD A+ +Y+K ++      P   + YSN+  A LK     ++  
Sbjct: 35  FQHFKDIGNEHFKKGEYDLAIEQYRKCISL----EPTNAVGYSNLAMAYLKNRCPDEAKT 90

Query: 606 DCDVAL 611
            C++ L
Sbjct: 91  ACEMGL 96

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 40.4 bits (93), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 543 LSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQ 602
           +S + + +  G   FK+G Y  A+  Y + +   PQ      + YSN   A +K+GEY+Q
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNP----VGYSNKAMALIKLGEYTQ 56

Query: 603 SVKDCDVAL 611
           +++ C   L
Sbjct: 57  AIQMCQQGL 65

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           + +++  G   FK+G Y  A   Y+K ++  P+ +P   I YSN   A +K+G Y++ V+
Sbjct: 3   FEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPE-NP---IGYSNKAMALIKLGRYTEVVE 58

Query: 606 DCDVALELFP 615
            C   L   P
Sbjct: 59  LCRKGLTFTP 68

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F KGD+ +A+  Y + +   P+        YSN  AA  K+  + +++KDC
Sbjct: 391 EARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDAR----GYSNRAAALSKLMSFPEAIKDC 446

Query: 608 DVALELFP 615
           D A++  P
Sbjct: 447 DNAIKKDP 454

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G EFF KGD+ +A+  Y + +   PQ        +SN  AA  K+  + ++++DC
Sbjct: 382 EARLQGKEFFTKGDWPNAVKAYTEMVKRAPQD----ARGFSNRAAALAKLMSFPEAIEDC 437

Query: 608 DVALELFP 615
           + A+ + P
Sbjct: 438 NKAVSIDP 445

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           + +  G  FFK GDY++A+  Y+K+   L   +P   I +SN+  A +K+  + ++V  C
Sbjct: 43  DLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNAC 98

Query: 608 DVAL 611
           D  L
Sbjct: 99  DKGL 102

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 39.3 bits (90), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 550 RANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDV 609
           +  G E +K+G Y  A+  Y + +   PQ +P   + +SN   A +K+GE++Q+++ C  
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQ-NP---VGHSNKAMALIKLGEHAQAIEACQQ 63

Query: 610 ALEL 613
            L+L
Sbjct: 64  GLQL 67

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+ +A+  Y + +   PQ        YSN  AA  K+  + +++ DC
Sbjct: 384 EARLEGKEYFSKADWPNAVKAYTEMIKRSPQD----ARGYSNRAAALAKLMSFPEAIADC 439

Query: 608 DVALELFP 615
           D A+E  P
Sbjct: 440 DRAIEKDP 447

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
            EF+  G  F K+ +Y  A+  Y K++   P +     I YSN   AQLK+  +  +  D
Sbjct: 13  VEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQS----IFYSNRALAQLKLDNFQSAYND 68

Query: 607 CDVALELFPKNDKQW 621
           C+ AL L  KN K +
Sbjct: 69  CNEALTLDSKNVKAY 83

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 26/109 (23%)

Query: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
           T  +  G EFFK+ DYD+AL  Y  +L    +K P   + YSNI A  + + +  + V++
Sbjct: 107 TALKDKGNEFFKQKDYDNALKYYDYALTL--KKDP---VFYSNISACYVSMNQLDKVVEN 161

Query: 607 CDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
              ALEL P                      + K +LR+A A E +E Y
Sbjct: 162 STKALELKPD---------------------YSKALLRRASANESLENY 189

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 7/94 (7%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F KGD+ +A+  Y + +     + P     YSN  AA  K+  + +++ DC
Sbjct: 391 EARLEGKEYFTKGDWPNAVKAYTEMI----ARDPSDARGYSNRAAALSKLMSFPEAITDC 446

Query: 608 DVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKI 641
           + A+E   K+      +I+ +  Q   K+  P I
Sbjct: 447 NTAIE---KDPNFIRAYIRKATAQIAIKDFVPAI 477

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F KGD+ SA+  Y + +   P+        YSN  AA  K+  +  ++ DC
Sbjct: 387 EARLEGKEYFTKGDWPSAVKAYTEMIKRAPED----ARGYSNRAAALSKLMSFPDAISDC 442

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 443 NKAIEKDP 450

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+ +A+  Y + +   P+        YSN  AA  K+  + +++KDC
Sbjct: 392 EARLEGKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIKDC 447

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 448 EKAIEKDP 455

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+  A+  Y + +    +++P     YSN  AA  K+  ++ +++DC
Sbjct: 391 EARLQGKEYFTKADWPKAVEAYTEMI----KRNPNDARGYSNRAAALSKLMSFADAIRDC 446

Query: 608 DVALELFP 615
           D A+E  P
Sbjct: 447 DKAIEKDP 454

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 28/149 (18%)

Query: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592
           V +P+   E+    E F+  G +     D+  A+ +Y +++  LP       I Y+N  A
Sbjct: 88  VNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILP----TNAIYYANRAA 143

Query: 593 AQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHM 652
           A   + E+ +++KD + A+++ P   K ++                     R A A   +
Sbjct: 144 AHSSLKEFEEAIKDAESAIKIDPSYSKGYS---------------------RLAFAKYGL 182

Query: 653 EKYQIAYDSYQLLLHKNVFNDKIMAGKRR 681
            K++ A +SY+ +L  ++  D   AG +R
Sbjct: 183 GKHEEALESYKKVL--DIEGDNATAGMKR 209

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 60/132 (45%), Gaps = 5/132 (3%)

Query: 494 FDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTIELSGYTE-FRAN 552
           F+FD +SV +   K     + K +V A +           V +P+   E     E  +  
Sbjct: 44  FEFDRESVATTLEKTFAGRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLE 103

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G +     D++ A+ +Y +++  LP       + Y+N  AA   + +Y ++VKD + A++
Sbjct: 104 GNKAMAAKDFEQAVLKYSEAIQVLP----TNAVYYANRAAAHSSLKKYEEAVKDAEDAIK 159

Query: 613 LFPKNDKQWTQF 624
           + P   K +++ 
Sbjct: 160 VNPSYSKGYSRL 171

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 38.1 bits (87), Expect = 0.014,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 543 LSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQ 602
           ++ + + +  G   FK+G Y  A+  Y + +   PQ      + YSN   A +K+GE++Q
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQNP----VGYSNKAMALIKLGEHAQ 60

Query: 603 SVKDCDVALE 612
           +++ C   L+
Sbjct: 61  AIQACQQGLQ 70

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G  F KK D+  A+  Y K++         + I +SN   A LK+  +  S+ DCD AL+
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGL----DSTQSIYFSNRALAHLKLDNFQSSLNDCDEALK 74

Query: 613 LFPKNDKQW 621
           L PKN K +
Sbjct: 75  LDPKNAKAY 83

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G + +K   +  A   Y K ++   Q + +    Y+N  A +L++  Y + + DC 
Sbjct: 84  FKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCK 143

Query: 609 VALELFPKNDKQW 621
            AL+L PKN K +
Sbjct: 144 QALQLNPKNIKCY 156

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G ++F KGD+ +A+  Y + +   P+        YSN  AA  K+  + ++++DC
Sbjct: 392 EARLEGKDYFTKGDWPNAVKAYTEMIKRAPED----ARGYSNRAAALSKLMSFPEAIEDC 447

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 448 NKAIEKDP 455

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
            R+ G + + KG+Y++A+  YK +    P  +P+ L   +N+  A LK+  +  ++  CD
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPS-NPVHL---ANMSMALLKLERWEDALSACD 66

Query: 609 VALELF---PKNDKQWTQFIQ 626
            ALE+    P  D +  Q +Q
Sbjct: 67  RALEIMKKGPVTDDKILQKVQ 87

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 26/125 (20%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E +  G E+FK+ DY++AL  Y  +L  + +K P   + YSN+ A  + + E  + ++  
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 608 DVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLH 667
             ALEL P                      + K +LR+A A E +E Y  A     +L  
Sbjct: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAMFDLSVLSL 203

Query: 668 KNVFN 672
            N FN
Sbjct: 204 NNDFN 208

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F   D+ +A+  Y + +   P+        YSN  AA  K+  +  ++KDC
Sbjct: 390 EARLQGKEYFTNADWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPDAIKDC 445

Query: 608 DVALELFP 615
           D+A++  P
Sbjct: 446 DMAIQKDP 453

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 7/66 (10%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISY-SNILAAQLKVGEYSQSVKD 606
           E +A G E +KK  +D A++ Y+K+ +     H  + I+Y +N  AA+ + G+Y  ++K 
Sbjct: 256 EAKAKGNELYKKRQFDEAIANYEKAWDL----H--KDITYLNNRAAAEYEKGDYESAIKT 309

Query: 607 CDVALE 612
            + A+E
Sbjct: 310 LEKAVE 315

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G E +K   +  A   Y K LN   +   +    ++N  A +L++  Y + ++DC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 609 VALELFPKNDKQW 621
            AL + PKN K +
Sbjct: 146 KALSINPKNTKCY 158

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           EF+  G  F K  ++  A   Y K++    +    + I +SN   A LK+  +  ++ DC
Sbjct: 14  EFKNQGNVFIKGKNFSKAAELYSKAI----ELDGTQSIYFSNRAFAHLKLDNFQTALNDC 69

Query: 608 DVALELFPKNDKQWTQ----FIQDSDPQKTYKEIWPKIVLR 644
           + A+EL PKN K + +    +I   +  K  K++  KIVLR
Sbjct: 70  NKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDL--KIVLR 108

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G E +K   +  A   Y K L    +   +    Y+N  A +L++  Y + ++DC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 609 VALELFPKNDKQW 621
            AL + PKN K +
Sbjct: 146 KALTINPKNVKCY 158

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 538 ISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKV 597
           IS  + +   E++  G +F KK D+  A   Y K++     K     I +SN   A LK 
Sbjct: 4   ISAADSAKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKS----IFFSNRALAHLKQ 59

Query: 598 GEYSQSVKDCDVALELFPKNDKQW 621
             +  S+ DCD ALEL  KN K +
Sbjct: 60  DNFQLSLNDCDKALELDSKNIKAY 83

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+ +A+  Y + +   P+        YSN  AA  K+  + +++ DC
Sbjct: 398 EARLEGKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIADC 453

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 454 NKAIEKDP 461

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+ +A+  Y + +   P+        YSN  AA  K+  + +++ DC
Sbjct: 398 EARLEGKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIADC 453

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 454 NKAIEKDP 461

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G +FF KG +  A+  Y + +     + P    +YSN  AA  K+  + +++ DC
Sbjct: 394 EARIQGKDFFNKGQWPDAVKAYTEMI----ARAPDDARAYSNRAAALSKLMSFPEAISDC 449

Query: 608 DVALELFP 615
           + ALE  P
Sbjct: 450 EKALEKDP 457

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 38.5 bits (88), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+ +A+  Y + +    ++ P     YSN  AA  K+  + +++ DC
Sbjct: 395 EARLEGKEYFTKSDWPNAVKAYTEMI----KRSPEDARGYSNRAAALAKLMSFPEAIADC 450

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 451 NKAIEKDP 458

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSL---NTLPQKHPLRLISYSNILAAQLKVGEYSQSV 604
           EF+  G +  K  DY  A+  Y +++   +T+        I +SN     LK+  +   +
Sbjct: 14  EFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVS-------IYFSNRAMGHLKMDNFQSGI 66

Query: 605 KDCDVALELFPKNDKQW 621
            DCD ALE+ PKN K +
Sbjct: 67  NDCDKALEIDPKNIKAY 83

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 38.1 bits (87), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G ++ K+  Y  A+  Y K++    +    + I +SN   AQLK+  +   + DC+ ALE
Sbjct: 20  GNKYIKEKKYTKAVEYYTKAI----ELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALE 75

Query: 613 LFPKNDKQW 621
           L PKN K +
Sbjct: 76  LDPKNIKAY 84

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 35.4 bits (80), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVAL 611
           G   FK+G Y  A+  Y + +   PQ      + YSN   A +K+ EY+ +++ C   L
Sbjct: 15  GNALFKQGLYREAVDSYDQLITAQPQNP----VGYSNKAMALIKLAEYTHAIQTCQEGL 69

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
           T ++  G +F K+ D+  A   Y K++ T     P + I YSN   A LK+  +  ++ D
Sbjct: 10  TSYKDEGNKFLKQQDFQRANELYTKAIET----DPTQSIFYSNRALANLKLDNFMNALND 65

Query: 607 CDVALELFPKNDKQW 621
           C  A+EL   N K +
Sbjct: 66  CTNAIELNSSNLKAY 80

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592
           + +P    E     E  +  G +     DY+ A+++Y +++  LP       I Y+N  A
Sbjct: 89  INIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAA 144

Query: 593 AQLKVGEYSQSVKDCDVALELFPKNDKQWTQF 624
           A   + EY Q+VKD + A+ + P   + +++ 
Sbjct: 145 AHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G ++F KGD+ +A+  Y + +   P+        YSN  A   K+  + +++ DC
Sbjct: 399 EARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDAR----GYSNRAAVLSKLMSFPEAIDDC 454

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 455 NKAIEKDP 462

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           + + +  G  FF+KGDY  A   Y + +       P   I YSN   + +K G +  +V+
Sbjct: 3   FNDLKQEGNTFFQKGDYAQANGYYDQCIKL----EPTNPIGYSNKAMSLIKQGNHGLAVE 58

Query: 606 DCDVALELFPKNDKQWT 622
            C   L+    + K+ T
Sbjct: 59  TCQEGLKYTSSSTKEAT 75

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G ++F K D+ +A+  Y + +   P+        YSN  AA  K+  + +++ DC
Sbjct: 398 EARLEGKDYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIADC 453

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 454 NKAIEKDP 461

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 16/117 (13%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           EF+  G  F K+  Y  A+  Y K++    +    + I +SN   ++LK+  +  +++DC
Sbjct: 14  EFKNQGNAFIKEKKYPEAVEYYSKAI----ELDDTQSIFFSNRAFSRLKLDNFLTALEDC 69

Query: 608 DVALELFPKNDK-------QWTQFIQDSDPQKTYKEIW-----PKIVLRKAEACEHM 652
           + ++EL PKN K        +   ++ S  +K  K I       +  L+  E CE  
Sbjct: 70  NKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCERF 126

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 26/108 (24%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           + +  G ++FK  DY +A+  Y  +L+    K P   I YSNI A  + +G+  + ++  
Sbjct: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178

Query: 608 DVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
             ALEL P                      + K +LR+A A E +E Y
Sbjct: 179 TKALELNPN---------------------YSKALLRRASANESLENY 205

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 542 ELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYS 601
           E++G   F+  G + +K   +  A   Y K+++       +    Y+N  A +L++  Y 
Sbjct: 72  EIAG--NFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYR 129

Query: 602 QSVKDCDVALELFPKNDKQW 621
           + + DC +AL L PKN K +
Sbjct: 130 RCINDCKMALSLNPKNIKCY 149

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 26/121 (21%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G +FF+   YD A+  Y  +L    ++ P   + YSN+ A  + VG+  + V+    ALE
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672
           L P                      + K++LR+A A E + K+  A     +L     FN
Sbjct: 161 LKPD---------------------YSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFN 199

Query: 673 D 673
           D
Sbjct: 200 D 200

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E R  G E+F K D+ +A+    KS   + ++ P     YSN  AA  K+  +  ++ DC
Sbjct: 387 EARLEGKEYFTKADWPNAV----KSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDC 442

Query: 608 DVALELFP 615
           + A+E  P
Sbjct: 443 NKAIEKDP 450

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G E +K   +  A   Y K +    +   +    ++N  A +L++  Y + V+DC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 609 VALELFPKNDKQW 621
            AL + PKN K +
Sbjct: 146 KALTINPKNIKCY 158

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G E +K   +  A   Y K +    +   +    ++N  A +L++  Y + ++DC 
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 609 VALELFPKNDKQW 621
            AL + PKN K +
Sbjct: 146 KALTINPKNIKCY 158

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G EFFK  D++ A+  Y  +++   ++ P   + YSN  AA + +  + + V+D   AL+
Sbjct: 111 GNEFFKAKDFEKAIEYYTLAISL--KEDP---VFYSNRSAAYVSINNFEKVVEDTTAALK 165

Query: 613 LFPKNDKQWTQ 623
           L P   K W +
Sbjct: 166 LKPDYSKCWLR 176

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 547 TEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
           +E +  G  +FK  DY++A++ YK +L    +  P   + YSN+ A  + +    ++++ 
Sbjct: 87  SELKKRGNAYFKVKDYENAINYYKFALQL--KNDP---VFYSNMAACYISLEHNKEAIEA 141

Query: 607 CDVALELFP 615
           C  ALEL P
Sbjct: 142 CSKALELNP 150

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592
           V +P    E     E  +  G +     D++ A+++Y +++  LP       I Y+N  A
Sbjct: 80  VNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNA----IYYANRAA 135

Query: 593 AQLKVGEYSQSVKDCDVALELFPKNDKQWTQF 624
           A   + +Y ++V D + A+E+ P   K +++ 
Sbjct: 136 AHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRL 167

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 26/121 (21%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G +FFK+  Y+ AL  Y  +L+   ++ P   + YSNI A  + +G   + V+    ALE
Sbjct: 106 GNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESSTKALE 160

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672
           L P                      + K +LR+A A E++E +  A     +L     FN
Sbjct: 161 LKPD---------------------YSKALLRRASANENLENFAEAMFDLSVLSLNGDFN 199

Query: 673 D 673
           +
Sbjct: 200 E 200

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 543 LSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQ 602
           +  + EF+  G   +K+ ++  A++ YKK++       P   + YSN   A +K+  Y+ 
Sbjct: 1   MPSFEEFKIKGNTAYKQNNFTDAVNFYKKAITY----DPTNPVGYSNCAMALIKLNNYAD 56

Query: 603 SVKDCDVAL 611
           + + C   L
Sbjct: 57  ASQMCQRGL 65

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 35.4 bits (80), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E++  G    K  DY  A+ +Y K++    +    + + +SN     LK+  +  + +DC
Sbjct: 11  EYKNEGNACVKVQDYAKAIEKYDKAI----ELDDTQSVYFSNRALCHLKLDNFQCASQDC 66

Query: 608 DVALELFPKNDKQW 621
           D AL L PKN K +
Sbjct: 67  DKALALDPKNVKAY 80

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 59/143 (41%), Gaps = 19/143 (13%)

Query: 504 MHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTIELSGYTE-FRANGTEFFKKGDY 562
           + + QN S +S    T +A+          V +P    E     E  +  G +     D+
Sbjct: 61  VELLQNESGSSSETATTQAESIK-------VNIPAEDAETKAKAETLKLEGNKAMACKDF 113

Query: 563 DSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQWT 622
           D A+ +Y  ++  LP       + Y+N  AA   +  Y +++KD + A++  P   K ++
Sbjct: 114 DLAIKKYSDAIEVLP----TNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYS 169

Query: 623 Q-------FIQDSDPQKTYKEIW 638
           +         Q  D  + YK++ 
Sbjct: 170 RLGYAKFALGQAEDALEAYKKVL 192

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           E +  G +     +Y+ A+ +Y ++++ LP       I Y+N  AA   + EY +++KD 
Sbjct: 104 ELKIQGNKAMANKEYELAIKKYTEAIDVLP----TNAIYYANRAAAHSSLKEYDEAIKDA 159

Query: 608 DVALELFPKNDKQWTQF 624
           + A+ + P   + +++ 
Sbjct: 160 ESAISVDPSYFRGYSRL 176

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 26/103 (25%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G E FK+   + A+  Y+ +L    +K P   + Y+NI A  + + ++ + +++C+ ALE
Sbjct: 113 GNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCNKALE 167

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           L P                      + K++LR+A   E+ME +
Sbjct: 168 LKPD---------------------YSKVLLRRANTYENMENF 189

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%)

Query: 788 KKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           ++V+ +Y K   K HPDK+SKDLS E ++  E  + +++ A++
Sbjct: 129 REVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYK 171

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 52/113 (46%), Gaps = 18/113 (15%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           + +  G +     D+++A+ +Y +++  LP       + Y+N  AA   + +Y +SV+D 
Sbjct: 99  DLKLQGNKAMASKDFETAIKKYTEAIEVLPSNA----VYYANRAAAYSSLKKYEESVQDA 154

Query: 608 DVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYD 660
           + A+++ P   K +++              + K  L K E  E +E Y+   D
Sbjct: 155 ESAIKVNPSYSKGYSRL------------GFAKYALGKPE--EALEAYKTVLD 193

>Kwal_26.8932 s26 (1011029..1012243) [1215 bp, 404 aa] {ON} YOR264W
           (DSE3) - Daughter Specific Expression 3 [contig 68] FULL
          Length = 404

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 18/129 (13%)

Query: 464 EGDLLGDFGSNLKNHNESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATS--------- 514
           EG+LL  F   LK ++ +L      E   L +   ++  S  +KQ+N A +         
Sbjct: 186 EGELL--FEEILKAYSNAL----EDEEPSLVNTQLNNSISRCLKQSNYAHALKQNKKPLV 239

Query: 515 --KNIVTAKADEKDLVNTLPIVKVPISTIE-LSGYTEFRANGTEFFKKGDYDSALSEYKK 571
              N V A  DE+ LV+T  +++VP    E LSG     +  +E F  G+  S L    +
Sbjct: 240 GHSNTVIAGEDEECLVDTSALLEVPAVLEEALSGPEYSNSTSSEPFSSGEEFSELGSIAE 299

Query: 572 SLNTLPQKH 580
           SL   P++H
Sbjct: 300 SLCASPRRH 308

>AGR028C Chr7 complement(766474..768213) [1740 bp, 579 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR060C
           (ORC2)
          Length = 579

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 15/80 (18%)

Query: 111 LDDFEDLFGKIDQRQALRTEK--------IPSTAPDSMDELDRAMNTFNSNTPSVTKNGS 162
            D FE   G IDQ++ +R  K         PS + D    L  A+N F   TP     G 
Sbjct: 202 FDGFE---GYIDQKKPIRAHKKSRNSMAIAPSVSRDEFRLLSGALNGFMHQTPRAVLTGH 258

Query: 163 KSNYFPPMTTEKNTSLLEGF 182
           +   FP    E    +++GF
Sbjct: 259 QQRLFPQYWFE----VMQGF 274

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 62/138 (44%), Gaps = 12/138 (8%)

Query: 494 FDFDSDSVTSMHIKQNNSATSKNIV------TAKADEKDLVNTLPIVKVPISTIELSGYT 547
           F F+ D+ + +  K      S   V       ++++EKD    +  V +P    E     
Sbjct: 44  FGFERDAASGILGKSEFKGKSLADVLNSASKASESNEKDDAQNVE-VNIPEEDAETKAKA 102

Query: 548 E-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
           E  +  G +     DY+ A+++Y +++  LP       I Y+N  AA   + EY ++VKD
Sbjct: 103 EDLKMQGNKAMANKDYELAINKYTEAIQVLP----TNAIYYANRAAAHSSLREYDEAVKD 158

Query: 607 CDVALELFPKNDKQWTQF 624
            + ++ + P   + +++ 
Sbjct: 159 AESSISIDPSYFRGYSRL 176

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 26/103 (25%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G ++FKK D+++AL  Y  +L TL Q  P   + YSNI A  + +G+  + V+    AL+
Sbjct: 112 GNDYFKKQDFENALKYYNYAL-TLKQ-DP---VFYSNISACYVSLGQLEKVVESSTEALK 166

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           L  K+D                   + K +LR+A A E +  Y
Sbjct: 167 L--KHD-------------------YSKALLRRASAYESLANY 188

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G E +K   Y  A   Y K +      + +    +SN  A +L++  Y + V DC 
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 609 VALELFPKNDKQW 621
            AL+  P N K +
Sbjct: 141 QALQFNPTNIKCF 153

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 546 YTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVK 605
           + E +  G   FK GDY +A   Y   +     + P   I YSN   + +K   + Q+++
Sbjct: 3   FEENKTEGNRLFKLGDYTAANKFYDLCI----MEEPTNPIGYSNKAMSLIKQEHFDQAIR 58

Query: 606 DCDVAL 611
            C+  L
Sbjct: 59  TCNTGL 64

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G  F K+  +  A+ +Y ++++        + I +SN   A  KV  +  ++ DCD AL+
Sbjct: 19  GNVFIKEKHFLKAIEKYTQAIDL----DSTQSIYFSNRAFAHFKVDNFQSALNDCDEALK 74

Query: 613 LFPKNDKQW 621
           L PKN K +
Sbjct: 75  LDPKNIKAY 83

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 63/138 (45%), Gaps = 11/138 (7%)

Query: 494 FDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPISTI------ELSGYT 547
           F+F+ D V S    +    +   ++ A  + K   ++   +KV IS        EL+   
Sbjct: 44  FEFEKDDVKSTLASKFGGKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKA 103

Query: 548 E-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKD 606
           E  +  G +     DY+ A+ +Y  ++  +P K     + Y+N  AA     +Y +++KD
Sbjct: 104 EALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKA----VYYANRAAAYSSQEKYDEAIKD 159

Query: 607 CDVALELFPKNDKQWTQF 624
            + A+++ P   K +++ 
Sbjct: 160 AESAIKVEPNWSKGYSRL 177

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 542 ELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYS 601
           E++G   F+  G EF+K   Y  A   Y K ++       +    Y+N  A +L++  + 
Sbjct: 72  EIAG--NFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFR 129

Query: 602 QSVKDCDVALELFPKNDKQW 621
           + ++DC  AL    KN K +
Sbjct: 130 KCIEDCKKALSFNVKNIKCY 149

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 50/121 (41%), Gaps = 26/121 (21%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G +FF+   YD A+  Y  +L    +  P   + YSN+ A  + VG+  + V+    ALE
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALEL--KDDP---VFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672
           L P                      + K++LR+A A E +  +  A     +L     FN
Sbjct: 161 LKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199

Query: 673 D 673
           D
Sbjct: 200 D 200

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 562 YDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQW 621
           +D A+ +Y  ++       P   + YSN  AA   + +Y Q+VKD + A+E+ P   K +
Sbjct: 111 FDEAIEKYTAAIEV----SPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGF 166

Query: 622 TQF 624
           ++ 
Sbjct: 167 SRL 169

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 28/43 (65%)

Query: 788 KKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           ++++  Y K   K HPDK+SKDLS + + + E  + +++ A++
Sbjct: 129 REIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYK 171

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G + F    +  A   Y K +    +   +    ++N  A QL++  Y   + DC 
Sbjct: 83  FKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCK 142

Query: 609 VALELFPKNDKQW 621
            AL L PKN K +
Sbjct: 143 HALTLNPKNIKCY 155

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 778 AINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           ++ ASD    K++K  Y K   K HPDK++KD++ E K   E ++  +S A+E
Sbjct: 128 SVTASD----KEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYE 176

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592
           V +P    E+    E  +  G +     DY+ A+++Y +++  LP       I Y+N  A
Sbjct: 89  VNIPEEDAEIKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLP----TNAIYYANRAA 144

Query: 593 AQLKVGEYSQSVKDCDVALELFP 615
           A   +  Y ++V+D + A+ + P
Sbjct: 145 AHSSLKGYDEAVEDAESAISIDP 167

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 542 ELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYS 601
           E++G   F+  G + +K   +  A   Y K +        +    Y+N  A +L++  Y 
Sbjct: 76  EIAG--NFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYR 133

Query: 602 QSVKDCDVALELFPKNDKQW 621
           + + DC  AL+  PKN K +
Sbjct: 134 RCLNDCKTALQYNPKNLKCY 153

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 788 KKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           + +K  Y K   K HPDK+SKDL  E +   E ++  +S A+E
Sbjct: 137 RDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYE 179

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 26/103 (25%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G EFFK+  +D A+  Y  +L    +K P   + YSN  A  + +G+  + V+D   AL+
Sbjct: 109 GNEFFKEKKFDDAIKYYNLALEL--KKDP---VFYSNRSACYVSMGQLEKVVEDTTAALK 163

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           L                     K  + K +LR+A A E +  Y
Sbjct: 164 L---------------------KSDYSKCLLRRASANESLGNY 185

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 26/103 (25%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G   FK   ++ A+  Y  ++    +++P   I YSN+ A  + + +  + +K C+ ALE
Sbjct: 118 GNSLFKADKFEEAIKYYNWAIEL--KENP---IFYSNLSACYVSLNKLEEIIKYCNKALE 172

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           L P                      + K++LR+A A E +E Y
Sbjct: 173 LKPD---------------------YSKVLLRRANANEKLENY 194

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G  F K+  +  A+ +Y ++++        + I +SN   A  KV  +  ++ DCD A++
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDL----DATQSIYFSNRAFAHFKVDNFQSALNDCDEAIK 74

Query: 613 LFPKNDKQW 621
           L PKN K +
Sbjct: 75  LDPKNIKAY 83

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 548 EFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDC 607
           EF+  G  + K+  Y  A+  Y K++    +    + I +SN   ++L++  +  + +DC
Sbjct: 12  EFKNQGNAYVKEKKYQEAVEYYSKAI----ELDDTQSIYFSNRAFSRLRLDNFLTAQEDC 67

Query: 608 DVALELFPKNDK 619
           D A+ L PKN K
Sbjct: 68  DKAIALDPKNIK 79

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 788 KKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           ++++  Y K   K HPDK+SKDLS   + I E  + +++ A++
Sbjct: 131 REIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYK 173

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
            +  G +     DY+SA+ +Y +++  L    P   + Y+N  AA   + +Y  +V D +
Sbjct: 96  LKLEGNKAMATKDYESAIKKYSEAIEVL----PTNAVYYANRAAAYSSLKKYDDAVNDAE 151

Query: 609 VALELFPKNDKQWTQF 624
            A+++ P   K +++ 
Sbjct: 152 SAIKVNPTYSKGYSRL 167

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G  F K+  +  A+ +Y ++++        + I +SN   A  KV  +  ++ DCD A++
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDL----DSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIK 74

Query: 613 LFPKNDKQW 621
           L PKN K +
Sbjct: 75  LDPKNIKAY 83

>Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032W
           (REAL)
          Length = 393

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 14/85 (16%)

Query: 543 LSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHP--------------LRLISYS 588
           L   T  + +GT  FKK DY +A  +Y+KSLN + +  P              L++  Y 
Sbjct: 237 LEAATIIKDSGTLLFKKNDYSNAFFKYRKSLNYINEYTPEPDVDKERNYQFTSLKMKVYL 296

Query: 589 NILAAQLKVGEYSQSVKDCDVALEL 613
           N+      V +Y  S+      LE+
Sbjct: 297 NLSLVLFNVEKYDDSITYATYLLEM 321

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 794 YMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           Y K   K HPDK+SKDLS + +++ E  +  ++ A+E
Sbjct: 142 YRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYE 178

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 534 VKVPISTIELSGYTE-FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILA 592
           V +P    EL    E  +  G +     DY+ A+ +Y ++++ +P       + Y+N  A
Sbjct: 80  VNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVP----TNAVYYANRAA 135

Query: 593 AQLKVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEI-WPKIVLRKAEACEH 651
           A   +  Y +++KD + A+++             DS   K Y  + + K    K+E  E 
Sbjct: 136 AHSSLKNYDEAIKDAESAVKV-------------DSSYSKGYSRLGYAKFAQGKSE--EA 180

Query: 652 MEKYQIAYD 660
           +E Y+   D
Sbjct: 181 LEAYKKVLD 189

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 788 KKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           + +K  Y K   K HPDK+SKDLS + +   E ++  ++ A+E
Sbjct: 143 RDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYE 185

>Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032W
           (REAL)
          Length = 394

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 550 RANGTEFFKKGDYDSALSEYKKSLNTLPQKHP 581
           + +GT  FKK DY +AL +Y+KSLN + +  P
Sbjct: 245 KESGTLLFKKKDYSNALFKYRKSLNYINEYMP 276

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G       DY  A+  Y  ++     K+P   I YSN   A LKV +Y  ++ D +
Sbjct: 140 FKDEGNRLMFSEDYKKAIECYTNAI----SKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195

Query: 609 VALEL 613
             + +
Sbjct: 196 FCISI 200

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 778 AINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           +++ASD    + +K  Y K   K HPDK+SKDLS E +   E  +  ++ A+E
Sbjct: 129 SVSASD----RDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYE 177

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 66/133 (49%), Gaps = 6/133 (4%)

Query: 494 FDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPI-VKVPISTIELSGYTE-FRA 551
           F+ + +S +S+  K     + + IV A +         P+ V +P+   E+    E  + 
Sbjct: 44  FEVEKESASSVIEKSFGGQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKL 103

Query: 552 NGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVAL 611
            G +     D++ A+S+Y +++ TLP       + ++N  AA   + +Y+++V+D + A+
Sbjct: 104 EGNKAMATKDFEHAISKYSEAIRTLPSNA----VYFANRAAAYSSLKKYAEAVEDAEAAI 159

Query: 612 ELFPKNDKQWTQF 624
           ++ P   K +++ 
Sbjct: 160 KVNPSYSKGYSRL 172

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 26/121 (21%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G ++F+   YD A+  Y  +L    ++ P   + YSN+ A  + VG+  + V+    ALE
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALEL--KEDP---VFYSNLSACYVSVGDLKKVVEMSTKALE 160

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYDSYQLLLHKNVFN 672
           L P                      + K++LR+A A E +  +  A     +L     FN
Sbjct: 161 LKPD---------------------YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFN 199

Query: 673 D 673
           D
Sbjct: 200 D 200

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 543 LSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHP--------------LRLISYS 588
           L   +  + +GT  FKK DY++A  +Y+KSLN + +  P              L++  Y 
Sbjct: 237 LKAASTIKESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYL 296

Query: 589 NILAAQLKVGEYSQSVKDCDVALEL 613
           N+  A   +  Y  ++      LE+
Sbjct: 297 NLSLALFNLERYDSAITYATYLLEM 321

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 162 SKSNYFPPMTTEKNTSLLEGFDDKPTIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVK 221
           S S  F  +T E  T L+E F   PTI   N T N  I +PL  D  D   QQ +  E  
Sbjct: 170 SLSKVFTTLTDEDVTVLMEEFTFTPTIS--NVTANGGIPIPLKVDITDDASQQGINVEYM 227

Query: 222 D 222
           D
Sbjct: 228 D 228

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 13/65 (20%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHP-------------LRLISYSNILAAQLKVGE 599
           GT  FK   +  AL++Y+KS + L Q  P             LR+  + NI    +K G+
Sbjct: 225 GTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIKTGD 284

Query: 600 YSQSV 604
           Y +++
Sbjct: 285 YQKAL 289

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G EFFK   YD A+  Y  ++    ++ P   + YSN  A  + +G+  + V+D   AL+
Sbjct: 102 GNEFFKNKKYDEAIQYYSWAIEV--KEDP---VFYSNRSACYVSLGQQEKVVEDTTAALK 156

Query: 613 LFP 615
           L P
Sbjct: 157 LKP 159

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 26/103 (25%)

Query: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612
           G EFFK   ++ AL  Y  SL    ++ P   + YSN  A  + +G+  + V+D   AL+
Sbjct: 103 GNEFFKNKQFEDALKYY--SLAIEVKEDP---VFYSNRSACYVSLGQQEKVVEDTTAALK 157

Query: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655
           L P                      + K +LR+A A E + K+
Sbjct: 158 LKPD---------------------YSKCLLRRASANESLGKF 179

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%)

Query: 788 KKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           K +K  Y +   K HPDK+SK+LS E +   E ++  +S A E
Sbjct: 139 KDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHE 181

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 31/73 (42%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G + +K   +  A   Y K +        +    Y+N  A QL++  +   + DC 
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 609 VALELFPKNDKQW 621
            AL   PKN K +
Sbjct: 141 TALTYNPKNIKCY 153

>TBLA0D04690 Chr4 complement(1162517..1163920) [1404 bp, 467 aa]
           {ON} Anc_7.203 YIL023C
          Length = 467

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 17/20 (85%)

Query: 342 SPDTTPISVYENDHAPLTEY 361
           SPD TP+S++ + HAP+T++
Sbjct: 152 SPDGTPVSLHSHSHAPITQF 171

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 11/85 (12%)

Query: 561 DYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQ 620
           DY+ A+ +Y +++ TL    P   + ++N  AA   + +Y ++V+D + A+++ P   K 
Sbjct: 115 DYELAIKKYTEAIATL----PTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKG 170

Query: 621 WTQ-----FIQD--SDPQKTYKEIW 638
           +++     F Q    D  + YK++ 
Sbjct: 171 YSRLGFAKFAQGKAEDALEAYKKVL 195

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 778 AINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830
           A +A+D    K+V+  Y K   K HPDK++KDL+ E +   E  + +++ A++
Sbjct: 124 ATSATD----KEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYK 172

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%)

Query: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608
           F+  G + +K   +  A   Y K +        +  +   N  A +L++  Y + + DC 
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 609 VALELFPKNDKQW 621
            AL+L PKN K +
Sbjct: 140 EALKLNPKNPKAF 152

>YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}
           CPR7Peptidyl-prolyl cis-trans isomerase (cyclophilin),
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues; binds to Hsp82p and
           contributes to chaperone activity
          Length = 393

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 550 RANGTEFFKKGDYDSALSEYKKSLNTLPQKHP 581
           + +GT  FKK DY +A  +Y+KSLN + +  P
Sbjct: 244 KESGTLLFKKKDYSNAFFKYRKSLNYINEYMP 275

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,128,977
Number of extensions: 3884792
Number of successful extensions: 15447
Number of sequences better than 10.0: 262
Number of HSP's gapped: 16115
Number of HSP's successfully gapped: 309
Length of query: 840
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 722
Effective length of database: 39,950,811
Effective search space: 28844485542
Effective search space used: 28844485542
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)