Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0H014608.258ON44244223200.0
Smik_12.1448.258ON43844715910.0
YLR085C (ARP6)8.258ON43844515810.0
Suva_10.1698.258ON43844615690.0
Skud_12.1538.258ON43844815660.0
NCAS0B049908.258ON42044215630.0
NDAI0B019608.258ON43944915550.0
KAFR0B027008.258ON42044415490.0
Kpol_543.368.258ON42744415460.0
ZYRO0C01738g8.258ON41444215430.0
TDEL0F038508.258ON41944315110.0
KNAG0G020108.258ON42444314790.0
KLTH0G13772g8.258ON42044214650.0
CAGL0L12166g8.258ON42144014530.0
SAKL0H17138g8.258ON41944314500.0
Ecym_43128.258ON41143914130.0
TPHA0A018308.258ON42144614060.0
Kwal_56.238328.258ON41944214040.0
AGR091W8.258ON41043913780.0
KLLA0F19063g8.258ON41544513730.0
NCAS0C037008.23ON3754382543e-23
SAKL0B00968g8.23ON3754382543e-23
TBLA0C004408.23ON3754382533e-23
ABR222W8.23ON3764382533e-23
Ecym_15208.23ON3764382534e-23
NDAI0G030408.23ON3754382524e-23
TDEL0C004708.23ON3754382525e-23
CAGL0K12694g8.23ON3754382525e-23
Suva_6.188.23ON3754382525e-23
Smik_6.398.23ON3754382525e-23
YFL039C (ACT1)8.23ON3754382525e-23
KLLA0D05357g8.23ON3754382526e-23
ZYRO0F02772g8.23ON3754382526e-23
TPHA0D002508.23ON3754382516e-23
KNAG0L002508.23ON3754382516e-23
KAFR0D009408.23ON3754382516e-23
KLTH0G18832g8.23ON3754382491e-22
Kpol_1058.158.23ON3754382482e-22
SAKL0E11814g2.117ON3794462384e-21
Ecym_63852.117ON3774462359e-21
Skud_6.318.23ON3603922313e-20
AFR051W2.117ON4054372323e-20
Kwal_14.11098.23ON3603922286e-20
KLLA0E22925g2.117ON3804482216e-19
ZYRO0G05676g2.117ON3814362146e-18
KLTH0F06490g3.161ON3914002083e-17
KLTH0B05940g2.117ON3834482031e-16
NDAI0G029003.161ON3913982012e-16
TDEL0D046103.161ON3914002004e-16
NCAS0B071302.117ON3814382004e-16
TPHA0I013002.117ON3794361995e-16
Kwal_33.146422.117ON3834451986e-16
TBLA0F008703.161ON3914101971e-15
SAKL0C07370g3.161ON3913981961e-15
TDEL0B048102.117ON3734371951e-15
ZYRO0B04928g3.161ON3913981951e-15
Kwal_33.141773.161ON3373321922e-15
CAGL0K01595g3.161ON3914041942e-15
KLLA0C03850g3.161ON3914001933e-15
Skud_4.2223.161ON3913931933e-15
TPHA0A009203.161ON3914001933e-15
Kpol_1023.188.23ON3193531904e-15
Ecym_52373.161ON3913991898e-15
KAFR0C01040na 1ON3373321861e-14
KNAG0H036502.117ON3874381862e-14
NCAS0C035503.161ON3923991862e-14
KAFR0F005902.117ON3864391862e-14
ADR316W3.161ON3914011836e-14
Suva_4.2203.161ON3913911827e-14
NDAI0B044602.117ON3814381827e-14
Smik_4.2063.161ON3913931792e-13
YDL029W (ARP2)3.161ON3913931782e-13
KNAG0K01130na 1ON3934011747e-13
Kpol_479.253.161ON3914011738e-13
KAFR0D037001.514ON4494481613e-11
Smik_8.2102.117ON3843921603e-11
TBLA0B010702.117ON3834381604e-11
Kpol_1056.161.514ON4604141605e-11
ADL253C2.248ON7511351606e-11
YHR129C (ARP1)2.117ON3843921552e-10
SAKL0E08602g2.248ON7471371562e-10
Skud_8.1902.117ON3843921533e-10
SAKL0D12804g1.514ON4564481533e-10
CAGL0H09042g2.117ON3873901523e-10
YNL059C (ARP5)2.248ON7551331544e-10
KNAG0I018602.248ON7531381534e-10
Suva_15.3262.117ON3843891516e-10
TPHA0O010401.514ON4582541516e-10
Kwal_23.48482.248ON7451341527e-10
TPHA0C031602.248ON7551321518e-10
TBLA0D036801.514ON4584611508e-10
Ecym_32852.248ON7461401518e-10
CAGL0F00517g1.514ON4544201499e-10
Kpol_1003.162.248ON7491321482e-09
NDAI0D010602.248ON7531411473e-09
KLTH0G09482g2.248ON7451351473e-09
KNAG0B001701.514ON4534181453e-09
KLLA0B13904g1.514ON4564111453e-09
TBLA0E038602.248ON7591441464e-09
AFR419C1.514ON4554121444e-09
TDEL0F004701.514ON4612601436e-09
NDAI0A039701.514ON4624141436e-09
ZYRO0G01936g1.514ON4612521401e-08
Smik_10.3551.514ON4494141401e-08
KLTH0C02508g1.514ON4514491392e-08
NCAS0A122701.514ON4544161392e-08
YJR065C (ARP3)1.514ON4494141392e-08
Skud_10.2891.514ON4494131382e-08
TDEL0C041402.248ON7491371392e-08
Suva_12.1541.514ON4494141382e-08
Suva_14.2812.248ON7551331383e-08
KLLA0F03421g2.248ON7471331383e-08
Skud_14.2722.248ON7551371384e-08
Ecym_31531.514ON4582551347e-08
Kwal_27.99581.514ON4453481331e-07
ZYRO0A01584g2.248ON7481351331e-07
Smik_14.2672.248ON7551331331e-07
CAGL0J10054g2.248ON7541351242e-06
Kpol_282.41.287ON5011071133e-05
SAKL0F13772g7.448ON4223021114e-05
KAFR0J011602.248ON7511331091e-04
KLLA0D02288g1.287ON5201051062e-04
CAGL0M03201g1.287ON4931451053e-04
AFR105C1.287ON4791051000.001
ZYRO0G21428g1.287ON483109990.001
NDAI0G055801.287ON515162980.002
TDEL0D015501.287ON48093980.002
KLTH0H09702g1.287ON48191960.003
NCAS0G030502.248ON743121970.003
TPHA0I010301.287ON503106950.004
YJL081C (ARP4)1.287ON48989940.005
ACR184C7.448ON40185940.005
Skud_10.1321.287ON48893910.012
KAFR0A015601.287ON485117910.015
NCAS0B060601.287ON49793890.024
SAKL0D05874g1.287ON497105880.030
Smik_10.1611.287ON48989880.034
Kwal_14.23771.287ON481114870.035
Ecym_63301.287ON480105870.036
Suva_6.1541.287ON489109870.038
KNAG0B019201.287ON505258850.075
TBLA0D053601.287ON596165820.19
TDEL0C031207.448ON438159780.53
Kwal_47.180068.50ON61842760.90
SAKL0A08162g6.71ON81728760.95
SAKL0G09966g5.314ON34388741.5
KLTH0C05324g7.448ON399260731.7
KAFR0D010308.50ON73095731.9
ZYRO0C12078g1.149ON775101722.5
KAFR0D045105.314ON362104712.8
KLLA0E06975g7.418ON2761117723.2
TPHA0P006807.390ON72761713.7
TDEL0E031305.314ON32461704.2
Suva_4.1422.343ON407141704.5
TPHA0E013505.314ON32188678.4
Kpol_1036.153.124ON303074689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0H01460
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   898   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   617   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   613   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   608   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   607   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   606   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   603   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   601   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   600   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   598   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   586   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   574   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   568   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   564   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   563   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   548   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   546   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   545   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   535   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   533   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   102   3e-23
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   102   3e-23
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   102   3e-23
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   102   3e-23
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   102   4e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   101   4e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   101   5e-23
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   101   5e-23
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   101   5e-23
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   101   5e-23
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   101   5e-23
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   101   6e-23
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   101   6e-23
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   101   6e-23
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   101   6e-23
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   101   6e-23
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   100   1e-22
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   100   2e-22
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    96   4e-21
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    95   9e-21
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    94   3e-20
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    94   3e-20
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    92   6e-20
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    90   6e-19
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    87   6e-18
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    85   3e-17
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    83   1e-16
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    82   2e-16
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    82   4e-16
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    82   4e-16
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    81   5e-16
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    81   6e-16
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    80   1e-15
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    80   1e-15
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    80   1e-15
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    80   1e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    79   2e-15
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    79   2e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    79   3e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    79   3e-15
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    79   3e-15
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    78   4e-15
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    77   8e-15
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    76   1e-14
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    76   2e-14
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    76   2e-14
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    76   2e-14
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    75   6e-14
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    75   7e-14
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    75   7e-14
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    74   2e-13
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    73   2e-13
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    72   7e-13
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    71   8e-13
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    67   3e-11
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    66   3e-11
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    66   4e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    66   5e-11
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    66   6e-11
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    64   2e-10
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    65   2e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    64   3e-10
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    64   3e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    63   3e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    64   4e-10
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    64   4e-10
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    63   6e-10
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    63   6e-10
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    63   7e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    63   8e-10
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    62   8e-10
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    63   8e-10
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    62   9e-10
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    62   2e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    61   3e-09
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    61   3e-09
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    60   3e-09
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    60   3e-09
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    61   4e-09
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    60   4e-09
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    60   6e-09
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     60   6e-09
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    59   1e-08
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    59   1e-08
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    58   2e-08
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    58   2e-08
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    58   2e-08
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    58   2e-08
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    58   2e-08
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    58   2e-08
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    58   3e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    58   3e-08
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    58   4e-08
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    56   7e-08
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    56   1e-07
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    56   1e-07
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    56   1e-07
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    52   2e-06
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    48   3e-05
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    47   4e-05
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    47   1e-04
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    45   2e-04
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    45   3e-04
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    43   0.001
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    43   0.001
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    42   0.002
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    42   0.002
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    42   0.003
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    42   0.003
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    41   0.004
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    41   0.005
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    41   0.005
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    40   0.012
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    40   0.015
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    39   0.024
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    39   0.030
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    39   0.034
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    38   0.035
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    38   0.036
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    38   0.038
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    37   0.075
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    36   0.19 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    35   0.53 
Kwal_47.18006 s47 complement(643091..644947) [1857 bp, 618 aa] {...    34   0.90 
SAKL0A08162g Chr1 complement(721932..724385) [2454 bp, 817 aa] {...    34   0.95 
SAKL0G09966g Chr7 complement(846059..847090) [1032 bp, 343 aa] {...    33   1.5  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    33   1.7  
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    33   1.9  
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    32   2.5  
KAFR0D04510 Chr4 (890844..891932) [1089 bp, 362 aa] {ON} Anc_5.3...    32   2.8  
KLLA0E06975g Chr5 complement(631154..639439) [8286 bp, 2761 aa] ...    32   3.2  
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    32   3.7  
TDEL0E03130 Chr5 complement(589523..590497) [975 bp, 324 aa] {ON...    32   4.2  
Suva_4.142 Chr4 complement(262137..263360) [1224 bp, 407 aa] {ON...    32   4.5  
TPHA0E01350 Chr5 complement(271085..272050) [966 bp, 321 aa] {ON...    30   8.4  
Kpol_1036.15 s1036 complement(31585..40677) [9093 bp, 3030 aa] {...    31   9.7  

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/442 (98%), Positives = 436/442 (98%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEYNYGSIYKSPVAGFIPFADLTKDVISISGKA      NNAKFQEQLVTNDLNTYISSE
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
           EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI
Sbjct: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420
           GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR
Sbjct: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420

Query: 421 EEYMEHGVEWCTKHRFGYQNWI 442
           EEYMEHGVEWCTKHRFGYQNWI
Sbjct: 421 EEYMEHGVEWCTKHRFGYQNWI 442

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/447 (64%), Positives = 354/447 (79%), Gaps = 14/447 (3%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PIVIDNGSYEIKFG S +  PFRA+NA+AKDK+ T YLSN IK IKDISSV FRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLT WELES IWDYCF+NP EFDGF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVI-SISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           EEY + S++KSPVA F+PF    K  + +ISGK             + +V+      + S
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDA---------DIVVSKSNEADMPS 171

Query: 180 EEPSVTKT--AEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETL 237
             P  T+   ++Y DFQL+IDSGFNCTWIIPV+KGIPYYKA+KK+D+GGRFLTGLLKETL
Sbjct: 172 NNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231

Query: 238 SFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNS 297
           SFRHYN+ DETILVNNIKEKCLFV+P SY +SFK+K+K A+EYVLPDF T+F+GY+++  
Sbjct: 232 SFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRR 291

Query: 298 K--TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVN 355
           K  + L ++AQ ITL DELF++ ET FHPEI++I KPGI+E I+ESLSMLPE++RPLMV 
Sbjct: 292 KENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVG 351

Query: 356 NIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRK 415
           NIVC GGNFNLPNF++RL +ELQRQLPTDWT HV +P+ D  LFGW+ M+QFS T SYR 
Sbjct: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRN 411

Query: 416 ARITREEYMEHGVEWCTKHRFGYQNWI 442
           AR+TREEY EHG +WCTKHRFGYQNWI
Sbjct: 412 ARVTREEYYEHGSDWCTKHRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/445 (64%), Positives = 352/445 (79%), Gaps = 10/445 (2%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PIVIDNGSYEIKFG S ++ PFRA+NA+AKDK+ T YLSN IK IKDISS+ FRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLT WELES IWDYC +NP EFDGF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTK-DVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           EEY + S++KSPVA F+PF    K ++ +ISGK                 +++      S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239
                   ++Y DFQL+IDSGFNCTWIIPV+KGIPYYKA+KK+DIGGRFLTGLLKETLSF
Sbjct: 181 -------GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233

Query: 240 RHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK- 298
           RHYN+ DETILVNNIKE+CLFV+P SY +SFK K+K A+EYVLPDF T+F+GY+++  K 
Sbjct: 234 RHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKE 293

Query: 299 -TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNI 357
              LP++AQ+ITL DELF++ ET FHPEIS+I KPGI+E I+ESLSMLPE++RPLMV NI
Sbjct: 294 NVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNI 353

Query: 358 VCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKAR 417
           VC GGNFNLPNF++RL +ELQRQLPTDWT HV +P+ D  LFGW+ M+QF+ TDSYRKAR
Sbjct: 354 VCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKAR 413

Query: 418 ITREEYMEHGVEWCTKHRFGYQNWI 442
           +TREEY EHG +WCTKHRFGYQNWI
Sbjct: 414 VTREEYYEHGPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/446 (64%), Positives = 354/446 (79%), Gaps = 12/446 (2%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PIVIDNGSYEIKFG S +++PFRA+NA+AKDK+ T YLSN IK IKDISSV FRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLT WELES IWDYC +NP EFDGF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVI-SISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           EEY + S++KSPVA F+PF    K  + +ISGK        +      +  +D  T+ S 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGK--------DEDADVAISDSDDKTFTSK 172

Query: 180 EEPSVTKTA-EYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238
           E    T +  +Y DFQL+IDSGF+CTWIIPV+KGIPYYKA+KK+DIGGRFLTGLLKETLS
Sbjct: 173 EPVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232

Query: 239 FRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIK--DN 296
           FRHYN+ DETILVNNIKEKCLFV+P SY +SFK KNK  +EYVLPDF T+F+GY++  + 
Sbjct: 233 FRHYNMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNE 292

Query: 297 SKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNN 356
             + LP +AQ ITL DELF++ ET FHPEIS+I+KPGI+E I+ESLSMLPE++RPLM+ N
Sbjct: 293 EDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGN 352

Query: 357 IVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKA 416
           IVC GGNFNLPNF++RL  ELQRQLPTDWT +V +P+ D  LFGW+ M+QF+ T+SY++A
Sbjct: 353 IVCTGGNFNLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRA 412

Query: 417 RITREEYMEHGVEWCTKHRFGYQNWI 442
           R+TREEY EHG +WCTKHRFGYQNWI
Sbjct: 413 RVTREEYYEHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/448 (63%), Positives = 355/448 (79%), Gaps = 16/448 (3%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PIVIDNGSYEIKF  S + +PFRA+NA+AKDK+ T YLSN IK IKDISS+ FRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLT WELES IWDYCF+NP EF GF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVI-SISGKAXXXXXXNNAKFQEQLVTND--LNTYI 177
           EEY + S++KSPVA F+PF    K  + +ISGK            +  +VT++  + T+ 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDE----------EADVVTSNSGITTFT 170

Query: 178 SSEEPSVTKT-AEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKET 236
           S E  S   + ++Y DFQL+IDSGFNCTWIIPV+KGIPYYKA+KK+DIGGRFLTGLLKET
Sbjct: 171 SRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230

Query: 237 LSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKD- 295
           LSFRHYN+ DETILVNN+KEKCLFV+P SY +SFK K+K A+EYVLPDF T+F+GY+++ 
Sbjct: 231 LSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290

Query: 296 -NSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMV 354
               + LP++AQ I L DELF++ ET FHPEIS+I KPGI+E I+ESLSMLPE++RPLMV
Sbjct: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350

Query: 355 NNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYR 414
            NIVC GGNFNLPNF++RL +ELQRQLPTDWT HV +P  D  LFGW+ M+QF+ T+SYR
Sbjct: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYR 410

Query: 415 KARITREEYMEHGVEWCTKHRFGYQNWI 442
           +AR+TR+EY EHG +WCTK RFGYQNWI
Sbjct: 411 RARVTRDEYYEHGPDWCTKQRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/442 (65%), Positives = 347/442 (78%), Gaps = 22/442 (4%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PI IDNGSYEIKFG ++   P+RAINA A DKY+T YLSNQIK IKDI+SV FRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLTSWELES+IWDY  +NP+EF GF L D   KHL+ SETC++LPE S+N+D ++F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY + S YKS +AGFI FAD  K+   ISGK            +E +  + +N      
Sbjct: 121 EEYEFDSYYKSSIAGFIQFAD-DKNTKIISGKT-----------EEDISLDSVNQ----- 163

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
                +  EY D+QL+IDSGFNCTWIIPVIKG+PYYKA+KK+DIGGRFL GLLKETLSFR
Sbjct: 164 ----VREKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFR 219

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HY+V DETILVNNIKE CLFV+P SY +SFK KN+TAVEYVLP+F TTF+G+++D +K  
Sbjct: 220 HYDVMDETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK-P 278

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           LP+N Q I L DELFSV ET FHPEI+RILKPG++ETI+ESLSM+PE++RPL+V N+VC 
Sbjct: 279 LPENTQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCT 338

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420
           GGNFNLP+F+ RLTSELQRQLPTDW     +P  + ELFGWKAMAQF+ T+SYRK R+TR
Sbjct: 339 GGNFNLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTR 398

Query: 421 EEYMEHGVEWCTKHRFGYQNWI 442
           EEY EHG +W TK+RFGYQNWI
Sbjct: 399 EEYYEHGTDWLTKNRFGYQNWI 420

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/449 (61%), Positives = 358/449 (79%), Gaps = 17/449 (3%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           MD  P+V+DNGSYEIKFG+SNS  P+RA+N  A DKY + YLSNQ+K I+++S V  RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLTSWELES IWDYC YNP+EFDGF+L  + KKHL++SE C++LPE S+N+D +IF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYNYGSIYKSPVAGFIPF---ADLTKDVI-SISGKAXXXXXXNNAKFQEQLVTNDLNTY 176
           EEY + S++K+P AG+IPF   AD  K ++ +ISGK          K  + ++    N  
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGK----------KNDDDMIGQSENVT 170

Query: 177 ISSEEPSVTK---TAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           IS++     K   + +Y+D++L+IDSGFNCTWIIP+IKG+PYYKAIKK+DIGGRFLTGLL
Sbjct: 171 ISTDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLL 230

Query: 234 KETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYI 293
           KETLSFRHY++ DET+LVNNIKEKCLFV+P SY +SFK K +T+VEY+LPD  ++++GY 
Sbjct: 231 KETLSFRHYDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYT 290

Query: 294 KDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLM 353
           ++N    LP+ +Q++ L DELFSV ET FHPEISRILKPGI+ETI+ESLSM+PE++RPL+
Sbjct: 291 RENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLL 350

Query: 354 VNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSY 413
           V NIVC GGNFNLP+F+ RL +ELQRQLPTDWT  + +PK + ELF WK+M QF++TDSY
Sbjct: 351 VANIVCTGGNFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSY 410

Query: 414 RKARITREEYMEHGVEWCTKHRFGYQNWI 442
           +K RI++EEY EHG +W TKH+FGYQNW+
Sbjct: 411 KKTRISKEEYYEHGPDWLTKHKFGYQNWL 439

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/444 (63%), Positives = 351/444 (79%), Gaps = 26/444 (5%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M++ P+VIDNGSY +KFG ++   P+ A+NAIA DKY+  YLSNQIK IKDISSV+ +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           + LGQLTSWE+++ IWDYC YNP+EF+GF + DT  KHL+ SETC++LPE  +N+D +IF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY +GS+ KSPVAG++PF   TKD                     Q++  + +T    E
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKD---------------------QIIIGERDTEPFVE 159

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
            PS   T EY+DFQL++DSGFNCTWIIPVIKGIPYYKA+KK+DIGGRFL GLLKETLSFR
Sbjct: 160 TPS---TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFR 216

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIK-DNSKT 299
           HYNV DETILVNNIKEKCLFV+P SY +SFK K+ T+ EYVLPDF T+F+GY++  N + 
Sbjct: 217 HYNVMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQG 276

Query: 300 K-LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358
           K LP+++Q ITLKDELF+V ET FHPEIS+ILKPG++ETI+ESLSM+PEVIRPLMV+NI+
Sbjct: 277 KPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIM 336

Query: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARI 418
           CIGGNFNLP+F+ R+  ELQRQLPTDW   + I K ++EL GWKAM+ F+ TD Y+  R+
Sbjct: 337 CIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRV 396

Query: 419 TREEYMEHGVEWCTKHRFGYQNWI 442
           TREEY EHG++WCTKHRFGYQNW+
Sbjct: 397 TREEYYEHGIDWCTKHRFGYQNWV 420

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/444 (62%), Positives = 355/444 (79%), Gaps = 19/444 (4%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PIVIDNGSYE+KFG S++++P RA+NA+AKDKY   YLSNQ+  IKDISSV  RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQL SWELE  +WDYCF+NP+EF  F L++T   HLV+SETC++LPE S N+D ++F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY + S++KSPVAGF+PF +L  ++  I GK                V  DL   IS+ 
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDD-------------VMGDL---ISNM 164

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
           +    K   Y DF L+IDSGFNCTWIIP+IKG+PYYKA+KKM++GGRFL GL KET+S+R
Sbjct: 165 DSQNIKNP-YSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYR 223

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKD-NSKT 299
           HY+VTDETILVNNIKEKCLF++P SY +SFK K++ +V+YVLPDF T+F+GY+KD  S +
Sbjct: 224 HYDVTDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNS 283

Query: 300 KLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVC 359
           +LP+N+Q+ITL DELFSV ETIFHPE++++LKPGI+ETI+ESLS++PE IRPL+VNNIVC
Sbjct: 284 QLPENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVC 343

Query: 360 IGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS-DTDSYRKARI 418
           +GGNFN+PNF  RL +ELQRQLPTDW  ++YIP+ D EL GWK+M+QF+ +TD Y+KARI
Sbjct: 344 VGGNFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARI 403

Query: 419 TREEYMEHGVEWCTKHRFGYQNWI 442
           +REEY EHG +W TK RFGYQNWI
Sbjct: 404 SREEYYEHGTDWTTKKRFGYQNWI 427

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/442 (63%), Positives = 343/442 (77%), Gaps = 28/442 (6%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  PIV+DNGSYEIKFG  +   P RA NA+A+DK+ + YLSNQIK IKDISSV FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +E GQLTSWELESAIWDYCF+NP+EF+GF L+D+  +HLV+SETC+++PE S+N+D ++F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY + S++KSP+AGF PF    +  I+ISGK        N K                 
Sbjct: 121 EEYEFASMFKSPIAGFAPFG---RPSIAISGKGDDQP---NRK----------------A 158

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
           EP       Y+ FQL+ID GFNCTW++PVIKGIPYYKA+KK+DIGGRFL GLLKETLSFR
Sbjct: 159 EPDA-----YEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFR 213

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HYNV DETILVNNIKE CLFV+P SY ESFK K +TAVEYVLPDF T+F+GY+KD  K  
Sbjct: 214 HYNVMDETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKD-PKKP 272

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           LP ++Q + LKDELFSV ET FHPEI ++LKPGIIETI+ESLS+LPE +RPLM+ NIVC 
Sbjct: 273 LPQDSQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCT 332

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420
           GGNFNLPNF+ RL +ELQRQLPTDWT  V++P    EL+GW +MA F+++  Y  AR+TR
Sbjct: 333 GGNFNLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTR 392

Query: 421 EEYMEHGVEWCTKHRFGYQNWI 442
           EEY EHGV+WCT+HRFGYQNW+
Sbjct: 393 EEYFEHGVDWCTRHRFGYQNWM 414

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/443 (59%), Positives = 348/443 (78%), Gaps = 25/443 (5%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M+  P+V+DNGSYE+KFG S +  PFRA+NA+A+DK+   YLSNQI  IKDISSV+F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +E GQLTSWEL+S +WDYCF+NP EFDGF L+D+  +HL+ SETC++LPE S+N+D ++F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY + S+ K+P++GF+PF+  T++   ISGK                         S  
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGD-----------------------SES 157

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
             S ++T +Y+ FQ++IDSGFNCTW++P+IKG+P+YKA+KK+D+GGRF+ GLLKETLSFR
Sbjct: 158 GTSTSETKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFR 217

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HYNV DETILVNNIKEKCLF++P SY +SF  K++TAVEYVLPDF TTF+GY+ D  K  
Sbjct: 218 HYNVMDETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADR-KNP 276

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
              +AQ +TL+DELFSV ET FHPEI+++LKPGIIETI+ESLS++PE +RPLMV+NI+C 
Sbjct: 277 PSKDAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCT 336

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDA-ELFGWKAMAQFSDTDSYRKARIT 419
           GGNFNLP+F +RL +ELQRQLPTDW+  +Y+P+  + EL GW +M+ F+ TD Y+ AR++
Sbjct: 337 GGNFNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVS 396

Query: 420 REEYMEHGVEWCTKHRFGYQNWI 442
           R+EY EHGVEW TK+RFGYQNWI
Sbjct: 397 RQEYYEHGVEWTTKNRFGYQNWI 419

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 335/443 (75%), Gaps = 24/443 (5%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYEL 63
           +P VIDNGSYEIKFG +N   PFRA N IAKDKY   YLSN +K I+DISS   RRP+EL
Sbjct: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61

Query: 64  GQLTSWELESAIWDYCFYNPEEFDGFQLED-TSKKHLVISETCLSLPEFSRNIDHIIFEE 122
           GQL SWELE  IWDYC YNP+EFDGF L D T ++ L+++ETC +LPE S+N D ++FEE
Sbjct: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121

Query: 123 YNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEEP 182
           Y + +++KSP +GF+PFA+L  +                 K  E L   D  T ++++  
Sbjct: 122 YEFATMFKSPASGFMPFANLIGN-----------------KNMEHLCGKD--TAVNTDYT 162

Query: 183 SVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY 242
           + T T EY+DFQL+IDSGFNCTW++P+IKG+P+YKAIKKMDIGGRFL GLLKETLSFRHY
Sbjct: 163 TAT-TKEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY 221

Query: 243 NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLP 302
           N+ DETIL+NNIKEKCLFV+P SY +SFK K + AVEYVLPDF T+F+GY+ D S  K  
Sbjct: 222 NMMDETILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGI 281

Query: 303 DNA--QLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           D    Q ITL DE F+V ET FHPE++ ILKPG++ETI+E++SM+PE +RP++V+NIVC+
Sbjct: 282 DRGSVQTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCV 341

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIP-KIDAELFGWKAMAQFSDTDSYRKARIT 419
           GGNF LP+ S RLTSELQRQLPTDWT  V +P   D EL  W AMAQFS TD Y+  R+T
Sbjct: 342 GGNFKLPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVT 401

Query: 420 REEYMEHGVEWCTKHRFGYQNWI 442
           REEY+EHG +WC+KHRF YQNWI
Sbjct: 402 REEYLEHGTDWCSKHRFTYQNWI 424

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/442 (58%), Positives = 339/442 (76%), Gaps = 22/442 (4%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M++ PIVIDNGSYEIKFG ++S  PF A+N+IAKDKY   +LSNQ++ IKDISSV F RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           ++LGQL SWELES IWDYC +NP+EFDG+ L+ T  KHL+ SE+C++LPE S+N+D ++F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY Y S++K+PV  F+PF +   D   I                  LV  +    ++S+
Sbjct: 121 EEYEYDSLFKAPVPVFVPF-NAEGDTTHI------------------LVAKEDADVVASD 161

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
            PS  K  +Y+D++L+IDSGFNCTW++PVIKG+PYYKA+KK+DIGGRFL G L+E LSFR
Sbjct: 162 HPSDNK--DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HYNV DETILVN+IKEKCLF++P SY +SF+ + KTA EYVLPDF T+F GY++   +T 
Sbjct: 220 HYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT- 278

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           LP+++Q I L+DELF+V ET FHPEI+ +L PGIIE I+ES+SMLPE +RPL+V N+V  
Sbjct: 279 LPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVT 338

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420
           GGNFN+PNF+ RL +ELQRQ PTDW+  V +P  DA L+GWK M +FS+T +YR++R++R
Sbjct: 339 GGNFNIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSR 398

Query: 421 EEYMEHGVEWCTKHRFGYQNWI 442
           EEY EHGV+WCT  RFGYQ W+
Sbjct: 399 EEYYEHGVDWCTSKRFGYQAWL 420

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/440 (59%), Positives = 332/440 (75%), Gaps = 22/440 (5%)

Query: 3   DLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYE 62
           D  IVIDNGSY++KFG+++   P  A+NA+AKDKY   +LSNQ++ IKDISSV FRRP+E
Sbjct: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63

Query: 63  LGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEE 122
           LGQLTSWELES IWDYC YNP+EF G   +    +H+V+SETC++LPE S+N D ++FEE
Sbjct: 64  LGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEE 122

Query: 123 YNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEEP 182
           Y   S+YK+P A +IPF    +++ +ISGK+                  +L+      E 
Sbjct: 123 YEVDSLYKAPTAAYIPFYTTNENIKTISGKSDH---------------GELDI-----EE 162

Query: 183 SVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY 242
            +    EY DF L+IDSGFNCTW+IP++KG+PYYKA+KK+D+GGRFL GLLKET+SFRHY
Sbjct: 163 KIEAGKEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY 222

Query: 243 NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLP 302
           NV DE+ILVNNIKE+CL+V P SY E+FK K K  +++VLPDF T+F GY++D  KT LP
Sbjct: 223 NVMDESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRD-PKTALP 281

Query: 303 DNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGG 362
           DNAQ++TL DE FSV E  FHPEIS+ LKPGIIET++ES+ MLPE++RPLM +NIVC+GG
Sbjct: 282 DNAQILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGG 341

Query: 363 NFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREE 422
           NFNLP F+ RL SELQRQLPTDW     I   D  L GW AMA+F+ TD+Y+KAR+T+E+
Sbjct: 342 NFNLPGFTDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKED 401

Query: 423 YMEHGVEWCTKHRFGYQNWI 442
           Y EHG++W TK RFGYQNW+
Sbjct: 402 YFEHGLDWTTKERFGYQNWV 421

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/443 (58%), Positives = 330/443 (74%), Gaps = 25/443 (5%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           MDD PI+IDNGSYE+KFG + +  PFRA+NA+A+DKY   +LSNQ+  +KDIS+V FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQLTSWEL+S IWDYC YNP+EF+ +++ +T  KHLV+SE C+S+PE S+  D ++F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY +GS +K PVAGF+PF                    N    +  ++    ++    +
Sbjct: 120 EEYEFGSCFKGPVAGFVPF--------------------NWQALEHNMIYAKEDSVYRKD 159

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
             S  +  EY DFQL+IDSGFNCTW++P++KGIPYYKAIKK+DIGGRFL G LKETLSFR
Sbjct: 160 --STGERNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFR 217

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HYNV DETILVNNIKEKCLF++P SY  SF+ K  T  EYVLPDF T+F GY+K   K K
Sbjct: 218 HYNVMDETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVK-QQKQK 276

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           +P+++Q I L DELFS+ ET FHPEI+ +LKPGI+ETI+ES+SMLPE IRPLMV+N V  
Sbjct: 277 IPEDSQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVT 336

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKI-DAELFGWKAMAQFSDTDSYRKARIT 419
           GGNFN+ NF++RL +ELQRQ PTDW   V +P   D  LFGW +M QFS T +Y++ R+T
Sbjct: 337 GGNFNIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVT 396

Query: 420 REEYMEHGVEWCTKHRFGYQNWI 442
           REEY EHGV+WCTK RFGYQ W+
Sbjct: 397 REEYYEHGVDWCTKQRFGYQKWL 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 333/439 (75%), Gaps = 30/439 (6%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYEL 63
           +PI+IDNGSYEIKFG S+ + P+RA+N +A+DKY   +LSNQ+K I+++S+ + RRP+EL
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 64  GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEEY 123
           GQL SWELE  IWDYC +N +EF  + L+D+    L++SETC+S+PE S+++D ++FEEY
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121

Query: 124 NYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEEPS 183
            +GS+ K PVA +IPF ++                             D   Y S   P 
Sbjct: 122 EFGSLMKCPVAQYIPFDNMA----------------------------DYKVYGSDGLPV 153

Query: 184 VTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYN 243
           V K  +Y DFQL++DSGFNCTW+IPVIKG+PYYKA+KK+DIGGRFLTGLLKET+SFRHYN
Sbjct: 154 VRKKDDYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYN 213

Query: 244 VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPD 303
           + DETIL NNIKE+C F+ P SY +SF+ K +T ++YVLPDF T+ +GY++   K  +P+
Sbjct: 214 LMDETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVR-QPKQAIPE 272

Query: 304 NAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGN 363
           ++Q + L+DELF++ ET FHPEI+ ILKPG+IET++ES+SMLPE+IRPLMV+NI  IGGN
Sbjct: 273 DSQTLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGN 332

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEY 423
           FN+ NF+ RL +ELQRQ PTDW+  V++PK D EL GWKAM +FS+TDSY++ R+TR EY
Sbjct: 333 FNISNFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEY 392

Query: 424 MEHGVEWCTKHRFGYQNWI 442
           +EHGV+WCTK+RFGY+ WI
Sbjct: 393 LEHGVDWCTKYRFGYEQWI 411

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/446 (57%), Positives = 332/446 (74%), Gaps = 29/446 (6%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M + P++IDNGSYEIKFG SN   PF A+NA+AKDKY T YLSNQI  IKDISSV+ +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           ++LGQL SWELE  IWDYCFYN ++F GF++ + S+ HLV++ET ++LPE SRN D ++F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYNYGSIYKSPVAGFIPF-ADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           EEY + S+YK+P A FIPF  +     I +SGK+                     TY+  
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKS--------------------KTYLDG 160

Query: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239
                +K   Y+DF L+IDSG+NC+WIIP+IKG+PYYKA+KKMD+GGRFL GLLKET+S+
Sbjct: 161 -----SKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISY 215

Query: 240 RHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK- 298
           RHY+VTDE++LVNNIKE C+F++P SY ESFK K  T VEYVLPDF T+FMGY++D  K 
Sbjct: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275

Query: 299 TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358
           + LP+++Q I L+DELFSV E  FHPE++ +LKPGIIETI+ESL +LPE +R LMVNNIV
Sbjct: 276 STLPEHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIV 335

Query: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS--YRKA 416
           C GGNFN+PNF  R+ +ELQ+Q+ T+W   V IPK +AEL  WKAM  F++ +   Y+  
Sbjct: 336 CTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHT 395

Query: 417 RITREEYMEHGVEWCTKHRFGYQNWI 442
           R+T++EY EHG EW TK RFGYQNW+
Sbjct: 396 RVTKQEYNEHGFEWTTKQRFGYQNWL 421

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 331/442 (74%), Gaps = 23/442 (5%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M++ P++IDNGSYEIKFG  + + P RA+N+IAKDKY   +LSNQ++ IKDISSV F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120
           +ELGQL SWELE+ IWDYC +NP++F+G+ ++ T  KHL+ SE+C+++PE S+N+D ++F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSE 180
           EEY + +++K+PV  F+PF                    N  K    ++    ++ +   
Sbjct: 121 EEYEFETMFKAPVPVFVPF--------------------NTGKKSTHMLVAKEDSEVEES 160

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
           E +  K   Y DFQL+IDSGFNC+WI+PVIKG+PYYKA+KK+DIGGRFL G L+E LSFR
Sbjct: 161 EVAPAKN--YNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 218

Query: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
           HYNV DETILVN+IKE CLF++P +Y ESF+ ++KTA EYVLPDF+T+F GY++   +  
Sbjct: 219 HYNVMDETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQV- 277

Query: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360
           LP  +Q I L+DELF+V ET FHPEI+ +L  GI+ETI+ES+SMLPE IRPLMV NIV  
Sbjct: 278 LPAESQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVIT 337

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420
           GGNFN+PNF+ RL +ELQRQ PTDW+  V +PK DA L+GWK M +FS+T+ Y ++R+TR
Sbjct: 338 GGNFNIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTR 397

Query: 421 EEYMEHGVEWCTKHRFGYQNWI 442
           +EY EHGV+WCT  RFGYQ W+
Sbjct: 398 QEYYEHGVDWCTAKRFGYQAWL 419

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 322/439 (73%), Gaps = 31/439 (7%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYEL 63
           +P++++NGSYEIKFG +N   P+RA N + +D+Y   +LSNQ+  I+DIS  + RRP EL
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 64  GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEEY 123
           GQL SWELE  IWDYC +NP+EF G++L+D+    L+ SETC+++PE S+N+D ++FEEY
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121

Query: 124 NYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEEPS 183
            +GS+ K PVA F+PF D  +D   + G                                
Sbjct: 122 EFGSMMKCPVAQFVPF-DRARDYDIVGGAGEV---------------------------- 152

Query: 184 VTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYN 243
           V   + Y +FQL++DSGFNCTW++PVIKG+PYYKA KK+DIGGRFL GLLKET+SFRHYN
Sbjct: 153 VEAKSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN 212

Query: 244 VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPD 303
           V DETIL+NNIKE+C F+ P SY +SF+ K +T VEY+LPDF T+ +GY++   K  +P 
Sbjct: 213 VMDETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVR-QPKQAIPK 271

Query: 304 NAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGN 363
            +Q++ L+DELF+V ET FHPEIS ILKPG++ETI+E +SM+PEV+RPL+V+NIV +GGN
Sbjct: 272 TSQILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGN 331

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEY 423
           FN+ NF+ RL +ELQRQ PTDW   V+ PK+DA L GWK+M QFS TDSY+ +R+TR EY
Sbjct: 332 FNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEY 391

Query: 424 MEHGVEWCTKHRFGYQNWI 442
           +EHG +WCTKHRFGY+ WI
Sbjct: 392 LEHGADWCTKHRFGYEQWI 410

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/445 (56%), Positives = 327/445 (73%), Gaps = 33/445 (7%)

Query: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60
           M +  +VIDNGSYEIKFG S    P RA+N + KDKY+  +LSNQ K ++DIS    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  YELGQLTSWELESAIWDYCFYNPEEF--DGFQLEDTSKKHLVISETCLSLPEFSRNIDHI 118
           +ELGQL SWELES +WDYCFYN ++F  +     DT   HLV+SET +++PE S+N+D +
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 119 IFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYIS 178
           IFEEY++ S++K PVA +IPF                       ++Q+  +T       +
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFY--------------------QGQYQDDAMT-------A 153

Query: 179 SEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238
           +E+    KT+ YKDFQL+IDSGFNCTW +P+IKG+PYYKAIKK+DIGGRFLTGLL+ET+S
Sbjct: 154 AED---KKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETIS 210

Query: 239 FRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK 298
           FRHYNV +ETILVNNIKE+C FV P+SY  SF  K  T VEYVLPDF T+F+GY+K   K
Sbjct: 211 FRHYNVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK 270

Query: 299 TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358
            KL D+AQ + L DE+FSV ET FHPEI++ILKPGI+ETI+E ++M PEV+RPL+V NIV
Sbjct: 271 EKLTDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIV 330

Query: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPK-IDAELFGWKAMAQFSDTDSYRKAR 417
           C GGNFN+PNF +RL +ELQRQ P DW+  V+ P+  D  L GW++M  F+++D +R AR
Sbjct: 331 CTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSAR 390

Query: 418 ITREEYMEHGVEWCTKHRFGYQNWI 442
           +TREEY+EHG++WCTK+RFGYQ W+
Sbjct: 391 VTREEYLEHGLDWCTKNRFGYQQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP I  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQILFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR +T  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +A+E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (253), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMEVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  102 bits (253), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 65

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 118

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 119 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 141

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR +T  L
Sbjct: 142 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYL 190

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +A+E  Y LPD     
Sbjct: 191 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD----- 245

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 246 ---------------GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDV 290

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 291 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 349

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 350 LTTFQQMWISKQEYDESG 367

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  102 bits (253), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRGI-- 65

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 118

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 119 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 141

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR +T  L
Sbjct: 142 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYL 190

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +A+E  Y LPD     
Sbjct: 191 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYELPD----- 245

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 246 ---------------GQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDV 290

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 291 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 349

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 350 LTTFQQMWISKQEYDESG 367

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 178/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG+   P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  101 bits (252), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKNNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQILFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR +T  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + L+ R Y+   T E  +V +IKEK  +VA     E       +AVE  Y LPD     
Sbjct: 190 MKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  101 bits (252), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       ++VE  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   G+ +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKDLYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G     AI ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 100/438 (22%), Positives = 175/438 (39%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQILFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S     +           ++DSG   T ++P+  G      I ++D+ GR +T  L
Sbjct: 141 SLYSSGRTTGI-----------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +A+E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 100/438 (22%), Positives = 176/438 (40%), Gaps = 95/438 (21%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +   +++DSG   T ++P+  G      I ++D+ GR LT  L
Sbjct: 141 SLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y+   T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+      +
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDV 289

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           R  +  NIV  GG    P  ++R+  E+    P+     +  P  + +   W   +  + 
Sbjct: 290 RKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-ERKYSVWIGGSILAS 348

Query: 410 TDSYRKARITREEYMEHG 427
             ++++  I+++EY E G
Sbjct: 349 LTTFQQMWISKQEYDESG 366

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 105/446 (23%), Positives = 177/446 (39%), Gaps = 92/446 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTV---------YLSNQIKGIKDISS 54
           PIV+DNGS  IK G S    P     + I   KYN V         ++ NQ + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           +  R P E G + +W     IW++ F+        QL +  +  ++ +E  L+  +    
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHK-----SLQLNNIEEHPVLATEAPLNPLKNREA 123

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  ++FE +N  ++Y S                                     +   L+
Sbjct: 124 MCEMLFETFNVPAVYVS-------------------------------------IQAVLS 146

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----FLT 230
            Y S            +    ++D G  C   +PV  G     +I+++D+ GR    FL 
Sbjct: 147 LYASG-----------RTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQ 195

Query: 231 GLLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFM 290
            LL++T      + ++  I V  IKEK  +VA     E           Y L    T F 
Sbjct: 196 LLLRKTTGVSLLSSSEREI-VRIIKEKACYVARDPLTEE--------QTYHLTPTSTIF- 245

Query: 291 GYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIR 350
                    KLPD  +++ LK+E F   E +F P++       I E   +S+S +   +R
Sbjct: 246 ---------KLPD-GKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLR 295

Query: 351 PLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDT 410
           P +++NIV  GG    P F  RL +EL+          ++ P  + +   W   +  S  
Sbjct: 296 PALLSNIVLSGGTTMFPGFGDRLLTELRNLSEPQTKIKIFAPP-ERKYSTWIGGSILSGL 354

Query: 411 DSYRKARITREEYMEHGVEWCTKHRF 436
            +++K  +T+ E+ E+    C   RF
Sbjct: 355 STFKKIWVTKSEWQEN--PDCVHSRF 378

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 104/446 (23%), Positives = 173/446 (38%), Gaps = 92/446 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTV---------YLSNQIKGIKDISS 54
           PIV+DNGS  IK G S    P     + I   KYN V         ++ NQ + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           +  R P E G + +W     IW Y F         QL++     ++I+E  L+       
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFNK-----SLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  ++FE +N  ++Y S                                     +   L+
Sbjct: 122 MCELLFESFNVPALYVS-------------------------------------IQAVLS 144

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----FLT 230
            Y S                 ++D G  C   +PV  G     +I+++DI GR    FL 
Sbjct: 145 LYASGRTTGC-----------VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQ 193

Query: 231 GLLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFM 290
            LL++T      + ++  + V  IKEK  +VA   + E            + P++     
Sbjct: 194 LLLRKTTGVSLLSSSEREV-VRIIKEKACYVAKDPHIEEQNFS-------INPNY----- 240

Query: 291 GYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIR 350
                 +K KLPD  + I L  E F   E +F PE+       + +   +S+  +   +R
Sbjct: 241 ------TKFKLPD-GKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLR 293

Query: 351 PLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDT 410
            L+ +N++  GG   LP F  RL SEL+    +     ++ P  + +   W   +  S  
Sbjct: 294 SLLFSNVLLSGGTSILPGFGDRLLSELKSLSDSQTKIKIFAPP-ERKYSTWIGGSILSGL 352

Query: 411 DSYRKARITREEYMEHGVEWCTKHRF 436
            +++K  +TR E+ E     C   RF
Sbjct: 353 STFKKLWVTRAEWEEAAD--CIHSRF 376

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 90/392 (22%), Positives = 157/392 (40%), Gaps = 83/392 (21%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLV 100
           Y+ ++ +  + I  +  R P E G +T+W+    IW + FYN       +L    ++H V
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPV 88

Query: 101 ISETCLSLPEFSR-NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXX 159
           +       P+ +R  +  I+FE +N  + Y S                            
Sbjct: 89  LLTEAPMNPKSNREKMTQIMFETFNVPAFYVS---------------------------- 120

Query: 160 NNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAI 219
                    +   L+ Y S            +   +++DSG   T ++P+  G     AI
Sbjct: 121 ---------IQAVLSLYSSG-----------RTTGIVLDSGDGVTHVVPIYAGFSLPHAI 160

Query: 220 KKMDIGGRFLTGLLKETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTA 277
            ++D+ GR LT  L + LS R Y+   T E  +V +IKEK  +VA     E       ++
Sbjct: 161 LRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSS 220

Query: 278 VE--YVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGII 335
           +E  Y LPD                     Q+IT+ +E F   E +FHP +  +   GI 
Sbjct: 221 IEKSYELPD--------------------GQVITIGNERFRAPEALFHPSVLGLESAGID 260

Query: 336 ETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKID 395
           +T   S+      +R  +  NIV  GG    P  ++R+  E+    P+     +  P  +
Sbjct: 261 QTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-E 319

Query: 396 AELFGWKAMAQFSDTDSYRKARITREEYMEHG 427
            +   W   +  +   ++++  I+++EY E G
Sbjct: 320 RKYSVWIGGSILASLTTFQQMWISKQEYDESG 351

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 102/437 (23%), Positives = 172/437 (39%), Gaps = 94/437 (21%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTV---------YLSNQIKGIKDISS 54
           P+V+DNGS  IK G S    P     + I   KYN V         ++ NQ + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           +  R P + G +T+W     +W Y F         QL++      +++E  L+  +    
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFNK-----SLQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  ++FE +N  ++Y S                                     V   L+
Sbjct: 150 MCELLFESFNVPALYVS-------------------------------------VQAVLS 172

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----FLT 230
            Y S            +    ++D G  C   +PV  G     +I+++DI GR    FL 
Sbjct: 173 LYASG-----------RTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQ 221

Query: 231 GLLKETLSFRHYNVTDETILVNNIKEKCLFVA--PKSYAESFKLKNKTAVEYVLPDFHTT 288
            LL++T      + ++  I V  IKEK  FV   PK   ++F +          P F   
Sbjct: 222 LLLRKTTGVSLLSSSEREI-VRTIKEKACFVTKDPKLEEQNFPMN---------PSF--- 268

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
                   SK KLPD  + I L  E +   E +F PE+       + +   +S+  +   
Sbjct: 269 --------SKFKLPD-GKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLD 319

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS 408
           +R L+ +NI+  GG   LP F  RL  EL+    +     ++ P  + +   W   +  S
Sbjct: 320 LRSLLYSNILLSGGTSMLPGFGDRLLKELKSLSGSRTKIKIFAPP-ERKYSTWIGGSILS 378

Query: 409 DTDSYRKARITREEYME 425
              +++K  +T+ E+ E
Sbjct: 379 GLSTFKKLWVTKSEWEE 395

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 89/392 (22%), Positives = 155/392 (39%), Gaps = 83/392 (21%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLV 100
           Y+ ++ +  + I  +  R P E G +T+W+    IW + FYN       +L    ++H V
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPV 88

Query: 101 ISETCLSLPEFSR-NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXX 159
           +       P+ +R  +  I+FE +N  + Y S                            
Sbjct: 89  LLTEAPMNPKSNREKMTQILFETFNVPAFYVS---------------------------- 120

Query: 160 NNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAI 219
                    +   L+ Y S     +           ++DSG   T ++P+  G      I
Sbjct: 121 ---------IQAVLSLYSSGRTTGI-----------VLDSGDGVTHVVPIYAGFSLPHGI 160

Query: 220 KKMDIGGRFLTGLLKETLSFRHYN--VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTA 277
            ++D+ GR +T  L + LS R Y+   T E  +V +IKEK  +VA     E       +A
Sbjct: 161 LRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSA 220

Query: 278 VE--YVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGII 335
           +E  Y LPD                     Q+IT+ +E F   E +FHP +  +   GI 
Sbjct: 221 IEKSYELPD--------------------GQVITIGNERFRAPEALFHPSLLGLEAAGID 260

Query: 336 ETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKID 395
           +T   S+      +R  +  NIV  GG    P  ++R+  E+    P+     +  P  +
Sbjct: 261 QTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPP-E 319

Query: 396 AELFGWKAMAQFSDTDSYRKARITREEYMEHG 427
            +   W   +  +   ++++  I+++EY E G
Sbjct: 320 RKYSVWIGGSILASLTTFQQMWISKQEYDESG 351

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 101/448 (22%), Positives = 177/448 (39%), Gaps = 96/448 (21%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTV---------YLSNQIKGIKDISS 54
           PIV+DNGS  IK G      P     + +   KY+ V         ++ NQ + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           +  R P E G +T W     +W + F       G QL       ++++E  L+  +    
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  ++FE ++  ++Y S                                     +   L+
Sbjct: 125 MCELLFETFSVPAVYVS-------------------------------------IQAVLS 147

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLK 234
            Y S                 ++DSG  C+  +PV  G     AI+++DI GR ++ LL 
Sbjct: 148 LYASGRTTGC-----------VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELL- 195

Query: 235 ETLSFRHYNVT----DETILVNNIKEKCLFVA--PKSYAESFKLKNKTAVEYVLPDFHTT 288
           + L  +   V+     E  +V  IKEK  ++A  PK   +++ +  K           T 
Sbjct: 196 QVLIRKSTGVSLLSSSEREIVRIIKEKACYIALDPKEEEKNYTMHGK----------QTM 245

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
           F          +LPD  Q I L +E F   E +F+P++       + E + ES+  +   
Sbjct: 246 F----------RLPDGKQ-IELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLD 294

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS 408
           +R  + +NIV  GG   +P F  R+  EL+          ++ P  + +   W   +  S
Sbjct: 295 LRTSLFSNIVFSGGTTMIPGFGDRVLKELKLSCEPQTKIKIFAPP-ERKYSTWIGGSILS 353

Query: 409 DTDSYRKARITREEYMEHGVEWCTKHRF 436
              +++K  +T++E+ E+    C   RF
Sbjct: 354 GLSTFKKIWVTKKEWEEN--PRCVHARF 379

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 104/436 (23%), Positives = 171/436 (39%), Gaps = 91/436 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP------------FRAINAIAKDKYNTVYLSNQIKGIKDI 52
           P+V+DNGS  +K G S    P               +N  +KD      L+ + + I   
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--- 68

Query: 53  SSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFS 112
             +  R P + G + +W     IWDY F      D  +L+D  +  ++I+E  L+     
Sbjct: 69  --LQLRHPVDHGVVKNWNDMELIWDYMFK-----DKLKLKDVDEHPVLITEAPLNPVSNR 121

Query: 113 RNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
             +  ++FE +   ++Y +  A    +A         SGK                    
Sbjct: 122 DEMCDLLFESFGVQALYVANPAVLSLYA---------SGK-------------------- 152

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGL 232
               IS                 ++D G   +  +PV +G     AIK++D+GGR LT  
Sbjct: 153 ----ISG---------------CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQ 193

Query: 233 LKETL---SFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
           L+  L   +      + E  LV  IKEK  +VA     E  K            ++    
Sbjct: 194 LQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC-----------NYEGDQ 242

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
           +G      K KLPD  + ITL  + F V E +F P +       I E I +S+S L   +
Sbjct: 243 VGL-----KFKLPD-GKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           RP M ++I+  GG   L  F  RL  EL +         ++ P  + +   W   +  ++
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAPP-ERKYTSWIGGSILAE 355

Query: 410 TDSYRKARITREEYME 425
             +++K  +T+ ++ E
Sbjct: 356 LSTFQKIIVTKSQWQE 371

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 164/400 (41%), Gaps = 92/400 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYNTV------YLSNQIKGIKD 51
           PIV+D G+  +K G +    P     +I       A+++ N V       + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY FY     D  +L  TS   ++++E  ++    
Sbjct: 66  YLQISY--PMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTN 171
              +  ++FE+Y++G +Y +            + V+++  +                   
Sbjct: 119 REQMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG------------------ 149

Query: 172 DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231
                +SS               +++DSG   T I+PV + +      +++D+ GR +T 
Sbjct: 150 -----LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190

Query: 232 LLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
            L + LS R Y  N + +   V  IKEK  +V   SY     L  K A E       TT 
Sbjct: 191 HLIDLLSRRGYAFNRSADFETVRQIKEKLSYV---SY--DLDLDTKLARE------TTTL 239

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
           +         +LPD  ++I +  E F   E +F P +  + +PG+ E +  ++      +
Sbjct: 240 V------ENYELPD-GRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDV 292

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           R  +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 293 RSALYRAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 101/448 (22%), Positives = 176/448 (39%), Gaps = 92/448 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVY----------LSNQIKGIKDIS 53
           P+V+DNGS  IK G S    P     + I   KYN V           + N+ + ++ + 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRGLL 70

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +++  P E G +  W     +W + FYN       +L +  +  ++I+E  L+ P  +R
Sbjct: 71  KLHY--PLEHGVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLN-PMKNR 122

Query: 114 N-IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
           N +  ++FE +   ++Y S  A    +A          G+                    
Sbjct: 123 NKMCEMLFETFGSPAVYVSIQAVLALYA---------GGRTTG----------------- 156

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----F 228
                                  +ID G  C   +PV  G     AI+++D+ GR    F
Sbjct: 157 ----------------------CVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEF 194

Query: 229 LTGLLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTT 288
           L  LL+++      + ++  I V  IKEK  FVA     E    +   + E         
Sbjct: 195 LQLLLRKSSGVTLSSSSEREI-VRMIKEKACFVATDVGNEEQNYEGANSAEL-------- 245

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
                   ++ KLPD  +++TL  E F   E +F P +       I E   +S+S +   
Sbjct: 246 -------ETRFKLPD-GKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLD 297

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS 408
           +R  + ++IV  GG+     F  RL SE+++    +    ++ P  + +   W   +  +
Sbjct: 298 LRSSLYSSIVLSGGSTMFSGFGDRLLSEIRKTSEPNTKIKIFAPP-ERKYSTWIGGSILA 356

Query: 409 DTDSYRKARITREEYMEHGVEWCTKHRF 436
              ++ K  +TR E+ E+    C   RF
Sbjct: 357 GLSTFEKLWVTRAEWQEN--PQCIHSRF 382

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 96/398 (24%), Positives = 165/398 (41%), Gaps = 88/398 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYN-TVYLSNQIKG--IKDISS 54
           PIV+D G+  +K G +    P     +I       A+++ N T  L + + G    D+ S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 55  -VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +    P E G + +W     +WDY F+N       +L +TS   ++++E  ++  +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  ++FE+Y++G +Y +            + V+++  +                     
Sbjct: 121 KMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG-------------------- 149

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
              +SS               +++DSG   T I+PV + +      +++D+ GR +T  L
Sbjct: 150 ---LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192

Query: 234 KETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG 291
            + LS R Y  N T +   V  IKEK  +V   SY     L  K A E       TT + 
Sbjct: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLDLDTKLARE------TTTLV- 240

Query: 292 YIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRP 351
                   +LPD  + I +  E F   E +F P +  + +PG+ E +  ++      +R 
Sbjct: 241 -----ESYELPD-GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRS 294

Query: 352 LMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
            +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 295 ALYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WYTRV 328

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/400 (22%), Positives = 164/400 (41%), Gaps = 92/400 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYNT------VYLSNQIKGIKD 51
           PIV+D G+  +K G +    P     +I       A+++ N       + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY F     FD  +L  TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAF-----FDQMKLPTTSNGKILLTEPPMNPVKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTN 171
              +  ++FE+Y++G +Y +            + V+++  +                   
Sbjct: 119 REQMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG------------------ 149

Query: 172 DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231
                +SS               +++DSG   T I+PV + +      +++D+ GR +T 
Sbjct: 150 -----LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190

Query: 232 LLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
            L + LS R Y  N + +   V  IKEK  +V   SY     L  K A E       TT 
Sbjct: 191 HLIDLLSRRGYAFNRSADFETVRQIKEKVCYV---SY--DLDLDTKLARET------TTL 239

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
           +         +LPD  ++I +  E F   E +F P +  + + G+ E +  ++      I
Sbjct: 240 V------ENYELPD-GRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDI 292

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           R  +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 293 RSALYRAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 96/438 (21%), Positives = 174/438 (39%), Gaps = 91/438 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVYLSNQI----------KGIKDIS 53
           P+V+DNGS  IK G S    P     N I   KY  V L+N I          +  K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +  R P   G + +W+    +W + F      D  ++ D  +  L+I+E  L+ PE +R
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFN-----DILKINDFDEHPLLITEAPLN-PEKNR 123

Query: 114 N-IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
           + +  + FE++++ ++Y          A+ +   +  SG+                    
Sbjct: 124 DKMCEVFFEKFDFAAVY---------IANPSTLSLYASGRTTG----------------- 157

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGL 232
                                  ++D G      +P+ +G     +I+++D+GGR +T  
Sbjct: 158 ----------------------CVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQ 195

Query: 233 LKETLSFRHYN-----VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHT 287
           L+     R Y       + E  +V N+KEK  +V+   +A    + N      + P+   
Sbjct: 196 LQ--FQIRKYTGISLYSSSEHEIVKNVKEKACYVS-TDFAHDEDMSN------LNPE--- 243

Query: 288 TFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPE 347
                 K   + KLPD   LI L    F   E +F P+I  +    + +   ES+S +  
Sbjct: 244 ------KIRCQFKLPDGKDLI-LDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDL 296

Query: 348 VIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQF 407
            +RP + ++I+  GG+     F  RL  ELQ +        +  P  + +   W   +  
Sbjct: 297 ELRPKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAPP-ERKYTSWIGGSIL 355

Query: 408 SDTDSYRKARITREEYME 425
           +   ++++  +T+ E+ E
Sbjct: 356 TGLSTFKQLWMTKAEWQE 373

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 89/436 (20%), Positives = 177/436 (40%), Gaps = 90/436 (20%)

Query: 5   PIVIDNGSYEIKFG-VSNSRIPFRAINAIAKDKYNTV---------YLSNQIKGIKDISS 54
           P+VIDNG+  +K G V + +      N +   K++ V         Y+ N+ +  + +  
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL-- 67

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           +  R P E G++  W+   A+W +   +        ++   +  ++I+E  L+  +   +
Sbjct: 68  LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNREH 122

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  I+FE +N  +I+                                             
Sbjct: 123 MCEILFESFNIPAIH--------------------------------------------- 137

Query: 175 TYISSEEPSVTKT-AEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
                E P+V    +  +    +ID G      +P+ +G     +I+++DIGGR +T  L
Sbjct: 138 ----VENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREITEQL 193

Query: 234 ----KETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
               ++++    ++ ++E  +V  IKE+  +VA     E  K        Y+L       
Sbjct: 194 QFQIRKSVGMSLFS-SNEKEIVRTIKERACYVADDISKEEHK--------YILDSE---- 240

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                ++SK KLPD   L ++ +  F  TE +F+P +       + E + ++LS +   +
Sbjct: 241 ----SNSSKFKLPDGKSL-SIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDL 295

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           RP++  ++V  GG   LP F  R+  ELQ     D    + I   + +   W   +  + 
Sbjct: 296 RPMLYKSLVLNGGTTVLPGFGNRILKELQILTKQDTKLRI-IASPERKYTTWIGGSILAG 354

Query: 410 TDSYRKARITREEYME 425
             +++K  +T+  + E
Sbjct: 355 LSTFQKILVTKSNWNE 370

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 97/445 (21%), Positives = 176/445 (39%), Gaps = 86/445 (19%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP----FRAINAIAKDKYNTVYLSNQIKGI-----KDISSV 55
           P+V+DNGS  IK G S    P    +  I     DK     LS++ + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  NFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNI 115
             + P E G +  W     +W + FY+       +L +     ++++E  L+  E    +
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYS-----SLKLNNIGDHPMLVTEAPLNPLENRDKM 125

Query: 116 DHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNT 175
             +++E +N  ++Y S                                     +   L  
Sbjct: 126 CEMLYETFNVPAVYVS-------------------------------------IQAVLAL 148

Query: 176 YISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----FLTG 231
           Y           A  +    +ID G  C   +PV  G     AI+++D+ GR    FL  
Sbjct: 149 Y-----------AGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQL 197

Query: 232 LLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG 291
           LL++++     + ++  I V  IKEK  +VAP+  AE  K  +    E +          
Sbjct: 198 LLRKSIGVTLLSSSEREI-VRMIKEKACYVAPEVAAEEQKYASSRGSEEL---------- 246

Query: 292 YIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRP 351
                +K KLPD  ++++L  E F   E +F P++       I +   +S+S +   +R 
Sbjct: 247 -----TKFKLPD-GKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRS 300

Query: 352 LMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTD 411
            + +++V  GG+     F  RL +EL+ +   +    ++ P  + +   W   +  +   
Sbjct: 301 SLYSSLVLSGGSTLFAGFGDRLLNELRSRCEPNVKIKIFAPP-ERKYSVWIGGSILAGLS 359

Query: 412 SYRKARITREEYMEHGVEWCTKHRF 436
           ++ K  +TR E+ E+    C   RF
Sbjct: 360 TFEKIWVTRSEWQEN--PQCVHSRF 382

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 97/410 (23%), Positives = 165/410 (40%), Gaps = 98/410 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKG-----IKDI------- 52
           PIV+D G+  +K G +    P     +I         L  + +G     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGTISTPLKDIMIGDEAS 61

Query: 53  ---SSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLP 109
              S +    P E G + +W     +WDY F+N       +L  TS   ++++E  ++  
Sbjct: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPV 116

Query: 110 EFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLV 169
           +    +  ++FE Y++G +Y +            + V+++  +                 
Sbjct: 117 KNRERMCEVMFERYDFGGVYVA-----------IQAVLALYAQG---------------- 149

Query: 170 TNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFL 229
                  +SS               +++DSG   T I+PV + +      +++D+ GR +
Sbjct: 150 -------LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDV 188

Query: 230 TGLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHT 287
           T  L + LS R Y  N T +   V  IKEK  +V   SY     L  K A E       T
Sbjct: 189 TRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYV---SY--DLNLDTKLARE------TT 237

Query: 288 TFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPE 347
           T +       + +LPD  ++I +  E F   E +F P++  +  PG+ E +  ++     
Sbjct: 238 TLV------QEYELPD-GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADI 290

Query: 348 VIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAE 397
            +R  +   IV  GG+   P     L S L+R+L   W T +   K DAE
Sbjct: 291 DVRSSLYKAIVLSGGSSMYPG----LPSRLERELKQLWFTRIL--KGDAE 334

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 94/398 (23%), Positives = 160/398 (40%), Gaps = 88/398 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP--------FRAINAIAKDKYNTVYLSNQIKG--IKDISS 54
           PIV+D G+  +K G +    P         R I    +    T  L + + G    D+ S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65

Query: 55  -VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +    P E G + +W     +WDY FY     +  +L  TS   ++++E  ++      
Sbjct: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  ++FE+Y++G +Y +            + V+++  +                     
Sbjct: 121 QMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG-------------------- 149

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
              +SS               +++DSG   T I+PV + +      K++D+ GR +T  L
Sbjct: 150 ---LSS--------------GVVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHL 192

Query: 234 KETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG 291
            + LS R Y  N + +   V  IKEK  +V   SY     L  K A E       TT + 
Sbjct: 193 IDLLSRRGYAFNRSADFETVRQIKEKLCYV---SY--DLDLDTKLARE------TTTLV- 240

Query: 292 YIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRP 351
                   +LPD  ++I +  E F   E +F P +  + +PG+ E +  ++      +R 
Sbjct: 241 -----ENYELPD-GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRT 294

Query: 352 LMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
            +   +V  GG+   P    RL  EL +QL   W T V
Sbjct: 295 ALYRAVVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/437 (21%), Positives = 168/437 (38%), Gaps = 90/437 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDIS 53
           P+VIDNGS  +K G      P R +  + I    YN +         ++ N+ + ++ + 
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKP-RCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL- 68

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +  + P E G ++ W+    +W +       FD  QL    +  L+I+E  L+      
Sbjct: 69  -LKLKHPMERGVVSDWDDMELLWSHIL-----FDSLQLTSGMEHPLLITEAPLNPESNKE 122

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  + FE +N  +I                  +SI G                     L
Sbjct: 123 KMLEVFFETFNIPAI-----------------CVSIPGV--------------------L 145

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S            +    ++D G      +PV +G     +IK++++GG  +T  L
Sbjct: 146 SLYASG-----------RTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQL 194

Query: 234 KETLSFRHYNV----TDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
           +  L  +   V    + E  LV  +KEK  +V+        +LK++    +     +T F
Sbjct: 195 QFQLR-KESGVWLFSSGERELVRTMKEKSCYVSLN------QLKDEEKFTFEPGKMNTNF 247

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
                     KLPD   ++TL    F   E +F P+I    +P + E  ++S+  +   +
Sbjct: 248 ----------KLPD-GNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVEL 296

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSD 409
           RP +++ I   GG      F  R   ELQ          +  P  + +   W   +  + 
Sbjct: 297 RPRLMSRITLSGGTTMFRGFGDRFLQELQISTCKKSNIRILAPP-ERKYTAWIGGSMLAG 355

Query: 410 TDSYRKARITREEYMEH 426
             ++RK   T+ ++ EH
Sbjct: 356 LTTFRKMLTTKSDWREH 372

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 95/398 (23%), Positives = 160/398 (40%), Gaps = 88/398 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKG-IKDI----------S 53
           PIV+D G+  +K G +    P     +I             I   +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVRS 65

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +    P E G + +W+    +WDY FYN  +F       TS   ++++E  ++  +   
Sbjct: 66  YLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLKNRE 120

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  ++FE+Y++G +Y +            + V+++  +                     
Sbjct: 121 LMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG-------------------- 149

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
              +SS               +++DSG   T I+PV + +      +++D+ GR +T  L
Sbjct: 150 ---LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192

Query: 234 KETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG 291
            + LS R Y  N + +   V  IKEK  +V   SY     L  K A E       TT + 
Sbjct: 193 IDLLSRRGYAFNRSADFETVRQIKEKLSYV---SY--DLNLDTKLARE-------TTVL- 239

Query: 292 YIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRP 351
                   +LPD  ++I +  E F   E +F P++  + +PGI E +  ++      IR 
Sbjct: 240 ----VENYELPD-GRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRS 294

Query: 352 LMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
            +   IV  GG+   P    RL  EL +QL   W T +
Sbjct: 295 SLYRAIVLSGGSSMYPGLPSRLEKEL-KQL---WYTRI 328

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 137/332 (41%), Gaps = 77/332 (23%)

Query: 60  PYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHII 119
           P E G + +W     +WDY FY     D  QL  TS   ++++E  ++  +    +  ++
Sbjct: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           FE+Y++G +Y +            + V+++  +                        +SS
Sbjct: 73  FEKYDFGGVYVA-----------IQAVLALYAQG-----------------------LSS 98

Query: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239
                          +++DSG   T I+PV + +      +++D+ GR +T  L + LS 
Sbjct: 99  --------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 144

Query: 240 RHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNS 297
           R Y  N + +   V  IKEK  +V   SY     L  K A E       TT +       
Sbjct: 145 RGYAFNRSADFETVRQIKEKLSYV---SY--DLDLDTKLARE------TTTLV------E 187

Query: 298 KTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNI 357
             +LPD  ++I +  E F   E +F P +  + +PG+ E +  ++      +R  +   I
Sbjct: 188 NYELPD-GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAI 246

Query: 358 VCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           V  GG+   P    RL  EL +QL   W T V
Sbjct: 247 VLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 274

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 95/404 (23%), Positives = 163/404 (40%), Gaps = 100/404 (24%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP------------FRA-----INAIAKDKYNTVYLSNQIK 47
           PIV+D G+  +K G +    P             RA     IN   KD    + + ++  
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKD----IMIGDEAS 61

Query: 48  GIKDISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLS 107
            ++    +++  P E G + +W     +WDY F+N       QL  TS   ++++E  ++
Sbjct: 62  DVRSYLQISY--PMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMN 114

Query: 108 LPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQ 167
             +    +  ++FE+Y++G +Y +  A           V+++  +               
Sbjct: 115 PVKNREQMCEVMFEKYDFGGVYVAIQA-----------VLALYAQG-------------- 149

Query: 168 LVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR 227
                    +SS               +++DSG   T I+PV + +      +++D+ GR
Sbjct: 150 ---------LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGR 186

Query: 228 FLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDF 285
            +T  L + LS R Y  N + +   V  IKEK  +V   SY     L  K A E      
Sbjct: 187 DVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV---SY--DLDLDTKLARE------ 235

Query: 286 HTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSML 345
            TT +         +LPD  ++I +  E F   E +F P +  + + GI E +  ++   
Sbjct: 236 TTTLV------ENYELPD-GRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSA 288

Query: 346 PEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
              +R  +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 289 DVDVRSSLYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 91/400 (22%), Positives = 160/400 (40%), Gaps = 92/400 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------------AKDKYNTVYLSNQIKGIKD 51
           PIV+D G+  +K G +    P     +I             A      + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTN 171
              +  ++FE+Y++G  Y +            + V+++  +                   
Sbjct: 119 REQMCEVMFEKYDFGGTYVA-----------IQAVLALYAQG------------------ 149

Query: 172 DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231
                +SS               +++DSG   T I+PV + +      +++D+ GR +T 
Sbjct: 150 -----LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190

Query: 232 LLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
            L + LS R Y  N T +   V  IKEK  +V   SY     L  K A E       TT 
Sbjct: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLDLDTKLARET------TTL 239

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
           +         +LPD  ++I +  E F   E +F P +  + +PG+ E +  ++      I
Sbjct: 240 V------ESYELPD-GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDI 292

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           R  +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 293 RTSLYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/393 (21%), Positives = 156/393 (39%), Gaps = 94/393 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP---FRAI----------NAIAKDKYNTVYLSNQIKGIKD 51
           PIV+D G+  +K G +    P   F +I           A        + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTN 171
              +  ++FE+Y++G +Y +            + V+++  +                   
Sbjct: 119 REKMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG------------------ 149

Query: 172 DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231
                +SS               +++DSG   T I+PV + +      +++D+ GR +T 
Sbjct: 150 -----LSS--------------GVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTR 190

Query: 232 LLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAV---EYVLPDFH 286
            L + LS R Y  N T +   V  IKEK  +V+     ++ KL  +T V    Y LPD  
Sbjct: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTVLVESYELPDGR 249

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
           T                    I +  E F   E +F P +  + +PG+ E +  ++    
Sbjct: 250 T--------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSAD 289

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQR 379
             IR  +   IV  GG+   P    RL  EL++
Sbjct: 290 VDIRSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 163/400 (40%), Gaps = 92/400 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYNT------VYLSNQIKGIKD 51
           PIV+D G+  +K G +    P     +I       A+++ N       V +  +   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY FY     +  +L  TS   ++++E  L+  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTN 171
              +  ++FE+Y++G +Y +            + V+++  +                   
Sbjct: 119 REKMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG------------------ 149

Query: 172 DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231
                +SS               ++IDSG   T I+PV + +      +++D+ GR +T 
Sbjct: 150 -----LSS--------------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190

Query: 232 LLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289
            L + LS R Y  N T +   V  IKEK  +V   SY    +L  K A E       TT 
Sbjct: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLELDTKLARE------TTTL 239

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
           +         +LPD  ++I +  E F   E +F P +  +   G+ E +  ++      +
Sbjct: 240 V------ENYELPD-GRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDV 292

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           R  +   IV  GG+   P    R+  EL +QL   W T V
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRIEKEL-KQL---WYTRV 328

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 83/353 (23%), Positives = 139/353 (39%), Gaps = 94/353 (26%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDISS 54
           +VIDNGS   K G +    P RA+  + + + ++  +         Y+ ++ +  + I  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI-- 64

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR- 113
           +  R P E G +T+W+    IW + FYN       +L    ++H V+       P+ +R 
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNRE 117

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  I+FE +N  + Y S                                     +   L
Sbjct: 118 KMTQIMFETFNVPAFYVS-------------------------------------IQAVL 140

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
           + Y S     +           ++DSG   T ++P+  G      I ++D+ GR LT  L
Sbjct: 141 SLYSSGRTTGI-----------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYL 189

Query: 234 KETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVE--YVLPDFHTTF 289
            + LS R Y  + T E  +V +IKEK  +VA     E       +++E  Y LPD     
Sbjct: 190 MKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPD----- 244

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESL 342
                           Q+IT+ +E F   E +FHP +  +   GI +T   S+
Sbjct: 245 ---------------GQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 89/399 (22%), Positives = 159/399 (39%), Gaps = 88/399 (22%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVYLSNQIKGIKDI---------- 52
           +PIV+D G+  +K G +    P +   + + +        SN    +KDI          
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 53  SSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFS 112
           S +    P E G + +W     +WDY FY     D  ++  T+   ++++E  ++  +  
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFY-----DQMKIPSTAGHKVLLTEPPMNPLKNR 119

Query: 113 RNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
             +  ++FE+Y++G +Y +            + V+++  +                    
Sbjct: 120 EQMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG------------------- 149

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGL 232
               +SS               +++DSG   T I+PV + +      +++D+ GR +T  
Sbjct: 150 ----LSS--------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRY 191

Query: 233 LKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFM 290
           L + LS R Y  N T +   V  IKEK  +V       S+ L   T + +       T+ 
Sbjct: 192 LIDLLSRRGYAFNKTADFETVRQIKEKLCYV-------SYDLDLDTKLAHETTTLVETY- 243

Query: 291 GYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIR 350
                    +LPD  ++I +  E F   E +F P +  + + GI E +  ++      I 
Sbjct: 244 ---------ELPD-GRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDII 293

Query: 351 PLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
             +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 294 SALYRAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 137/332 (41%), Gaps = 77/332 (23%)

Query: 60  PYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHII 119
           P E G + +W     +WDY FY     +  +L DTS   ++++E  ++  +    +  ++
Sbjct: 18  PMENGIIKNWTDMELLWDYAFY-----EQMKLPDTSNGKILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           FE+YN+G +Y +  A           V+++  +                        +SS
Sbjct: 73  FEKYNFGGVYVAIQA-----------VLALYAQG-----------------------LSS 98

Query: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239
                          +++DSG   T I+PV + +      +++D+ GR +T  L + LS 
Sbjct: 99  --------------GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSR 144

Query: 240 RHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNS 297
           R Y  N T +   V  IKEK  +V   SY     L  K A E       TT +       
Sbjct: 145 RGYAFNRTADFETVRQIKEKLCYV---SY--DLDLDTKLARE------TTTLV------E 187

Query: 298 KTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNI 357
             +LPD  ++I +  E F   E +F P +  + + G+ E +  ++      IR  +   I
Sbjct: 188 SYELPD-GRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAI 246

Query: 358 VCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           V  GG+   P    RL  EL +QL   W T V
Sbjct: 247 VLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 274

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 98/438 (22%), Positives = 175/438 (39%), Gaps = 90/438 (20%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVYLSNQIKGIKDISSVN------- 56
           P+V+DNGS  +K G S    P         K +Y  V  +    G++D + V        
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTT----GLEDRTFVGNEAQRLR 68

Query: 57  ----FRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFS 112
                RRP   G++T+W+    +W + FY+  +  G          L+I+E  L+  +  
Sbjct: 69  GLLALRRPISRGEVTNWDDMELLWSHIFYSKLQL-GQGNSQIGDHPLLITEAPLNSTKNR 127

Query: 113 RNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
             +  I++E +N+ ++Y +  A           V+S+                       
Sbjct: 128 ETMCEILYETFNFDALYVAHPA-----------VLSL----------------------- 153

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGL 232
              Y + +               +++ G   +   PV +G     +I+++DIGGR +T  
Sbjct: 154 ---YATGQTTGC-----------VLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQE 199

Query: 233 L----KETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTT 288
           L    +++     ++ +++ I V  IKEK  +VA     E  K                 
Sbjct: 200 LQFYIRKSTGLSLFSNSEQEI-VRTIKEKANYVALDYKFEEEKF---------------- 242

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
           F+   ++ S  KLPD  +L T     +  +E +F P++       + E ++ES++ +   
Sbjct: 243 FIHERENTSTVKLPDGQEL-TFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMD 301

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKI-DAELFGWKAMAQF 407
           +R  ++ NIV  GG   L  F +R  SE ++ LP    T V I  + +     W   +  
Sbjct: 302 LRTQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKH--TKVKIRSLAERSYIAWIGGSIL 359

Query: 408 SDTDSYRKARITREEYME 425
           S    +R   +TRE Y E
Sbjct: 360 SGLYGFRNLWLTREMYEE 377

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 93/399 (23%), Positives = 155/399 (38%), Gaps = 90/399 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVYLSNQIKGIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +    P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
            +  ++FE+Y++G +Y +  A    +A  L+  V+  SG                     
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDG------------------- 161

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGL 232
                                          T I+PV + +      +++D+ GR +T  
Sbjct: 162 ------------------------------VTHIVPVYESVVLGHLTRRLDVAGRDVTRH 191

Query: 233 LKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFM 290
           L + LS R Y  N T +   V  IKEK  +V   SY     L  K A E       TT +
Sbjct: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLDLDTKLARE------TTTLV 240

Query: 291 GYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIR 350
                    +LPD  + I +  E F   E +F P +  + +PG+ E + +++      +R
Sbjct: 241 ------ESYELPD-GRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVR 293

Query: 351 PLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
             +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 99/439 (22%), Positives = 167/439 (38%), Gaps = 95/439 (21%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTVYLSNQI--------KGIKDISS 54
           PIVIDNG+  IK G +    P R +  + +   KY+ +  SN I        K  K    
Sbjct: 14  PIVIDNGTNVIKGGFTGETKP-RCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI 72

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           +  R P   G + +W+    IW Y F      D   LE+ ++  ++I+E  L+     + 
Sbjct: 73  LKLRHPMLRGVVQNWDDMETIWQYVFD-----DTLYLENLNEHPILITEPPLNNMANRQK 127

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +   +FE + + ++Y                 IS+S                        
Sbjct: 128 MCEALFEIFGFPAVY-----------------ISVS------------------------ 146

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT---- 230
                  P ++  A  +     +D G      IPV  G     ++KK+DIGG  +T    
Sbjct: 147 -------PVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQ 199

Query: 231 -GLLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKL---KNKTAVEYVLPDFH 286
             +LK T  F +   + E  +V  IKEK  ++A     E+ K    + K A ++ LPD  
Sbjct: 200 FSILKNTGLFMY--SSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPD-- 255

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
                              +++ +    ++ TE +F PE+       + E   +S+  + 
Sbjct: 256 ------------------GKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVD 297

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQ 406
             +R  + +NIV  GG    P F  RL  ELQ     D    +  P  + +   W   + 
Sbjct: 298 SDLRLPLYSNIVLSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAPP-ERKYTSWIGGSI 356

Query: 407 FSDTDSYRKARITREEYME 425
            S   ++ K  +T+  + E
Sbjct: 357 LSGLSTFSKIWVTKSMWEE 375

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 155/401 (38%), Gaps = 94/401 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYNT------VYLSNQIKGIKD 51
           PIV+D G+  +K G +    P     +I       A ++ N       + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G +  W     +WDY FY     +  +L  TS   ++++E  ++    
Sbjct: 66  YLQISY--PMENGIIRDWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVT 170
              +  ++FE+Y++G +Y    A    +A  L+  V+  SG                   
Sbjct: 119 REQMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDG----------------- 161

Query: 171 NDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT 230
                                            T I+PV + +      +++D+ GR +T
Sbjct: 162 --------------------------------VTHIVPVYESVVLNHLTRRLDVAGRDMT 189

Query: 231 GLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTT 288
             L + LS R Y  N T +   V  IKEK  +V   SY     L  + A E       TT
Sbjct: 190 RYLIDLLSRRGYAFNKTADFETVRQIKEKLCYV---SY--DLDLDTRLAQE------TTT 238

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
            +       + +LPD  ++I +  E F   E +F P +  + +PGI E +  ++      
Sbjct: 239 LV------EQYELPD-GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVD 291

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           I   +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 292 IVSTLYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 87/391 (22%), Positives = 152/391 (38%), Gaps = 90/391 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP---FRAI----------NAIAKDKYNTVYLSNQIKGIKD 51
           PIV+D G+  +K G +    P   F +I           A        + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY F     F+  +L+ TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAF-----FEQMKLQSTSNGKILLTEPPMNPLKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVT 170
              +  ++FE+Y++G +Y +  A    +A  L+  V+  SG                   
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDG----------------- 161

Query: 171 NDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT 230
                                            T I+PV + +      +++D+ GR +T
Sbjct: 162 --------------------------------VTHIVPVYESVVLNHLTRRLDVAGRDVT 189

Query: 231 GLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTT 288
             L + LS R Y  N T +   V  IKEK  +V   SY     L  K A E       TT
Sbjct: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLDLDTKLARE------TTT 238

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
            +         +LPD  + I +  E F   E +F P +  + +PG+ E +  ++      
Sbjct: 239 LV------ESYELPD-GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVD 291

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQR 379
           IR  +   IV  GG+   P    RL  EL++
Sbjct: 292 IRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 96/438 (21%), Positives = 171/438 (39%), Gaps = 92/438 (21%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFR-AINAIAKDKYNTV-----------YLSNQIKGIKDI 52
           PIVIDNGS  IK G S    P     N     KY+ +           Y+ N+ + I+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFS 112
             +  + P   G + +W+    +W + F      D   +++  +  L+I+E  L++ +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLWWHIFN-----DTLNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 RNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
             +   +FE +N  S+Y                                       V N 
Sbjct: 124 HIMCERLFETFNIPSLY---------------------------------------VAN- 143

Query: 173 LNTYISSEEPSVTKT-AEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231
                    PSV    A       ++D G       P+ +G     +I+KM++GGR +T 
Sbjct: 144 ---------PSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITE 194

Query: 232 LL----KETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHT 287
            L    +++     Y+ ++E  +V  IKEK  +++     E F   NK+   Y L     
Sbjct: 195 HLQFQIRKSSGISLYS-SNEKEIVRTIKEKVCYIS-----EDF---NKSEESYYLRQDEM 245

Query: 288 TFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPE 347
           +         K KLPD  +L TL  E F   E +F+P++  +    +     ES+S +  
Sbjct: 246 S--------CKFKLPDGKEL-TLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDL 296

Query: 348 VIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQF 407
            +RP + +NI+  GG+     F  RL  +LQ          +  P  + +   W   +  
Sbjct: 297 ELRPKLFSNILLTGGSTLFKGFGSRLLGDLQELTNNRAKIKILAPP-ERKYTSWIGGSIL 355

Query: 408 SDTDSYRKARITREEYME 425
           +   +++   +T+ ++ E
Sbjct: 356 TGLSTFKNLWVTKSDWEE 373

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/393 (21%), Positives = 149/393 (37%), Gaps = 94/393 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP---FRAI----------NAIAKDKYNTVYLSNQIKGIKD 51
           PIV+D G+  +K G +    P   F +I           A        + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVT 170
              +  ++FE+Y++G +Y +  A    +A  L+  V+  SG                   
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDG----------------- 161

Query: 171 NDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT 230
                                            T I+PV + +      +++D+ GR +T
Sbjct: 162 --------------------------------VTHIVPVYESVVLSHLTRRLDVAGRDVT 189

Query: 231 GLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAV--EYVLPDFH 286
             L + LS R Y  N T +   V  IKEK  +V+     ++   +  TA+   Y LPD  
Sbjct: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGR 249

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
           T                    I +  E F   E +F P +  + +PG+ E +  ++    
Sbjct: 250 T--------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSAD 289

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQR 379
             IR  +   IV  GG+   P    RL  EL++
Sbjct: 290 VDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/393 (21%), Positives = 149/393 (37%), Gaps = 94/393 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP---FRAI----------NAIAKDKYNTVYLSNQIKGIKD 51
           PIV+D G+  +K G +    P   F +I           A        + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVT 170
              +  ++FE+Y++G +Y +  A    +A  L+  V+  SG                   
Sbjct: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDG----------------- 161

Query: 171 NDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT 230
                                            T I+PV + +      +++D+ GR +T
Sbjct: 162 --------------------------------VTHIVPVYESVVLSHLTRRLDVAGRDVT 189

Query: 231 GLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAV--EYVLPDFH 286
             L + LS R Y  N T +   V  IKEK  +V+     ++   +  TA+   Y LPD  
Sbjct: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGR 249

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
           T                    I +  E F   E +F P +  + +PG+ E +  ++    
Sbjct: 250 T--------------------IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSAD 289

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQR 379
             IR  +   IV  GG+   P    RL  EL++
Sbjct: 290 VDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 152/401 (37%), Gaps = 92/401 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP---FRAINAIAKDKYNTVYLSNQIKGIKDI--------- 52
           PIV+D G+  +K G +    P   F +I      +       +    IKDI         
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDV 65

Query: 53  -SSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
            S +    P E G +  W     +WD+ F     F+  +L  TS   ++++E  ++  + 
Sbjct: 66  RSYLQISYPMENGIIKHWTDMELLWDHAF-----FEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVT 170
              +  ++FE+Y++G +Y +  A    +A  L+  V+  SG                   
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDG----------------- 163

Query: 171 NDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT 230
                                            T I+PV + +      +++D+ GR +T
Sbjct: 164 --------------------------------VTHIVPVYESVVLNHLTRRLDVAGRDVT 191

Query: 231 GLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTT 288
             L + LS R Y  N + +   V  IKEK  +V   SY   F  K       ++ ++   
Sbjct: 192 RHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV---SYDLDFDTKLARETTTLVENY--- 245

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
                      +LPD  ++I +  E F   E +F P +  + +PG+ E +  ++      
Sbjct: 246 -----------ELPD-GRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVD 293

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           IR  +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 294 IRSSLYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 330

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 155/401 (38%), Gaps = 94/401 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP---FRAI----------NAIAKDKYNTVYLSNQIKGIKD 51
           PIV+D G+  +K G +    P   F +I           A        + + ++   ++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVRS 65

Query: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111
              +++  P E G + +W     +WDY FY     +  +L  TS   ++++E  ++  + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLKN 118

Query: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFAD-LTKDVISISGKAXXXXXXNNAKFQEQLVT 170
              +  ++FE+Y++G +Y +  A    +A  L+  V+  SG                   
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDG----------------- 161

Query: 171 NDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLT 230
                                            T I+PV + +      +++D+ GR +T
Sbjct: 162 --------------------------------VTHIVPVYESVVLNHLTRRLDVAGRDVT 189

Query: 231 GLLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTT 288
             L + LS R Y  N T +   V  IKEK  +V   SY     L  + A E       TT
Sbjct: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLDLDTRLARE------TTT 238

Query: 289 FMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEV 348
            +       K +LPD  ++I +  E F   E +F P +  +   G+ E +  ++      
Sbjct: 239 LV------EKYELPD-GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVD 291

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389
           +R  +   IV  GG+   P    RL  EL +QL   W T V
Sbjct: 292 VRSSLYKAIVLSGGSSMYPGLPSRLEKEL-KQL---WFTRV 328

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 102/448 (22%), Positives = 172/448 (38%), Gaps = 106/448 (23%)

Query: 17  FGVSNSRIPFRAINAIAKDKYNTV----------YLSNQIKGIKDISSVNFRRPYELGQL 66
           FG S S   F ++NA      N            Y+ N+        S +   P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TSWE-----LESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFE 121
            +W+      E++I+ Y    PE+              +++E  L+ PE    +  I FE
Sbjct: 122 ENWDHMERFWENSIFKYLRTEPED-----------HFFLLTEPPLNPPENREQVAEIFFE 170

Query: 122 EYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEE 181
            +N   +Y +  A     A  T   ++                                +
Sbjct: 171 SFNCAGLYIAVQAVLALAASWTSSKVT--------------------------------D 198

Query: 182 PSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRH 241
            S+T T        +IDSG   T +IPV +G     AIK + I GR +T  ++  L  R 
Sbjct: 199 RSLTGT--------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RE 248

Query: 242 YNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
              TD ++     IK++  +V P    E  K           PD    F+  +++  KT+
Sbjct: 249 RGETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRN-------PDKFAQFI--VENQEKTQ 299

Query: 301 LPDNAQLITLKDELFSVTETIFHPEI--SRILKPGIIETIIE-SLSMLPEVIRPLMVNNI 357
                +++ +  E F   E  F+PEI  S  L P  + TI++ ++   P  +R  + NNI
Sbjct: 300 ----KKIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNI 353

Query: 358 VCIGGNFNLPNFSKRLTSELQ----------------RQLPTDWTTHVYIPKIDAELFGW 401
           V  GG+    +F +RL  +++                +    D     +  + +A  FG 
Sbjct: 354 VLSGGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGG 413

Query: 402 KAMAQFSDTDSYRKARITREEYMEHGVE 429
             +AQ ++  SY     T+++Y E+G E
Sbjct: 414 SLLAQTAEFKSYCH---TKKDYEEYGPE 438

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 85/392 (21%), Positives = 151/392 (38%), Gaps = 95/392 (24%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDIS 53
           PIVIDNGS  IK G S    P +A+  + +   KY+ V         ++ N+ + ++ + 
Sbjct: 14  PIVIDNGSGIIKAGFSGEERP-KALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +  R P + G +  W+    IW Y           QL++  +  L+I+E  ++  +   
Sbjct: 72  -LRLRYPMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            I  ++FE +N  +IY S  A    +A         SG+                     
Sbjct: 126 MIAQVMFETFNLSAIYVSDPAVLSLYA---------SGRTTG------------------ 158

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
                                 ++D G      +P+  G     +I +MDIGG    G +
Sbjct: 159 ---------------------CVVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDI 193

Query: 234 KETLSFRHYN-------VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFH 286
            E L F+           + E  +V  IKEK  ++A  +  E  K    T       D  
Sbjct: 194 TEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQ------DLI 247

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
           + F          KLPD  + I + ++ +   E +F P+I      G+    ++S+  + 
Sbjct: 248 SAF----------KLPD-GKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVD 296

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ 378
             +R  ++++++  GG   L  F  R+  +L+
Sbjct: 297 LDLRKNLLSSVILSGGTTTLKGFGDRMLHDLE 328

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 93/438 (21%), Positives = 173/438 (39%), Gaps = 98/438 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVYLSNQIKG--IKDISS-----VN 56
           PIV+DNGS  +K G      P     + I   KY+ V +    KG  + +++      + 
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGLLK 72

Query: 57  FRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNID 116
            R P + G + +WE    +WD+ F      D  ++ +  +  LV++E  L+       + 
Sbjct: 73  LRYPMDHGIIENWEHMETVWDHIFK-----DCLKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 117 HIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTY 176
             +FE +N  ++Y +  A    +A         SG+                        
Sbjct: 128 ETLFESFNIPALYIANPAVLSLYA---------SGRTT---------------------- 156

Query: 177 ISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG----L 232
                              ++++G      +P+ +G     +I+++DIGGR +T      
Sbjct: 157 -----------------GCVVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQ 199

Query: 233 LKETLSFRHYNVTDETILVNNIKEKCLFVAP--KSYAESFKL-KNKTAVEYVLPDFHTTF 289
           L+++     Y+ +++ I V  IKE   ++    K   E F L + K ++ + LPD     
Sbjct: 200 LRKSTGMWLYSSSEQEI-VRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLV 258

Query: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
           +G  +                    F   E +F+P +       + + I++S+S +   +
Sbjct: 259 IGPGR--------------------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDL 298

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYI---PKIDAELF-GWKAMA 405
           R  ++NNI   GG+     F  RL +EL      D TT V I   P+     F G   +A
Sbjct: 299 RSKLLNNITLSGGSTMFQGFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILA 356

Query: 406 QFSDTDSYRKARITREEY 423
             S   ++R   +T++++
Sbjct: 357 NLS---TFRNMWVTKDQW 371

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 96/414 (23%), Positives = 166/414 (40%), Gaps = 96/414 (23%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 107 YIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFKYLRAEPED---------- 156

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y +  A     A  T   ++       
Sbjct: 157 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVT------- 208

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 209 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 235

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 236 GSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDR 293

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
           +       P+    F+  I++  KTK     +++ +  E F   E  F+PEI  S  L P
Sbjct: 294 Q-------PEKFAQFI--IENQDKTK----QKVVDIGYERFLAPEIFFNPEIASSDFLTP 340

Query: 333 GIIETIIE-SLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ-----RQLPTDWT 386
             + T+++ ++   P  +R  + NNIV  GG+    +FS+RL  +++     R +  +  
Sbjct: 341 --LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAV 398

Query: 387 THVYIPKIDAEL-----------FGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
           T V    +D ++           FG   +AQ ++  SY     T+++Y E+G E
Sbjct: 399 TGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH---TKKDYEEYGPE 449

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 63/135 (46%), Gaps = 13/135 (9%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE---TIIESLSMLPEVIRPL------MVNNIVCIGGN 363
           E   V E IF P I  + + G++E   T++  L       R L      M  N+   GGN
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRRALSATCEKMAKNVFITGGN 671

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQF-SDTDSYRKARITREE 422
             LP   +R+  E    LP      V + K D  L  WK MA+F SD  SY+ + +T+ E
Sbjct: 672 TKLPGIRERIVREFTGFLPVGTELKVTLAK-DPSLSAWKGMAKFASDPTSYKSSILTKRE 730

Query: 423 YMEHGVEWCTKHRFG 437
           Y E+G E+  +H  G
Sbjct: 731 YEEYGPEYIKEHNLG 745

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/241 (19%), Positives = 84/241 (34%), Gaps = 59/241 (24%)

Query: 2   DDLPIVIDNGSYEIKFG-VSNSR----IPFRAINAIAKDKYNTVYLSNQIKGIKDISSVN 56
           D  PI ID GSYE++ G V+N       P R      +    T     +  G+       
Sbjct: 39  DGGPIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQ 98

Query: 57  FRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNID 116
            R P++   +T+W+    +  Y F++     G +        +V++E   +L     N  
Sbjct: 99  SRSPFDGPMVTNWDYVDDMLAYTFHHL----GVRGGGGVPNAVVLTERLATLQSQRANWY 154

Query: 117 HIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTY 176
            +++E YN   +                                          + L ++
Sbjct: 155 ELLYEAYNLQEV--------------------------------------TFGIDSLFSF 176

Query: 177 ISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----FLTGL 232
                P  T         L++ SG   T ++PV+ G       K+++ GG+    +LTGL
Sbjct: 177 YGERGPGSTG--------LVVSSGNEDTCVVPVVDGRGVVSEAKRINWGGQQAVDYLTGL 228

Query: 233 L 233
           L
Sbjct: 229 L 229

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/392 (20%), Positives = 151/392 (38%), Gaps = 95/392 (24%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAIN--AIAKDKYNTV---------YLSNQIKGIKDIS 53
           P+VIDNGS  IK G S    P +A+    +   KY+ V         ++ N  + ++ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL- 71

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +  R P + G +  W+    IW Y           QL++  +  L+I+E  ++  +   
Sbjct: 72  -LKLRYPIKHGVVEDWDSMELIWSYVLNEV-----LQLQNIGEHPLLITEAPMNPLKNRE 125

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  ++FE ++  ++Y S  A    +A         SG+                     
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYA---------SGRTTG------------------ 158

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
                                 ++D G      +P+  G     ++ +MDIGG  +T   
Sbjct: 159 ---------------------CVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT--- 194

Query: 234 KETLSFRHYNV-------TDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFH 286
            E L F+           + E  +V  +KEK  ++A     E  K    T       D  
Sbjct: 195 -EQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQ------DLI 247

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
           +TF          KLPD  + I + ++ +   E +F P+I  +   G+ +  ++S+  + 
Sbjct: 248 STF----------KLPD-GRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVD 296

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ 378
             +R  ++++I+  GG   L  F  R+  +L+
Sbjct: 297 LDLRKPLLSSIILSGGTTTLKGFGDRMLWDLE 328

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 17/137 (12%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE---TII-----ESLSMLPEVIRPLMVNNIVCIGGNF 364
           E   V E IF P +  + + GIIE   TII      S   L  V +  M NN+   GGN 
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQE-MANNVFLTGGNV 668

Query: 365 NLPNFSKRLTSELQRQLPTDWTTHVYI---PKIDAELFGWKAMAQFSDTDS-YRKARITR 420
            +P    R+  E    LP     ++ +   P IDA    WK MA+F+ + + Y+ + +T+
Sbjct: 669 RVPGLRDRIVREFTEFLPVGTKYNIKVASDPAIDA----WKGMAKFAQSSTDYKGSYVTK 724

Query: 421 EEYMEHGVEWCTKHRFG 437
           +EY E+G ++  +H+ G
Sbjct: 725 KEYEEYGPDYIKEHKLG 741

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 83/392 (21%), Positives = 151/392 (38%), Gaps = 95/392 (24%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAI--NAIAKDKYNTV---------YLSNQIKGIKDIS 53
           PIVIDNGS  IK G S    P +A+  + +   KY  V         ++ N+ + ++ + 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113
            +  R P   G +  W+    IW Y        +  QL++  +  L+I+E  ++  +   
Sbjct: 72  -LRLRYPMTHGVVEDWDSMELIWSYMLN-----EVLQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 NIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDL 173
            +  ++FE +N  ++Y S  A    +A         SG+                     
Sbjct: 126 VMAQVLFETFNLPALYISNPAVLSLYA---------SGRTTG------------------ 158

Query: 174 NTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL 233
                                 ++D G      +P+  G     +I +MDIGGR +T   
Sbjct: 159 ---------------------CVVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT--- 194

Query: 234 KETLSFRHYNV-------TDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFH 286
            E L F+           + E  +V  IKEK  ++A     E  +               
Sbjct: 195 -EQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRY-------------- 239

Query: 287 TTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLP 346
               G+    S  KLPD  + I + ++ +   E +F P+I      G+ +  ++S+  + 
Sbjct: 240 --LQGHHDLGSVFKLPD-GKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVD 296

Query: 347 EVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ 378
             +R  ++++I+  GG   L  F +R+  +L+
Sbjct: 297 LDLRKTLLSSIILSGGTTTLRGFGERMLHDLE 328

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 97/448 (21%), Positives = 170/448 (37%), Gaps = 106/448 (23%)

Query: 17  FGVSNSRIPFRAINAIAKDKYNTV----------YLSNQIKGIKDISSVNFRRPYELGQL 66
           FG S S   F ++ A A    N            Y+ N+        S +   P   GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  TSWE-----LESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFE 121
            +W+      E++I+ Y    PE+              +++E  L+ PE    +  I FE
Sbjct: 129 ENWDHMERFWENSIFKYLRTEPED-----------HFFLLTEPPLNPPENREQVAEIFFE 177

Query: 122 EYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEE 181
            +N   +Y                 I++           ++K  ++ +T           
Sbjct: 178 SFNCAGLY-----------------IAVQAVLALAASWTSSKVTDRSLTG---------- 210

Query: 182 PSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRH 241
                         +IDSG   T +IPV +G     AIK + I GR +T  ++  L  R 
Sbjct: 211 -------------TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RE 255

Query: 242 YNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300
               D ++     IK++  +V P    E  K                 F  +I +NS++ 
Sbjct: 256 RGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAG----------KFAQFIVENSEST 305

Query: 301 LPDNAQLITLKDELFSVTETIFHPEI--SRILKPGIIETII-ESLSMLPEVIRPLMVNNI 357
                +++ +  E F   E  F+PEI  S  L P  + T++ +++   P  +R  + NNI
Sbjct: 306 ---KKKIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTVVDQTIQACPIDVRKGLYNNI 360

Query: 358 VCIGGNFNLPNFSKRLTSELQ-----RQLPTDWTTHVYIPKIDAEL-----------FGW 401
           V  GG+    +F +RL  +L+     R   ++  +      +D ++           FG 
Sbjct: 361 VLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGG 420

Query: 402 KAMAQFSDTDSYRKARITREEYMEHGVE 429
             +AQ ++  SY     T+++Y E+G E
Sbjct: 421 SLLAQTAEFKSYCH---TKQDYEEYGPE 445

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/390 (20%), Positives = 154/390 (39%), Gaps = 84/390 (21%)

Query: 5   PIVIDNGSYEIKFGVSNSRIP----FRAI-NAIAKDKYNTV-----YLSNQIKGIKDISS 54
           P+++DNGS  IK G + S+ P    +  I N +A+    TV     Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNS--AYERRAT 69

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           ++   PY    + SW+    +WDY   N  E +  Q     +  +V++ +  +  +    
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQ-----EHPVVLTNSMSTSKKEEEK 124

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  ++FE+++  +IY                                             
Sbjct: 125 MCEVLFEKFSIPAIY--------------------------------------------- 139

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLK 234
               S +P ++     +     +  G     I  VI G+    + +  + GG  +T  + 
Sbjct: 140 ---CSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTML 196

Query: 235 ETLSFRH---YNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMG 291
           + L   H    N  +   L+ +IKE+C  ++   Y E           Y L    T+   
Sbjct: 197 DLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNE--------IRAYELITSKTS--- 245

Query: 292 YIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRP 351
               N+K +LPD   +I +  E F   E IF+P+     +  + + II S+S    + R 
Sbjct: 246 ----NNKYRLPD-GNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRS 300

Query: 352 LMVNNIVCIGGNFNLPNFSKRLTSELQRQL 381
            ++ +IV  GG+  +  F +RLT E+++++
Sbjct: 301 QLLESIVLSGGSSLIKGFGERLTKEIRKEI 330

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE----TIIESLSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E IF P +    + GI E     +++     P  +      MVNN++  GGN  
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS-DTDSYRKARITREEYM 424
           +P   +R+  E    LPT     V +   D  L  WK MA  + + + YRK  I+++EY 
Sbjct: 677 VPGLKERIVKEFTGFLPTGTNITVNMSS-DPSLDAWKGMAALARNEEQYRKTVISKKEYE 735

Query: 425 EHGVEWCTKHRFG 437
           E+G E+  +H+ G
Sbjct: 736 EYGPEYIKEHKLG 748

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 93/245 (37%), Gaps = 60/245 (24%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAI-NAIAKDK-----YNTVYLSNQIKGIKDISSVNFR 58
           PI ID GS +++ G  N   P     NA+ K +      N  ++ N     + + S + R
Sbjct: 39  PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQS-R 97

Query: 59  RPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHI 118
            P++   +T+W L   I DY F++     G   ++     ++++E   ++     N   I
Sbjct: 98  SPFDGPFVTNWNLTEEILDYTFHHL----GVVPDNGIPNPILLTERLATVQSQRTNWYQI 153

Query: 119 IFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYIS 178
           +FE YN        V G                                 VT  +++  S
Sbjct: 154 LFETYN--------VPG---------------------------------VTFGIDSLFS 172

Query: 179 --SEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKET 236
             +  PS  KT       L+I  G   T +IPV+ G       K+++ GG      L + 
Sbjct: 173 FYNYNPSGNKTG------LVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDL 226

Query: 237 LSFRH 241
           ++ ++
Sbjct: 227 MALKY 231

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 9/138 (6%)

Query: 308 ITLKDELFSVTETIFHPEISRILKPGIIE----TIIESLSMLP---EVIRPLMVNNIVCI 360
           + L  E   V E +F P I+   + GI E     +++     P         MVNN+   
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS-YRKARIT 419
           GGN  +P    R+  E    LP      V++ + D  L  WK MA+ ++ ++ Y+   +T
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPSLDAWKGMAKLANNETDYKNTAVT 726

Query: 420 REEYMEHGVEWCTKHRFG 437
           R+EY E+G ++  +H+ G
Sbjct: 727 RKEYEEYGPDYIKEHKLG 744

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 83/389 (21%), Positives = 152/389 (39%), Gaps = 89/389 (22%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFR-AINAIAKDKYNTV---------YLSNQIKGIKDISS 54
           PIVIDNGS  IK G S    P     + +   KY+ V         ++ N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
           + +  P E G +  W+    IW +        +  QL++  +  L+I+E  ++  +    
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILN-----EVLQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
           +  ++FE +N  ++Y S  A    +A         SG+                      
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYA---------SGRTTG------------------- 158

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLK 234
                                +ID G      +P+  G     ++ +MDIGGR +T  L+
Sbjct: 159 --------------------CVIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQ 198

Query: 235 ETLSFRHYNVT----DETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFM 290
             L  +   V+     E  +V  IKEK  ++A     E                   T+M
Sbjct: 199 FQLR-KSAGVSLFSSSEREIVRTIKEKVCYLATDIKKE-----------------ENTYM 240

Query: 291 GYIKD-NSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349
              +D  S  KLPD  + I + ++ +   E +F P+I      G+ +  ++S+  +   +
Sbjct: 241 QESQDLTSVFKLPD-GKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDL 299

Query: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQ 378
           R  ++++I+  GG   L  F  R+  +L+
Sbjct: 300 RTTLLSSIILSGGTTTLRGFGDRMLHDLE 328

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 113/254 (44%), Gaps = 40/254 (15%)

Query: 196 IIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNI 254
           +IDSG   T +IPV +G     AIK + I GR +T  ++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 255 KEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDEL 314
           K++  +V P    E  K   +       P+    F+  I++  KT      ++I +  E 
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQ-------PEKFAQFI--IENQDKT----TKKVIDIGYER 318

Query: 315 FSVTETIFHPEI--SRILKPGIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSK 371
           F   E  F+PEI  S  L P  + T++ +++   P  +R  + NNIV  GG+    +FS+
Sbjct: 319 FLAPEIFFNPEIASSDFLTP--LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSR 376

Query: 372 RLTSELQ-----RQLPTDWTTHVYIPKIDAEL-----------FGWKAMAQFSDTDSYRK 415
           RL  +++     R    +  T      +D ++           FG   +AQ ++   Y  
Sbjct: 377 RLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH 436

Query: 416 ARITREEYMEHGVE 429
              T+++Y EHG E
Sbjct: 437 ---TKKDYEEHGPE 447

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 11/134 (8%)

Query: 313 ELFSVTETIFHPEISRILKPGIIETIIES--------LSMLPEVIRPLMVNNIVCIGGNF 364
           E   V E IF P +  + + GIIE I E+               I   + +N+   GGN 
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFLTGGNM 667

Query: 365 NLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS-YRKARITREEY 423
            LP   +R+  E +  LP     +V +   D  L  W+ MA+ S TDS +R   +TR+EY
Sbjct: 668 RLPGMRERVVREFRGLLPIGTELNVRMAN-DCALDAWRGMAKLSRTDSLFRDTYVTRQEY 726

Query: 424 MEHGVEWCTKHRFG 437
            E+G ++  +H  G
Sbjct: 727 HEYGPDYIKEHNLG 740

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 104/268 (38%), Gaps = 63/268 (23%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAI-NAIAK--DK---YNTVYLSNQIKGIKDISSVNFRR 59
           I ID GS E++ G  N   P     N IA+  D+    N  ++ N       + S + R 
Sbjct: 39  IAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQS-RS 97

Query: 60  PYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHII 119
           PY+   +T+W+    I +Y F++     G +  D     ++++E   +L     N   ++
Sbjct: 98  PYDGALVTNWDYTEDIMEYTFHHL----GVKGTDGIPNPIIMTEKLGALHSQRDNWYQLL 153

Query: 120 FEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISS 179
           FE       + +P   F                                  + L ++ ++
Sbjct: 154 FE------CFGAPQVTF--------------------------------GLDSLFSFYAN 175

Query: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGR----FLTGLLKE 235
            + S +         L+I SG   T IIPV+ G       K+++ GGR    +L+ LL  
Sbjct: 176 NDASASG--------LVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL-- 225

Query: 236 TLSFRHYNVTDETILVNNIKEKCLFVAP 263
            L + ++ +   T     + ++  +V+P
Sbjct: 226 ALKYPYFPIKPSTHQFKALYDEFCYVSP 253

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 15/132 (11%)

Query: 317 VTETIFHPEISRILKPGIIE----TIIESLSMLPEVIR---PLMVNNIVCIGGNFNLPNF 369
           V E +F P +    + GIIE     +++     P  +      M  N+   GG+  LP  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 370 SKRLTSELQRQLPTDWTTHVYI---PKIDAELFGWKAMAQFSDTDS-YRKARITREEYME 425
             R+  E    LP D    V I   P +DA    WK MA+FS  D+ ++ + I+++EY E
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNISKHPSLDA----WKGMAKFSSDDADFKSSLISKKEYEE 737

Query: 426 HGVEWCTKHRFG 437
           +G E+  +HR G
Sbjct: 738 YGPEYIKEHRLG 749

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 103/461 (22%), Positives = 174/461 (37%), Gaps = 117/461 (25%)

Query: 10  NGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNF------------ 57
           NGS    FG S S   F  +          + LSN + G +    ++F            
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTG------GKMLLSNNLAGKRGTEDLDFYIGNEALVAAQS 116

Query: 58  -----RRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLS 107
                  P   GQ+ +W+      E++I+ Y    PE+            + +++E  L+
Sbjct: 117 PSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED-----------HYFLLTEPPLN 165

Query: 108 LPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQ 167
            PE    +  I FE +N   +Y                                     Q
Sbjct: 166 PPENREQVAEIFFESFNCAGLY----------------------------------IAVQ 191

Query: 168 LVTNDLNTYISSE--EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIG 225
            V     ++ SS+  + S+T T        +IDSG   T +IPV +G     AIK + I 
Sbjct: 192 AVLALAASWTSSKVIDRSLTGT--------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIA 243

Query: 226 GRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPD 284
           GR +T  ++  L  R     D ++     IK++  +V P    E  K   +       P+
Sbjct: 244 GRDITEFIQSLL--RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQ-------PE 294

Query: 285 FHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKPGIIETII-ES 341
               F+  ++   KTK     +++ +  E F   E  F+PEI  S  L P  + T++ ++
Sbjct: 295 KFAQFI--VESQEKTK----QKVVDVGYERFLAPEIFFNPEIASSDYLTP--LPTVVDQT 346

Query: 342 LSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ-----RQLPTDWTTHVYIPKIDA 396
           +   P  +R  + NNIV  GG+    +FS+RL  +++     R    +  T V    +D 
Sbjct: 347 IQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDV 406

Query: 397 ELFG--------WKAMAQFSDTDSYRKARITREEYMEHGVE 429
           ++          W   +  + T  +R    T+ +Y E G E
Sbjct: 407 QVISHRKQRNAVWFGGSLLAQTAEFRGYCHTKRDYEEIGPE 447

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 69/140 (49%), Gaps = 13/140 (9%)

Query: 313 ELFSVTETIFHPEISRILKPGIIETIIESLSM---------LPEVIRPLMVNNIVCIGGN 363
           E   V E IF P I  + + GI+E + E+L +         L E+ + +M  NI   GGN
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRELSEISK-MMAKNIFITGGN 666

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS-YRKARITREE 422
             LP   +R+  E    LP     +V + + D  +  W+ MA+F++  S Y  + +T++E
Sbjct: 667 AKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSAWRGMAKFANNTSLYETSIMTKKE 725

Query: 423 YMEHGVEWCTKHRFGYQNWI 442
           Y E G E+  +H  G   ++
Sbjct: 726 YEELGPEYIKEHNLGNAKFV 745

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 97/257 (37%), Gaps = 59/257 (22%)

Query: 3   DLPIVIDNGSYEIKFGVSNSRIP---FRAINAIAKDKYNT---VYLSNQIKGIKDISSVN 56
           D PI ID GSYE++ G  N   P   F    A  +D+  +    ++ N     + I + +
Sbjct: 36  DTPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSIRTQS 95

Query: 57  FRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNID 116
            + P++   +T+W+    I  Y F++ +      + +     ++I+E   +L     N  
Sbjct: 96  -KSPFDGSMITNWDYVDDILAYTFHHLDVRGNGGVPNP----VLITERMAALQSQRSNWY 150

Query: 117 HIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTY 176
            ++FE YN                 L K    I                     + L ++
Sbjct: 151 ELLFECYN-----------------LQKVTFGI---------------------DSLFSF 172

Query: 177 ISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKET 236
                P  T  A        I+SG   T +IPV+ G       K+++ GG+   G L   
Sbjct: 173 YGEHPPGTTGIA--------INSGNEDTSVIPVVNGKGILTEAKRINWGGQQSVGYLNGL 224

Query: 237 LSFRHYNVTDETILVNN 253
           LS ++      T LVNN
Sbjct: 225 LSLKYPYFP--TKLVNN 239

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 95/420 (22%), Positives = 158/420 (37%), Gaps = 108/420 (25%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 101 YIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 150

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y +  A     A  T   ++       
Sbjct: 151 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVT------- 202

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 203 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 229

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNK 275
             AIK + I GR +T  +++ L  R    T         +E C                 
Sbjct: 230 GSAIKNIPIAGRDITLFIQQLLRERGEQDTSLKTAERIKQEYC----------------- 272

Query: 276 TAVEYVLPDFHTTFMGYIKDNSK-------TKLPDNAQLITLKDELFSVTETIFHPEI-- 326
               YV PD    F  + +D SK       ++     +++ +  E F   E  F+PEI  
Sbjct: 273 ----YVCPDIVKEFNKFDRDASKFAQFVVESQEKTRKKIVDVGYERFLAPEIFFNPEIAS 328

Query: 327 SRILKPGIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ------- 378
           S  L P  + T++ E++   P  +R  + NNIV  GG+    +F +RL  +++       
Sbjct: 329 SDFLTP--LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDMKSIVNNRI 386

Query: 379 ---RQLPTDWTTHVYIPKI------DAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
                L    +T V +  I      +A  FG   +AQ ++  SY     T+++Y E+G E
Sbjct: 387 AQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH---TKKDYDEYGPE 443

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 8/132 (6%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE----TIIESLSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E +F P +    + G+ E     +++     P  +      M NNI   GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYME 425
           +P    R+  E    LP      V +   D  L  WK MA+++ ++ Y K+ IT++EY E
Sbjct: 673 VPGLKNRIVKEFTSFLPVGTKLSVNMSS-DPLLDSWKGMAKWAKSEDYNKSFITKKEYEE 731

Query: 426 HGVEWCTKHRFG 437
           +G E+  +H+ G
Sbjct: 732 YGPEYIKEHKMG 743

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 68/141 (48%), Gaps = 15/141 (10%)

Query: 308 ITLKDELFSVTETIFHPEISRILKPGIIE----TIIESLSMLPEVIRPL---MVNNIVCI 360
           I L  E   V E +F P +  + + GI E     ++      P+ +  L   M NNI   
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYI---PKIDAELFGWKAMAQFSDTDS-YRKA 416
           GGN  +P   +R+  E +  LP +   +V +   P  DA    W  MA+ +  ++ Y+K 
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNTQFNVNMTSDPTFDA----WNGMAKLAQNETDYKKT 726

Query: 417 RITREEYMEHGVEWCTKHRFG 437
            I+++EY E+G E+  +H+ G
Sbjct: 727 IISKKEYEEYGPEYIKEHKLG 747

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 63/135 (46%), Gaps = 13/135 (9%)

Query: 313 ELFSVTETIFHPEISRILKPGIIETIIES---------LSMLPEVIRPLMVNNIVCIGGN 363
           E   V E IF P ++ + + G+ E I E+          S L E  + L  N +   GGN
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTE-ICETNFLKKFGSTRSQLSEGSKKLAAN-VFLTGGN 666

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS-YRKARITREE 422
             LP   +R+  E    LP     +V +   D+ +  W+ MA+ S   S Y+ + ITR+E
Sbjct: 667 MRLPGVRERIVREFTGMLPMGSNLNVRMAS-DSAVDAWRGMAKLSQAGSQYKGSYITRKE 725

Query: 423 YMEHGVEWCTKHRFG 437
           Y E G ++  +H  G
Sbjct: 726 YQELGADYIKEHNLG 740

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 3   DLPIVIDNGSYEIKFGVSNSRIPFRAI-NAIAK-----DKYNTVYLSNQIKGIKDISSVN 56
           ++PI ID GS E++ G  N   P     N I++        N  ++ N       + S  
Sbjct: 36  NVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRS-Q 94

Query: 57  FRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNID 116
            + PY+   +++W+    I +Y F++     G    D     ++++E   +L     N  
Sbjct: 95  AKSPYDGAIVSNWDYTEEIMEYTFHHL----GVNGNDGVSNPILMTEKLATLQSQRENWY 150

Query: 117 HIIFE 121
            ++FE
Sbjct: 151 QLLFE 155

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 95/418 (22%), Positives = 164/418 (39%), Gaps = 104/418 (24%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+       +S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 100 YIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 149

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    I  I FE +N   +Y                          
Sbjct: 150 -HFFLLTEPPLNPPENREQIAEIFFESFNCAGLY-------------------------- 182

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSE--EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGI 213
                      Q V     ++ SS+  + S+T T        +IDSG   T +IPV +G 
Sbjct: 183 --------IAVQAVLALAASWTSSKVVDRSLTGT--------VIDSGDGVTHVIPVAEGY 226

Query: 214 PYYKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAE--SF 270
               AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E   F
Sbjct: 227 VIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKF 284

Query: 271 KLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SR 328
               +   +YV           +++  KT+     +++ +  E F   E  F+PEI  S 
Sbjct: 285 DRDPEKFAQYV-----------VENQEKTQ----KKVVDVGYERFLAPEIFFNPEIASSD 329

Query: 329 ILKPGIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ--------- 378
            L P  + TI+ +++   P  +R  + NNIV  GG+    +F +RL  +L+         
Sbjct: 330 FLTP--LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQ 387

Query: 379 -------RQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
                  +    D +   +  + +A  FG   +AQ ++  SY     T+++Y E+G E
Sbjct: 388 NELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKSYCH---TKKDYEEYGPE 442

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 92/411 (22%), Positives = 156/411 (37%), Gaps = 94/411 (22%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 103 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 152

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE  + +  I FE +N   +Y +  A     A  T   ++       
Sbjct: 153 -HFFLLTEPPLNPPENRQQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------- 204

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 205 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 231

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 232 GSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERIKQEYCYVCPDIVKEFNKFDR 289

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
            +            F  +I +N   K     +++ +  E F   E  F+PEI  S  L P
Sbjct: 290 DSE----------KFAQFIVEN---KERTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP 336

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ-------------- 378
            +   + E++   P  +R  + NNIV  GG+    +F +RL  +L+              
Sbjct: 337 -LPVVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLS 395

Query: 379 --RQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHG 427
             R    D +   +  + +A  FG   +AQ  +  SY     T+++Y E+G
Sbjct: 396 GTRSTGVDVSVISHKRQRNAVWFGGSLLAQTGEFKSYCH---TKQDYEEYG 443

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 65/144 (45%), Gaps = 9/144 (6%)

Query: 302 PDNAQLITLKDELFSVTETIFHPEISRILKPGIIET----IIESLSMLPEVIRPL---MV 354
           P     I +  E   V E +F P I    + GI E      +   +  P  +  +   M+
Sbjct: 611 PHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERML 670

Query: 355 NNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQF-SDTDSY 413
           NN+   GG+  LP   +R+  E    LP      + I   D  L  WK MA+  S+TD  
Sbjct: 671 NNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINISN-DPSLDTWKGMAKLASNTDYL 729

Query: 414 RKARITREEYMEHGVEWCTKHRFG 437
           +K ++T+++Y E+G E+  +H  G
Sbjct: 730 KKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 95/247 (38%), Gaps = 58/247 (23%)

Query: 3   DLPIVIDNGSYEIKFGVSNSRIPFRAI-NAIAKDKYNTVYLSNQIKGIKDISS------V 55
           D+PI ID GSY +K G +N  +P     N +   +Y    L+  +  I + ++      +
Sbjct: 36  DIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLT--RYRDRKLAKTMTFIGNDTNLDQPLRI 93

Query: 56  NFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTS-KKHLVISETCLSLPEFSRN 114
             +RPY+   + +WE    I+DY  ++     G Q  + S    ++++E    L     N
Sbjct: 94  QAKRPYDGLFIANWEYAEEIFDYTLHHL----GVQTTNGSISNPIILTEKMACLQSQRAN 149

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
              ++FE ++            +P A    D +                       N  N
Sbjct: 150 WYQLLFETFD------------VPSATFGLDSLYA------------------FYNNCAN 179

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLK 234
            + S                L+I+ G   T I+P+++G       K+++ GGR  T  L 
Sbjct: 180 PFESD--------------GLVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLS 225

Query: 235 ETLSFRH 241
             L+ ++
Sbjct: 226 SLLTLKY 232

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 95/412 (23%), Positives = 157/412 (38%), Gaps = 96/412 (23%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+  W       E++I+ Y    PE+          
Sbjct: 102 YIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFKYLRTEPED---------- 151

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y +  A     A  T   ++       
Sbjct: 152 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------- 203

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 204 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 230

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 231 GSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDR 288

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
                       T F  +I +N   K     +++ +  E F   E  F+PEI  S  L P
Sbjct: 289 DA----------TKFAQFIVEN---KEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP 335

Query: 333 GIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ----------RQL 381
             + T++ +++   P  +R  + NNIV  GG+    +F +RL  +L+            L
Sbjct: 336 --LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLRSIVNNRIAQSELL 393

Query: 382 PTDWTTHVYIPKI------DAELFGWKAMAQFSDTDSYRKARITREEYMEHG 427
               +T V +  I      +A  FG   +AQ ++  SY     T+++Y E+G
Sbjct: 394 SGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH---TKKDYEEYG 442

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 110/260 (42%), Gaps = 52/260 (20%)

Query: 196 IIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETILVNNIK 255
           +IDSG   T +IPV +G     AIK + I GR +T  +++ L  R    T         +
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEEDTSLRTAERIKQ 276

Query: 256 EKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK-------TKLPDNAQLI 308
           E C                     YV PD    F  + +D+ K       ++     +++
Sbjct: 277 EYC---------------------YVCPDIVKEFNKFDRDSEKFAQFVVESQEKTRRKVV 315

Query: 309 TLKDELFSVTETIFHPEI--SRILKPGIIETIIE-SLSMLPEVIRPLMVNNIVCIGGNFN 365
            +  E F   E  F+PEI  S  L P  + TI++ ++   P  +R  + NNIV  GG+  
Sbjct: 316 DVGCERFMAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTM 373

Query: 366 LPNFSKRLTSELQ-----RQLPTDWTTHVYIPKIDAEL-----------FGWKAMAQFSD 409
             +F +RL  +L+     R + +++ +      +D ++           FG   +AQ ++
Sbjct: 374 FKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAE 433

Query: 410 TDSYRKARITREEYMEHGVE 429
             SY     T+++Y E G E
Sbjct: 434 FKSYCH---TKKDYEEIGPE 450

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 95/414 (22%), Positives = 161/414 (38%), Gaps = 96/414 (23%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 109 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 158

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    I  I FE +N   +Y +  A     A  T   ++       
Sbjct: 159 -HFFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------- 210

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 211 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 237

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 238 GSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERIKQEYCYVCPDIVKEFNKFDR 295

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
                       + F  +I +N +       +++ +  E F   E  F+PEI  S  L P
Sbjct: 296 D----------GSKFAQFIVENQEQT---RKKVVDVGYERFLAPEIFFNPEIASSDFLTP 342

Query: 333 GIIETIIE-SLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ----------RQL 381
             + T+++ ++   P  +R  + NNIV  GG+    +F +RL  +L+           +L
Sbjct: 343 --LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERL 400

Query: 382 PTDWTTHVYIPKI------DAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
               +T V +  I      +A  FG   +AQ ++  SY     T+++Y E+G E
Sbjct: 401 SGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH---TKKDYEEYGPE 451

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 109/252 (43%), Gaps = 36/252 (14%)

Query: 196 IIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETILVNNIK 255
           +IDSG   T +IPV +G     A+K + I GR +T  ++  L  R   V         IK
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERG-EVDTSLRTAERIK 275

Query: 256 EKCLFVAPKSYAE--SFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDE 313
           ++  +V P    E   F    +   +YV+ +         +D ++ K+ D      +  E
Sbjct: 276 QEYCYVCPDIVKEFNKFDRDAEKFAQYVVEN---------QDKTRQKVVD------IGYE 320

Query: 314 LFSVTETIFHPEI--SRILKPGIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFS 370
            F   E  F+PEI  S  L P  + T++ +++   P  +R  + NNIV  GG+    +F 
Sbjct: 321 RFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 378

Query: 371 KRLTSELQ-----RQLPTDWTTHVYIPKIDAELFG--------WKAMAQFSDTDSYRKAR 417
           +RL  +L+     R   T+  +      +D ++          W   +  + T  ++   
Sbjct: 379 RRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYC 438

Query: 418 ITREEYMEHGVE 429
            T+++Y E+G E
Sbjct: 439 HTKKDYEEYGPE 450

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 91/414 (21%), Positives = 160/414 (38%), Gaps = 96/414 (23%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 145

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y +  A     A  T   ++       
Sbjct: 146 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------- 197

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 198 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 224

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 225 GSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDR 282

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
                   P     F+  +++  KT+     +++ +  E F   E  F+PEI  S  L P
Sbjct: 283 D-------PSKFAQFV--VENQEKTR----RKVVDIGYERFLAPEIFFNPEIASSDFLTP 329

Query: 333 GIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ------------- 378
             + T++ +++   P  +R  + NNIV  GG+    +F +RL  +L+             
Sbjct: 330 --LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELL 387

Query: 379 ---RQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
              +    D +   +  + +A  FG   +AQ ++   Y     T+++Y E+G E
Sbjct: 388 SGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH---TKKDYEEYGPE 438

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 103/449 (22%), Positives = 169/449 (37%), Gaps = 108/449 (24%)

Query: 17  FGVSNSRIPFRAINAIAKDKYNTV----------YLSNQIKGIKDISSVNFRRPYELGQL 66
           FG S S   F ++ + A    N            Y+ N+        S +   P   GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  TSWE-----LESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFE 121
            +W+      E++I+ Y    PE+              +++E  L+ PE    +  I FE
Sbjct: 124 ENWDHMERFWENSIFKYLRTEPED-----------HFFLLTEPPLNPPENREQVAEIFFE 172

Query: 122 EYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYISSEE 181
            +N   +Y                 I++           ++K  ++ +T           
Sbjct: 173 SFNCAGLY-----------------IAVQAVLALAASWTSSKVVDRSLTG---------- 205

Query: 182 PSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRH 241
                         +IDSG   T +IPV +G     AIK + I GR +T  ++  L  R 
Sbjct: 206 -------------TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RE 250

Query: 242 YNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNS-KT 299
               D T+     IK++  +V      E  K                 F  +I +NS KT
Sbjct: 251 RGEEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDP----------QKFAQFIVENSEKT 300

Query: 300 KLPDNAQLITLKDELFSVTETIFHPEI--SRILKPGIIETII-ESLSMLPEVIRPLMVNN 356
           K     ++I +  E F   E  F+PEI  S  L P  + T++ +++   P  +R  + NN
Sbjct: 301 K----RKVIDVGYERFLAPEIFFNPEIASSDFLTP--LPTVVDQTIQACPIDVRKGLYNN 354

Query: 357 IVCIGGNFNLPNFSKRLTSELQ----------RQLPTDWTTHVYIPKI------DAELFG 400
           IV  GG+    +F +RL  +L+            L    +T V +  I      +A  FG
Sbjct: 355 IVLSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFG 414

Query: 401 WKAMAQFSDTDSYRKARITREEYMEHGVE 429
              +AQ ++  SY     T+++Y E G E
Sbjct: 415 GSLLAQTAEFKSYCH---TKQDYEEIGPE 440

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 93/416 (22%), Positives = 160/416 (38%), Gaps = 100/416 (24%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 101 YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 150

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    I  I FE +N   +Y +  A     A  T   ++       
Sbjct: 151 -HFFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVT------- 202

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                                    + S+T T        +IDSG   T +IPV +G   
Sbjct: 203 -------------------------DRSLTGT--------VIDSGDGVTHVIPVAEGYVI 229

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAE--SFKL 272
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E   F  
Sbjct: 230 GSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDR 287

Query: 273 KNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRIL 330
             +   ++V+ +  +T                 +++ +  E F   E  F+PEI  S  L
Sbjct: 288 DGEKFAQFVVENQEST---------------RKKIVDVGYERFLAPEIFFNPEIASSDFL 332

Query: 331 KPGIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ----------R 379
            P  + T++ +++   P  +R  + NNIV  GG+    +F +RL  +L+           
Sbjct: 333 TP--LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRIAQSE 390

Query: 380 QLPTDWTTHVYIPKI------DAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
            L    +T V +  I      +A  FG   +AQ ++   Y     T+++Y E+G E
Sbjct: 391 MLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEFKGYCH---TKKDYDEYGPE 443

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 88/414 (21%), Positives = 159/414 (38%), Gaps = 96/414 (23%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 145

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y                 I++      
Sbjct: 146 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLY-----------------IAVQAVLAL 187

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                ++K  ++ +T                         +IDSG   T +IPV +G   
Sbjct: 188 AASWTSSKVTDRSLTG-----------------------TVIDSGDGVTHVIPVAEGYVI 224

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 225 GSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDK 282

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
                   P     F+  +++  KT+     +++ +  E F   E  F+PEI  S  L P
Sbjct: 283 D-------PSKFAQFV--VENQEKTR----RKVVDIGYERFLAPEIFFNPEIASSDFLTP 329

Query: 333 GIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ------------- 378
             + T++ +++   P  +R  + NNIV  GG+    +F +RL  +L+             
Sbjct: 330 --LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELL 387

Query: 379 ---RQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
              +    D +   +  + +A  FG   +AQ ++   Y     T+++Y E+G E
Sbjct: 388 SGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH---TKKDYEEYGPE 438

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/413 (21%), Positives = 157/413 (38%), Gaps = 94/413 (22%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 145

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y                 I++      
Sbjct: 146 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLY-----------------IAVQAVLAL 187

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                ++K  ++ +T                         +IDSG   T +IPV +G   
Sbjct: 188 AASWTSSKVTDRSLTG-----------------------TVIDSGDGVTHVIPVAEGYVI 224

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 225 GSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDR 282

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
                   P     F+  +++  KT+     +++ +  E F   E  F+PEI  S  L P
Sbjct: 283 D-------PSKFAQFV--VENQEKTR----RKVVDIGYERFLAPEIFFNPEIASSDFLTP 329

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ-------------- 378
            +   + +++   P  +R  + NNIV  GG+    +F +RL  +L+              
Sbjct: 330 -LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNSRIAQSELLS 388

Query: 379 --RQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
             +    D +   +  + +A  FG   +AQ ++   Y     T+++Y E+G E
Sbjct: 389 GTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH---TKKDYEEYGPE 438

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 9/137 (6%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE----TIIESLSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E  F P +    + G+ E     ++      P  +  +   M  N+   GGN  
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS-YRKARITREEYM 424
           +P   +R+  E    LP + + +V I   D  L  W+ MA+++  ++ Y+K+ I+++EY 
Sbjct: 672 IPGLRERIVKEFTGFLPVNTSFNVNISS-DPSLDAWRGMAKYAQNETDYKKSFISKKEYE 730

Query: 425 EHGVEWCTKHRFGYQNW 441
           E+G ++  +H+ G  N+
Sbjct: 731 EYGPDYIKEHKLGNMNY 747

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 88/414 (21%), Positives = 158/414 (38%), Gaps = 96/414 (23%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ N+        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 96  YIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 145

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
               +++E  L+ PE    +  I FE +N   +Y                 I++      
Sbjct: 146 -HFFLLTEPPLNPPENREQVAEIFFESFNCAGLY-----------------IAVQAVLAL 187

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                ++K  ++ +T                         +IDSG   T +IPV +G   
Sbjct: 188 AASWTSSKVTDRSLTG-----------------------TVIDSGDGVTHVIPVAEGYVI 224

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D ++     IK++  +V P    E  K   
Sbjct: 225 GSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDR 282

Query: 275 KTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEI--SRILKP 332
                   P     F+  +++  KT+     + + +  E F   E  F+PEI  S  L P
Sbjct: 283 D-------PSKFAQFV--VENQEKTR----RKAVDIGYERFLAPEIFFNPEIASSDFLTP 329

Query: 333 GIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ------------- 378
             + T++ +++   P  +R  + NNIV  GG+    +F +RL  +L+             
Sbjct: 330 --LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELL 387

Query: 379 ---RQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVE 429
              +    D +   +  + +A  FG   +AQ ++   Y     T+++Y E+G E
Sbjct: 388 SGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCH---TKKDYEEYGPE 438

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 9/133 (6%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE----TIIESLSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E +F P +    + GI E     +++     P  +      MVNN+   GGN  
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS-DTDSYRKARITREEYM 424
           +P   +R+  E    LP      V +   D  L  WK MA  + + + Y+K  I+++EY 
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVNMSS-DPSLDAWKGMAALAQNKEEYKKTVISKKEYE 735

Query: 425 EHGVEWCTKHRFG 437
           E+G ++  +H+ G
Sbjct: 736 EYGPDYIKEHKLG 748

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 52/244 (21%), Positives = 95/244 (38%), Gaps = 56/244 (22%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIP---FRAINAIAKDKY---NTVYLSNQIKGIKDISSVNF 57
           +PI ID GS +++ G  N   P   F  +    +D+    N  ++ N     + + S + 
Sbjct: 38  VPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS- 96

Query: 58  RRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDH 117
           R P++   +T+W     I DY F++     G    +  +  ++++E   ++     N   
Sbjct: 97  RSPFDGPFVTNWNFTEEIMDYTFHHL----GVSPNNGVRNPILLTERMATVQSQRANWYQ 152

Query: 118 IIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYI 177
           I+FE YN        V G      +T  + S+ G                          
Sbjct: 153 IMFETYN--------VPG------VTFGIDSLYG-------------------------F 173

Query: 178 SSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETL 237
            ++  S  KT       L+ID G   T +IPV+ G       K+++ GGR     L + +
Sbjct: 174 YNQNTSGNKTG------LVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLM 227

Query: 238 SFRH 241
           + ++
Sbjct: 228 ALKY 231

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 10/133 (7%)

Query: 313 ELFSVTETIFHPEISRILKPGIIETIIESL--------SMLPEVIRPLMVNNIVCIGGNF 364
           E     E IF P +  + + GI E     L        S L +     M +NI   GGN 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD-MASNIFITGGNT 669

Query: 365 NLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYM 424
            +PN  +R+ +E    LP +   +V   + +  L  WK MA+F+ +D+Y    +T+ EY 
Sbjct: 670 KIPNLRERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFARSDTYSSTCVTKVEYE 728

Query: 425 EHGVEWCTKHRFG 437
           E G  +  +H+ G
Sbjct: 729 EFGPNYIKEHKLG 741

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 88/249 (35%), Gaps = 69/249 (27%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPF------------RAINAIAKDKYNTVYLSNQIKGIKDI 52
           PI +D GSYE++ G ++   P             R I        N   L N ++     
Sbjct: 41  PIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRS---- 96

Query: 53  SSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFS 112
              + R PY+   +T+WE    +  Y F++     G Q  D     ++++E   ++    
Sbjct: 97  ---HSRSPYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMATVQAQR 149

Query: 113 RNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTND 172
            N   ++FE Y    +                    I G                     
Sbjct: 150 SNWYQLLFECYGIPQV-----------------TFGIDG--------------------- 171

Query: 173 LNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGL 232
           L ++ ++  P  T         LII+SG   T IIPVIKG       K++D GG      
Sbjct: 172 LFSFYANNSPDSTG--------LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDY 223

Query: 233 LKETLSFRH 241
           LK  LS ++
Sbjct: 224 LKSLLSLKY 232

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 17/137 (12%)

Query: 313 ELFSVTETIFHPEISRILKPGIIETIIESLSMLP--------EVIRPLMVNNIVCIGGNF 364
           E   V E +F P +    + GI E + E++ M                MVNNI+  GGN 
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICE-LSETILMKKFGSQRGKLSSTSLDMVNNILITGGNA 675

Query: 365 NLPNFSKRLTSELQRQLPTDWTTHVYI---PKIDAELFGWKAMAQFSDTDS-YRKARITR 420
            +P   +R+  E    LP      V I   P +DA    W+ MA  +   + Y+K  I++
Sbjct: 676 KVPGLRERIVKEFTEFLPVGTNVAVNISSNPSLDA----WRGMAALARNKAEYKKTVISK 731

Query: 421 EEYMEHGVEWCTKHRFG 437
           EEY E+G ++  +H+ G
Sbjct: 732 EEYEEYGPDYIKEHKLG 748

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 49/244 (20%), Positives = 89/244 (36%), Gaps = 56/244 (22%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIP---FRAINAIAKDKY---NTVYLSNQIKGIKDISSVNF 57
           LPI ID GS  ++ G  N   P   F  +    +D+    N  ++ N     + + S + 
Sbjct: 38  LPIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS- 96

Query: 58  RRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDH 117
           R P++   +T+W     I DY F++     G    +     ++++E   ++     N   
Sbjct: 97  RSPFDGPFVTNWNFTEEIMDYTFHHL----GVLPNNGISNPILLTERMATVQSQRANWYQ 152

Query: 118 IIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYI 177
           I+FE YN        V G           ++    +      NN                
Sbjct: 153 ILFETYN--------VPG-----------VTFGIDSLYSFYNNN---------------- 177

Query: 178 SSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETL 237
               PS  KT       L+ID     T ++P++ G       K+++ GG      L + +
Sbjct: 178 ----PSGNKTG------LVIDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

Query: 238 SFRH 241
           + ++
Sbjct: 228 ALKY 231

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 111/255 (43%), Gaps = 42/255 (16%)

Query: 196 IIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNI 254
           +IDSG   T +IPV +G     AIK + I GR +T  ++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 255 KEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDN-SKTKLPDNAQLITLKDE 313
           K++  +V P    E  K                 F  +I +N  KT+     +++ +  E
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVG----------KFSQFIIENQGKTQ----KKIVDVGYE 317

Query: 314 LFSVTETIFHPEI--SRILKPGIIETIIE-SLSMLPEVIRPLMVNNIVCIGGNFNLPNFS 370
            F   E  F+PEI  S  L P  + TI++ ++   P  +R  + +NIV  GG+    +F 
Sbjct: 318 RFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFG 375

Query: 371 KRLTSELQ-----RQLPTDWTTHVYIPKIDAEL-----------FGWKAMAQFSDTDSYR 414
           +RL  +L+     R   ++  +      +D ++           FG   +AQ ++  SY 
Sbjct: 376 RRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYC 435

Query: 415 KARITREEYMEHGVE 429
               T+ +Y E+G E
Sbjct: 436 H---TKRDYEEYGPE 447

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 136/348 (39%), Gaps = 79/348 (22%)

Query: 41  YLSNQIKGIKDISSVNFRRPYELGQLTSWE-----LESAIWDYCFYNPEEFDGFQLEDTS 95
           Y+ ++        S +   P   GQ+ +W+      E++I+ Y    PE+          
Sbjct: 92  YIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPED---------- 141

Query: 96  KKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXX 155
             + +++E  L+ PE    +  I FE +N   +Y                 I++      
Sbjct: 142 -HYFLLTEPPLNPPENREQVAEIFFESFNCAGLY-----------------IAVQAVLAL 183

Query: 156 XXXXNNAKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPY 215
                ++K  ++ +T                         +IDSG   T +IPV +G   
Sbjct: 184 AASWTSSKVVDRSLTG-----------------------TVIDSGDGVTHVIPVAEGYVI 220

Query: 216 YKAIKKMDIGGRFLTGLLKETLSFRHYNVTDETI-LVNNIKEKCLFVAPKSYAESFKLKN 274
             AIK + I GR +T  ++  L  R     D T+     IK++  +V      E  K   
Sbjct: 221 GSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERIKQEYCYVCSDIVKEFNKFDR 278

Query: 275 KTAVEYVLPDFHTTFMGYIKDNS-KTKLPDNAQLITLKDELFSVTETIFHPEI--SRILK 331
            +            F  +I +NS KT+     ++I +  E F   E  F+PEI  S  L 
Sbjct: 279 DSE----------KFAQFIVENSEKTR----RKVIDVGYERFLAPEIFFNPEIASSDFLT 324

Query: 332 PGIIETII-ESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQ 378
           P  + TI+ +++   P  +R  + NNIV  GG+    +F +RL  +L+
Sbjct: 325 P--LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 370

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 62/135 (45%), Gaps = 13/135 (9%)

Query: 313 ELFSVTETIFHPEISRILKPGI---IETIIESLSMLPEVIRPL------MVNNIVCIGGN 363
           E   V E +F P +    + GI    ET++  L       R L      M  N+   GGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS-DTDSYRKARITREE 422
             LP   +R+  E    LP+     +   + D  L  W+ MA+ + +T+ ++   IT++E
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIRKSQ-DPSLDAWRGMAKLAQNTEDFKHGYITKQE 727

Query: 423 YMEHGVEWCTKHRFG 437
           Y+E+G E+  +H  G
Sbjct: 728 YLEYGPEYIKEHNLG 742

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 61/133 (45%), Gaps = 9/133 (6%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE----TIIESLSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E +F P +    + GI E     +++     P  +      M NN+   GGN  
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFITGGNAK 676

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFS-DTDSYRKARITREEYM 424
           +P   +R+  E    LP     ++ +   D  L  WK MA  + + + Y++  I+R+EY 
Sbjct: 677 VPGLKERIVKEFTGFLPVGTNININMSS-DPSLDAWKGMAALAQNEEEYKRTIISRKEYE 735

Query: 425 EHGVEWCTKHRFG 437
           E+G ++  +H+ G
Sbjct: 736 EYGPDYIKEHKLG 748

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 93/247 (37%), Gaps = 62/247 (25%)

Query: 4   LPIVIDNGSYEIKFGVSNSRIPFRAI-NAIAKDK-----YNTVYLSNQI---KGIKDISS 54
           LPI ID GS +++ G  N   P     N + K +      N  ++ N     + ++  S 
Sbjct: 38  LPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSK 97

Query: 55  VNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRN 114
             F  P+    +T+W     I DY F++     G   E+     ++++E   ++     N
Sbjct: 98  SPFDGPF----VTNWNFTEEILDYTFHHL----GIVPENGISNPILLTERMATVQSQRAN 149

Query: 115 IDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLN 174
              I+FE YN        V G      +T  + S+ G                      N
Sbjct: 150 WYQILFETYN--------VPG------VTFGIDSLYGF--------------------YN 175

Query: 175 TYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLK 234
            Y     PS  +T       L+ID G   T +IP++ G       K+++ GG      L 
Sbjct: 176 YY-----PSGKQTG------LVIDCGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLN 224

Query: 235 ETLSFRH 241
           + ++ ++
Sbjct: 225 DLMALKY 231

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 15/135 (11%)

Query: 313 ELFSVTETIFHPEISRILKPGIIET----IIESLSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E +F P +    + GI E     I +     P  +      M  N+  +GGN  
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYI---PKIDAELFGWKAMAQFSDT-DSYRKARITRE 421
           +P    R+  E    LP+D   +V I   P +D     W  M + ++T + Y++  +T E
Sbjct: 677 VPGLKSRVVKEFTEFLPSDTKINVNISEAPTLDV----WNGMYRLANTEEDYQRTIVTSE 732

Query: 422 EYMEHGVEWCTKHRF 436
           EY E GV++  +H+ 
Sbjct: 733 EYDECGVDYLKEHKL 747

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 60/142 (42%), Gaps = 10/142 (7%)

Query: 3   DLPIVIDNGSYEIKFGVSNSRIPFRAI-NAIAK--DKYNTVYLS--NQIKGIKDISSVNF 57
           ++PI ID GSYE++ G +N   P     N  +K  D+    YL        +   +    
Sbjct: 40  NIPIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQA 99

Query: 58  RRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDH 117
           R P++   + +W++   I  Y F++     G Q ++     ++I+E    L     N   
Sbjct: 100 RSPFDGPLVVNWDMVEDILQYTFHHL----GVQPDNGVTNPIIINEKLACLQSQRSNWYQ 155

Query: 118 IIFEEYNYGSIYKSPVAGFIPF 139
            +FE +    +  + V G + F
Sbjct: 156 TLFESFGVPKVSMA-VEGMLAF 176

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 332 PGIIETIIESLSMLPEV-IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHV 389
           PGI++ +IES  M  +V +R  + +NIV  GG   +P FS RL  EL ++LP   +    
Sbjct: 395 PGIVD-LIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLT 453

Query: 390 YIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
                + +   W   +  S   ++ +  + ++EY E G +   K RF
Sbjct: 454 TGQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 86/260 (33%), Gaps = 81/260 (31%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYL-----------------SNQIKG 48
           +VID GS+    G S +  P     AI    Y  + L                 +N+ K 
Sbjct: 17  VVIDPGSFTTNIGYSGTDCP----QAILPSYYGEISLKEVASEGNEEIEENSASNNKSKK 72

Query: 49  IKDISSVNFRRP-YEL------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVI 101
           I    S+N+ R  YE+      G++  W+     WD+   N        LE  S     +
Sbjct: 73  IFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKN-----ALYLESNSGIPAFL 127

Query: 102 SETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNN 161
           +E   +  E  +    ++ E   + + Y SP    I FA         SG+         
Sbjct: 128 TEPIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFA---------SGRPNC------ 172

Query: 162 AKFQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKK 221
                                            L++D G +   + PVI G+   K+  +
Sbjct: 173 ---------------------------------LVVDIGHDVASVSPVIDGMTLSKSSMR 199

Query: 222 MDIGGRFLTGLLKETLSFRH 241
             I GRF+   +KE L  R 
Sbjct: 200 NFISGRFINEKIKEFLKPRE 219

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/302 (19%), Positives = 113/302 (37%), Gaps = 65/302 (21%)

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETL--- 237
           EP     +  ++  L++D G +   + P+I G     A+ +    G FL   + E L   
Sbjct: 127 EPLAISLSLGRNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNS 186

Query: 238 --------------SFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLP 283
                         SF+++  +     +++ K   L V+P    E   +++  A  +   
Sbjct: 187 LPIEPAGEDSKVPESFKYWESS--RTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPL 244

Query: 284 DFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISR---ILKPGIIETIIE 340
           D    F+ Y K N    L         + E + + E +F P+++      K G+ E +++
Sbjct: 245 DNKKYFL-YKKGNKTLTLE--------QRECYKLAEMLFQPQLASDQFAAKEGLAELVVK 295

Query: 341 SL--------------------------------SMLPEVIRPLMVNNIVCIGGNFNLPN 368
           ++                                +  PE I   ++ NIV  G    +P 
Sbjct: 296 AVKKAGAAVTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPG 355

Query: 369 FSKRLTSELQRQLPTDWTTHVYIPKI-DAELFGWKAMAQFSDTDSYRKAR-ITREEYMEH 426
             +R+ +EL  Q P    +    P + D +L  W+     S+  S+     ITR+EY  +
Sbjct: 356 VEQRIVNELSYQFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDAN 415

Query: 427 GV 428
           G+
Sbjct: 416 GI 417

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 9/133 (6%)

Query: 313 ELFSVTETIFHPEISRILKPGI---IETIIES-LSMLPEVIRPL---MVNNIVCIGGNFN 365
           E   V E +F P I    + GI    ETI+ +     P  +      M  NI   GG+  
Sbjct: 614 ERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLTGGHSK 673

Query: 366 LPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS-YRKARITREEYM 424
           LP   +R+  E    LP      V + K +  L  W  M + +  ++ Y+ + I++++Y 
Sbjct: 674 LPGLRERIVKEFTGFLPVGTKLGVKMSK-NPSLDAWYGMRKLAQNEADYKDSIISKKDYE 732

Query: 425 EHGVEWCTKHRFG 437
           E+G E+  +H+ G
Sbjct: 733 EYGAEYIKEHKLG 745

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 97/243 (39%), Gaps = 57/243 (23%)

Query: 5   PIVIDNGSYEIKFGVSNSRIPFRAI-NAIAKDKYNTV-----YLSNQIKGIKDISSVNFR 58
           PI ID GSYE++ G ++S IP     N + + +   +     ++ N +   + + S + +
Sbjct: 38  PIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS-K 96

Query: 59  RPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHI 118
            P++   + +W+    I  Y F +     G   +++ +  L+I+E   SL    +N   +
Sbjct: 97  SPFDGSFIANWDYVEDIMQYTFNHL----GVVGDNSVRNPLIINEPLGSLQSQRKNWYEL 152

Query: 119 IFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYIS 178
           +FE ++  ++    + G   F                    NN   Q+ +V N      S
Sbjct: 153 LFECFHLPNVSFG-IDGMFGF------------------YANNEGNQDGIVIN-----CS 188

Query: 179 SEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238
           +EE                      T +IPV+ G       K+++ GGR     L + +S
Sbjct: 189 NEE----------------------TDVIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMS 226

Query: 239 FRH 241
            ++
Sbjct: 227 LKY 229

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIP 392
           GI++ I +S+      +R  + +N+V  GG   +P  S R+  EL + LP      +   
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 393 KIDAELF-GWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            +    + GW   +  +   ++ +  + REEY E G E   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 59/157 (37%), Gaps = 45/157 (28%)

Query: 195 LIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLL--------------------- 233
           L++D G + + + PVI G+   K+  +  + G++L  L+                     
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPD 215

Query: 234 --KETLSF----RHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHT 287
             K TLSF       N  +E       KE  L +APKS + SFK +  T  +  L     
Sbjct: 216 FVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLS-SFKDELATQTKRSL----- 269

Query: 288 TFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHP 324
                       + P   +LI   D  +S  E +F P
Sbjct: 270 ------------EAPWGEELIFDADTRYSFAEQLFRP 294

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 63/145 (43%), Gaps = 8/145 (5%)

Query: 293 IKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPL 352
           +  N+ T LP+++   T  +      E I   E+     PGI++ I  S+S     IR  
Sbjct: 355 LDSNTATPLPESSS--TTNENGKRTAEDIKREEL-----PGIVDLISSSISSCDVDIRAS 407

Query: 353 MVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYIPKIDAELFGWKAMAQFSDTD 411
           + +N+V  GG+  +P  S R+ +EL  + P   +        I+ +   W   +  S   
Sbjct: 408 LAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWLGGSILSSLG 467

Query: 412 SYRKARITREEYMEHGVEWCTKHRF 436
           ++ +  I ++EY E G E     R 
Sbjct: 468 TFHQLWIGKKEYEEVGSERLLHDRL 492

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 195 LIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRH 241
           LI+D G +   + PVI G+   K+ +     GRFL  LL + L  R 
Sbjct: 168 LIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIP 392
           G+ + I  S+      +R  + +N+V  GG  +LP    R+++EL R LP      +   
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 393 KIDAELF-GWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
           ++    + GW   +  +   ++ +  + ++EY E G +   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 70/358 (19%), Positives = 125/358 (34%), Gaps = 88/358 (24%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNF-RRPYEL- 63
           +VID GS+    G S +  P     AI    Y   Y   +   +    S+   R+ YE+ 
Sbjct: 17  VVIDPGSFTTNIGYSGTDCP----QAILPSCYGK-YTEGEKDELFSEQSIGLPRKDYEIH 71

Query: 64  -----GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHI 118
                G++  WE     WD+   +   F     E  S    +++E   +  E  +    +
Sbjct: 72  NIVQNGEVVDWEKAEKQWDWAIRSELRF-----ETNSGMPALLTEPIWNSEENRKKSLEV 126

Query: 119 IFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNTYIS 178
           + E  ++ + Y  P A  + F                                       
Sbjct: 127 LLESMDFSACYLVPTATAVSF--------------------------------------- 147

Query: 179 SEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238
                    A  +   L++D G + T + PV+ G+   K+  +  I G  L  L++  L+
Sbjct: 148 ---------AMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLA 198

Query: 239 FRH----YNVTDETILVNNIK-------EKCLFVAPKSYAESFKLKNKTAVEYVLPDFHT 287
            R     + V     +    K           FV  + + + FK   +T ++ V P   +
Sbjct: 199 PRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEFK---ETMLQ-VAPTSIS 254

Query: 288 TFMGYIKDNSKTKL--PDNAQLITLKDELFSVTETIFHPEISR------ILKPGIIET 337
            F   I+  SK  +  P   +L+    +     E +F P++S+      I K G++ET
Sbjct: 255 KFKSEIETTSKRSIEAPWGEELVYDSLQRLEFAEQLFTPDLSQFPEDWPISKDGVVET 312

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-----DWTT 387
           GI + +  S++     +R  + +NIV  GG+ ++P FS RL +EL ++LP        T 
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 388 HVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
           H+     + +   W   +  +   S+ +  + + EY E G E     RF
Sbjct: 438 HLR----ERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 68/162 (41%), Gaps = 22/162 (13%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIK-GIKDISSVNFRRP-YEL 63
           IVID GSY    G S S  P   I +      +T    NQ K  +    S+   RP YE+
Sbjct: 15  IVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARPDYEI 74

Query: 64  ------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDH 117
                 G++  W+     WD+   N E F    L+  S   ++++E   +  E  +    
Sbjct: 75  KRIVENGEIADWDTAQEQWDWVLKN-ELF----LKSNSGIPVLLTEPIWNSVENRKKSLE 129

Query: 118 IIFEEYNYGSIYKSPVAGFIPFA---------DLTKDVISIS 150
           ++ E  ++ + Y SPV+  + FA         D+  D  S+S
Sbjct: 130 VLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVS 171

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 66/168 (39%), Gaps = 15/168 (8%)

Query: 274 NKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPG 333
           NKT  E       T     + +N K  + D     T K+E   V+      +I      G
Sbjct: 357 NKTTTETAASGESTNTSETVNENGKRPIEDTT-TSTAKNEDSEVSSNGNGVDII-----G 410

Query: 334 IIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-----DWTTH 388
           I + +  S+      +R  + +N+V  GG   +P  + RL  EL ++LP        T H
Sbjct: 411 IADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTGH 470

Query: 389 VYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
           +   +  A    W   +  +   ++ +  + +EEY E G +     RF
Sbjct: 471 LREKQYQA----WLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-----DWTTHVYIPKIDAELFGWKA 403
           +R  + +NIV  GG  ++P FS RL SEL ++LP        T H+     + +   W  
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLR----ERQYQAWLG 446

Query: 404 MAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            +  +   S+ +  + ++EY E G +     RF
Sbjct: 447 GSILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT---DWTTHVYIPKIDAELFGWKAMA 405
           +R  + +N+V  GG+ ++P  + RL +EL ++LP       T  ++ +  +    W   +
Sbjct: 392 LRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSGHLRERQSR--AWLGGS 449

Query: 406 QFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
             S   ++ +  + R+EY E G E   K RF
Sbjct: 450 ILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 19/121 (15%)

Query: 313 ELFSVTETIFHPEISRILKPGIIE---TII------ESLSMLPEVIRPLMVNNIVCIGGN 363
           E   V E +F P +    + GIIE   TI+      E   + P  +   M NN+   GGN
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLWITGGN 671

Query: 364 FNLPNFSKRLTSELQRQLPTDWTTHV---YIPKIDAELFGWKAMAQFS-DTDSYRKARIT 419
             LP   +R+  E    LP     +V   Y P +DA    W  MA+ + +++ Y+   I+
Sbjct: 672 SKLPGMKERIVKEFTGFLPVGTAFNVKQSYNPSLDA----WNGMAKLTLNSEDYKNTIIS 727

Query: 420 R 420
           +
Sbjct: 728 K 728

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 1/106 (0%)

Query: 332 PGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVY 390
           PGI++ I  S++     +R  + +N+V  GG   +P  S R+  EL ++LP   +     
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 391 IPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
               + +   W   +  S   ++ +  + ++EY E G +     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 32/63 (50%)

Query: 179 SEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238
           S  P+    A  +   L++D G +   + PV+ G+ + K+ ++  I G++L  L+ + L 
Sbjct: 163 SATPTCVSFAAGRSNCLVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLK 222

Query: 239 FRH 241
            R 
Sbjct: 223 PRE 225

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYIPKIDAELFGWKAMAQF 407
           +R  + +N+V  GG  ++P  S RL +EL + LP+  +        I+ +   W   +  
Sbjct: 400 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHTIERQYQSWLGGSIL 459

Query: 408 SDTDSYRKARITREEYMEHGVEWCTKHRF 436
           +   ++ +  + ++EY E GVE     RF
Sbjct: 460 TSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/242 (18%), Positives = 81/242 (33%), Gaps = 70/242 (28%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAI----AKDKYNTVYLSNQIKGIKDISSVNFRRPY 61
           +VID GSY    G S S  P   + ++      D+ N    S Q  GI        R+ Y
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIGIP-------RKDY 69

Query: 62  EL------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNI 115
           EL      G +  W+     W +   N        L   S    +++E   +  E  +  
Sbjct: 70  ELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKKS 124

Query: 116 DHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNT 175
             ++ E   + + Y +P +  + FA    + +                            
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFAAGRPNCL---------------------------- 156

Query: 176 YISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKE 235
                               ++D G +   + P++ G+   K+ ++  I G+F+  L+K+
Sbjct: 157 --------------------VVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKK 196

Query: 236 TL 237
            L
Sbjct: 197 AL 198

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 343 SMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYIPKIDAELFGW 401
           S  PE I   ++ N+V IGG   L    +RL ++L  Q P    +T+     +D +L  W
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSW 372

Query: 402 KAMAQFSDTDSYRKAR-ITREEYME 425
           +          ++    +T++EY+E
Sbjct: 373 QGGVNMCHLPDWKLGSWVTKQEYLE 397

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-----DWTTHVYIPKIDAELFGWKA 403
           +R  + +N+V  GG  ++P  S RL +EL + LP+       T H+     + +   W  
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIR----ERQYQSWLG 454

Query: 404 MAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            +  +   ++ +  + ++EY E G+E     RF
Sbjct: 455 GSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 61/164 (37%), Gaps = 31/164 (18%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAI----AKDKYNTVYLSNQIKGIKDISSVNFRRPY 61
           +VID GSY    G S S  P   + ++      D+ +    S Q  GI        R+ Y
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSVYGKLTADENSKKMFSEQSIGIP-------RKDY 69

Query: 62  EL------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNI 115
           EL      G +  W+     W +   N        L+  S    +++E   +  E  +  
Sbjct: 70  ELKPIIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPALLTEPVWNSMENRKKS 124

Query: 116 DHIIFEEYNYGSIYKSPVAGFIPFA---------DLTKDVISIS 150
             ++ E   + + Y +P +  + FA         D+  D  S+S
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVS 168

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 51/117 (43%), Gaps = 9/117 (7%)

Query: 325 EISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT- 383
           EI++    G+ + +  S+      +R  + +N+V  GG   +P  S RL +EL  +LP  
Sbjct: 372 EITKGSLLGVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPAL 431

Query: 384 ----DWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
                 T H      + +   W   +  +   ++ +  + +EEY + GV+     RF
Sbjct: 432 KFRMITTGHTR----ERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-----DWTTHVYIPKIDAELFGWKA 403
           +R  + +N+V  GG+ ++P  S RL  EL R+LP        T H      + +   W  
Sbjct: 408 LRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTGHTK----ERQYQAWLG 463

Query: 404 MAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            +  +   ++ +  + + EY E GVE     RF
Sbjct: 464 GSILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 176 YISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKE 235
           Y+SS  P+    A  +   L++D G + T + PV+ G+   K+  +  I G+++  L+++
Sbjct: 145 YLSSV-PTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEK 203

Query: 236 TLSFRH 241
            L  R 
Sbjct: 204 YLQPRE 209

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIP 392
           G+ + I  S+      +R  + +N+V  GG  ++P  + R+ +EL + LP      +   
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 393 KIDAELF-GWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            +    +  W   +  S   ++ +  + ++EY E G     K RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 349 IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYIPKIDAELFGWKAMAQF 407
           +R  + +N+V  GG   +P  S RL +EL + LP+  +        ++ +   W   +  
Sbjct: 400 LRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTGHTMERQYQSWLGGSIL 459

Query: 408 SDTDSYRKARITREEYMEHGVEWCTKHRF 436
           +   ++ +  + ++EY E GVE     RF
Sbjct: 460 TSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 59/164 (35%), Gaps = 31/164 (18%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAI----AKDKYNTVYLSNQIKGIKDISSVNFRRPY 61
           +VID GSY    G S S  P   + ++      D+      S Q  GI        R+ Y
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGKKNIFSEQSIGIP-------RKDY 69

Query: 62  EL------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNI 115
           EL      G +  W+     W +   N        L   S    +++E   +  E  +  
Sbjct: 70  ELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKKS 124

Query: 116 DHIIFEEYNYGSIYKSPVAGFIPFA---------DLTKDVISIS 150
             ++ E   + + Y +P +  + FA         D+  D  S+S
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVS 168

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 54/114 (47%), Gaps = 13/114 (11%)

Query: 326 ISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-- 383
           ++ ++   I+ET ++        +R  + +N+V  GG+ ++   + RL +EL ++LP   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 384 -DWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
               T  ++ +  +    W   +  S   ++ +  + R+EY E G E   K RF
Sbjct: 429 FRILTSGHLRERQSR--AWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYI 391
           G+ + I  S+      +R  + +N+V  GG+ ++P  + R+ +EL + LP   +      
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 392 PKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
              + +   W   +  +   ++ +  + ++EY E G +   K RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 37/169 (21%)

Query: 195 LIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRH------------- 241
           L++D G + T + PVI G+   K+  +  I G  L  L++ +L  R              
Sbjct: 156 LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPE 215

Query: 242 -----YNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDN 296
                ++      L+N + E+  F       + FK   +T ++ V P   T F   ++  
Sbjct: 216 FVKRSFDYEIHPSLLNFVNERQFF-------QEFK---ETMLQ-VAPTSLTKFKSELEQL 264

Query: 297 SKTKL--PDNAQLITLKDELFSVTETIFHPEISR------ILKPGIIET 337
           SK  +  P    L+   +  F++ E +F PE ++      I K G++ET
Sbjct: 265 SKRSIEAPWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-----DWTT 387
           G+ + +  S+      +R  + +N+V  GG  ++P  S RL +EL + LP+       T 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 388 HVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
           H      + +   W   +  +   ++ +  + ++EY E GV+     RF
Sbjct: 444 HTR----ERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 45/242 (18%), Positives = 84/242 (34%), Gaps = 70/242 (28%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAI----AKDKYNTVYLSNQIKGIKDISSVNFRRPY 61
           +VID GSY    G S S  P   + ++      DK +    S Q  GI        R+ Y
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIP-------RKDY 69

Query: 62  EL------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNI 115
           EL      G +  W+     W +   N        L+  S    +++E   +  E  +  
Sbjct: 70  ELKPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKKS 124

Query: 116 DHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAKFQEQLVTNDLNT 175
             ++ E   + + Y +P +  + FA         +G+                       
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFA---------AGRPNC-------------------- 155

Query: 176 YISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKE 235
                              L++D G +   + P++ G+   K+ ++  I G+F+  L+K+
Sbjct: 156 -------------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKK 196

Query: 236 TL 237
            +
Sbjct: 197 AI 198

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 48/258 (18%), Positives = 91/258 (35%), Gaps = 79/258 (30%)

Query: 6   IVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNF-------- 57
           +VID GSY    G S +  P    ++I   +Y +   +N+  G +D  S           
Sbjct: 17  VVIDPGSYSTNIGYSGTDCP----HSILPSRYGSFKKTNKDSGDEDTKSDESATKRAHIF 72

Query: 58  --------RRPYEL------GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISE 103
                   R+ YE+      G +T W+     W++   N E F    LE T     +++E
Sbjct: 73  SEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKN-ELF----LESTKGIPALLTE 127

Query: 104 TCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKAXXXXXXNNAK 163
              +  +  +     + E  N+ + Y +P +  + FA         +G+A          
Sbjct: 128 PVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFA---------TGRANC-------- 170

Query: 164 FQEQLVTNDLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMD 223
                                          L++D G +   + PV+ G+   K+ ++  
Sbjct: 171 -------------------------------LVVDIGHDTCSVSPVVDGMTLSKSTRRSF 199

Query: 224 IGGRFLTGLLKETLSFRH 241
             G+++  L++  L  R 
Sbjct: 200 FAGKYINHLIENFLKPRE 217

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 2/101 (1%)

Query: 338 IIESLSMLPEV-IRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYIPKID 395
           ++ S  M  +V +R  + +N+   GG   +P  S RL  EL  +LP   +       K +
Sbjct: 404 LVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTGHKKE 463

Query: 396 AELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            E   W   +  +   ++ +  + R+EY E G +     RF
Sbjct: 464 REYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 67/165 (40%), Gaps = 10/165 (6%)

Query: 273 KNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKP 332
           K  TA   + P    T    I +N K  + D         E   V +     +I  I+ P
Sbjct: 440 KEHTADAILAPTNADTPSENINENGKRSIEDG--------ENVDVPKKSDKKDIDNII-P 490

Query: 333 GIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPT-DWTTHVYI 391
           GI + +  +++     +R  + +N++  GG   +P  + RL  EL ++LP   +      
Sbjct: 491 GIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNKKLPALKFRILSSG 550

Query: 392 PKIDAELFGWKAMAQFSDTDSYRKARITREEYMEHGVEWCTKHRF 436
            + + +   W   +  +   ++ +  + + EY E G +   K RF
Sbjct: 551 HRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRLLKDRF 595

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 182 PSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRH 241
           P+    A  K   L++D G +   + PVI G+   K++++    GR+L  LL+  +  R 
Sbjct: 233 PTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 59/159 (37%), Gaps = 12/159 (7%)

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFL----TGLLKET 236
           EP     A  K   L+ID G   T + P++ G      + K   GG FL      LL+E 
Sbjct: 134 EPLAVALAMGKSSALVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEP 193

Query: 237 L-SFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPD------FHTTF 289
           L S  H    +    +   K   L V  K+ +E  +      +            +H   
Sbjct: 194 LGSSSHEAWYNSATWIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYM 253

Query: 290 MGYIKDNSKTKLPDNAQLITLK-DELFSVTETIFHPEIS 327
              +       L  N + +TL+  + + V E +F P+++
Sbjct: 254 TNPLTQKRNFLLKKNNKTVTLELRDCYRVCEYLFQPQLA 292

>Kwal_47.18006 s47 complement(643091..644947) [1857 bp, 618 aa] {ON}
           YLR054C - Hypothetical ORF [contig 201] FULL
          Length = 618

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 108 LPEFSRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISI 149
           +P  S N+  I+FE+++Y  + ++  + FI F DL K++ISI
Sbjct: 153 IPRISLNVISIVFEQFDYDKLLENSSSHFI-FQDLVKELISI 193

>SAKL0A08162g Chr1 complement(721932..724385) [2454 bp, 817 aa] {ON}
           highly similar to uniprot|P29496 Saccharomyces
           cerevisiae YLR274W CDC46 Component of the hexameric MCM
           complex which is important for priming origins of DNA
           replication in G1 and becomes an active ATP-dependent
           helicase that promotes DNA melting and elongation when
           activated by Cdc7p-Dbf4p in S-phase
          Length = 817

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 360 IGGNFNLPNFSKRLTSELQRQLPTDWTT 387
           +G N N+ N  KR+ +EL+R+LP  W+T
Sbjct: 743 LGSNTNMANEVKRIENELKRRLPIGWST 770

>SAKL0G09966g Chr7 complement(846059..847090) [1032 bp, 343 aa] {ON}
           similar to uniprot|P38992 Saccharomyces cerevisiae
           YDR297W SUR2 Sphingosine hydroxylase has a role in
           sphingolipid metabolism catalyses the conversion of
           sphinganine to phytosphingosine
          Length = 343

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 61  YELGQLTSWELESAIW----------DYCFYNPEEFDGFQLEDTSKKHL-VISETCLSLP 109
           +E+ ++  W     +W           Y F   + F GF L DT +  L  +  T  +L 
Sbjct: 127 FEMNEMWHWRRSVPLWIPNEAIYFAYSYGFSFAKIFFGFFLVDTWQYWLHRLMHTNKTLY 186

Query: 110 EFSRNIDHIIFEEYNYGSIYKSPVAGFI 137
           +   +  H ++  Y YG++Y SP  GF+
Sbjct: 187 KHFHSRHHRLYVPYAYGALYNSPTEGFL 214

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 52/260 (20%), Positives = 102/260 (39%), Gaps = 31/260 (11%)

Query: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240
           EP     +  ++  L++D G   + + P+I G     A+ +    G FL   + E L+  
Sbjct: 124 EPLAVALSLGRNTALVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKI 183

Query: 241 HYNVTDETILVNNIKEKCLFV--APKSYAESFKLKNKTAVEYVLPDFHTT---FMG--YI 293
                +E    NN K+  L +    +++ + FK          L D  +     MG  YI
Sbjct: 184 APIKDEEEGDPNNRKDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYI 243

Query: 294 KDNSKTKLPDNAQLITL-KDELFSVTETIFHPE-ISR--ILKPGIIETIIESLS------ 343
           K+     L    + I+L + +   + E +F P  +S+  +   G+ E + +S+       
Sbjct: 244 KNF----LLQKQKTISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGAST 299

Query: 344 ---------MLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKI 394
                      PE     ++ NI+  G +  +    +R+ ++L  Q P    +    P +
Sbjct: 300 ATSSSATNVTTPEQTHAALLTNILITGSSSLISGLEQRIVNDLSYQFPQYKLSSFANPLV 359

Query: 395 -DAELFGWKAMAQFSDTDSY 413
            D +L  W+     ++  S+
Sbjct: 360 LDRKLQSWQGGVTMANLPSW 379

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 17/95 (17%)

Query: 39  TVYLSNQIKGIKDISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLE-DTSKK 97
           T  L N++  I+++ +++  +  +  QL    LE A W             +LE D+SK 
Sbjct: 173 TPMLQNELVAIQELQNISKSKLLKFNQL----LEVAEWI----------KIKLESDSSKM 218

Query: 98  HLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKSP 132
            L I E+ +  P+ S NI  II+EE++Y ++ K+P
Sbjct: 219 SLKIWESII--PKISLNILSIIYEEFDYETLLKTP 251

>ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} similar
           to uniprot|P32944 Saccharomyces cerevisiae YJL187C SWE1
           Protein kinase that regulates the G2/M transition by
           inhibition of Cdc28p kinase activity localizes to the
           nucleus and to the daughter side of the mother-bud neck
           homolog of S. pombe Wee1p potential Cdc28p substrate
          Length = 775

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 17/101 (16%)

Query: 13  YEIKFGVSNSRIPFRAINAIAKDKYNTV-YLSNQIKGIKDISSVNFR---RPYELGQLTS 68
           Y++ F  +N +    A+ AI  +KYNTV  +  ++K + +IS  N     + Y +  ++S
Sbjct: 449 YQVTFAQNNRKY---AVKAIQPNKYNTVKRILQEVKILDEISKTNLDQEGKEYVIDFISS 505

Query: 69  WELESAIW---DYCFYNPEEFDGFQLEDTSKKHLVISETCL 106
           W+ ++A +   +YC       DGF  E     H++   T L
Sbjct: 506 WKYQNAFYVMTEYCENG--NLDGFLQE-----HIIAKNTRL 539

>KAFR0D04510 Chr4 (890844..891932) [1089 bp, 362 aa] {ON} Anc_5.314
           YDR297W
          Length = 362

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 9/104 (8%)

Query: 39  TVYLSNQIKGIKDISSVNFRRPYELGQLTSWELESAIWDYCF-YNPEEFD---GFQLEDT 94
           T Y SNQI  IK    VN      L Q  S E+   + +Y + Y    F    GF + DT
Sbjct: 120 TGYESNQIWNIKKYLIVNLH----LNQYLSLEIIDTLVNYAYNYGISAFKIAIGFVIIDT 175

Query: 95  SKKHL-VISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGFI 137
            +  L  +     +L +   ++ H ++  Y YG+++ +P+ GF+
Sbjct: 176 WQYWLHRLMHLNKTLYKKYHSVHHELYVPYAYGALFNAPLEGFL 219

>KLLA0E06975g Chr5 complement(631154..639439) [8286 bp, 2761 aa] {ON}
            similar to uniprot|P38110 Saccharomyces cerevisiae
            YBL088C TEL1 Protein kinase primarily involved in
            telomere length regulation contributes to cell cycle
            checkpoint control in response to DNA damage functionally
            redundant with Mec1p homolog of human ataxia
            telangiectasia (ATM) gene
          Length = 2761

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 49/117 (41%), Gaps = 10/117 (8%)

Query: 17   FGVSNSRIP--FRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYELGQLTSWELESA 74
            F +SN R     R  ++    ++ +V  SN   G+  +   NF  P       SW L+  
Sbjct: 1768 FALSNGRFEEGLRNKDSSCLHEFASVTSSNGFTGLATMLDSNFENPLLSANQYSWALKLN 1827

Query: 75   IWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEEYNYGSIYKS 131
             WD     PE  D F     +K    I +    +P+F    DHI+ +  + GS+ K+
Sbjct: 1828 KWDLPI--PEARDSF-----AKSAFSILKDVKEIPDFFSFDDHIL-KVMDGGSLLKN 1876

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 291 GYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETII-ESLSMLPEVI 349
           G I DN+ TK  +N ++I L  ++  + +T+F  ++  +L+    +T++ ES S L ++ 
Sbjct: 233 GIINDNTATKKNNNDKVIILGRQINEINDTLFEVKVKPVLEVSCSQTVVKESSSYLQKIF 292

Query: 350 R 350
           +
Sbjct: 293 K 293

>TDEL0E03130 Chr5 complement(589523..590497) [975 bp, 324 aa] {ON}
           Anc_5.314 YDR297W
          Length = 324

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 78  YCFYNPEEFDGFQLEDTSKKHL-VISETCLSLPEFSRNIDHIIFEEYNYGSIYKSPVAGF 136
           Y F   + F GF + DT +  L  +  T ++L +   +  H ++  Y YG++Y +P+ GF
Sbjct: 148 YGFSALKLFGGFAIIDTWQYWLHRLMHTNMTLYKKFHSRHHRLYVPYAYGALYNAPLEGF 207

Query: 137 I 137
           +
Sbjct: 208 L 208

>Suva_4.142 Chr4 complement(262137..263360) [1224 bp, 407 aa] {ON}
           YDL104C (REAL)
          Length = 407

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 61/141 (43%), Gaps = 20/141 (14%)

Query: 272 LKNKTAVEYVLPDFHTTFMGYIKDN----SKTKLPDNAQLITLKDELFSVTETIFHPEIS 327
           LKNK   + +L    ++F+  ++ N     K+ + D  +   ++   + V E+IF     
Sbjct: 243 LKNKAGRKNLLSFSFSSFITALRINLSKLGKSHINDLPE-CEIRSIAYQVQESIFDH--- 298

Query: 328 RILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTT 387
                 II+ + +++ + PE  +   VN  VC GG  N      +L  EL    PT +T 
Sbjct: 299 ------IIDKLKQAIKLQPEKFQN--VNEFVCSGGVSNNQRLRTKLEEELGETNPTGFTN 350

Query: 388 HVYIP----KIDAELFGWKAM 404
             Y P      ++ + GW  +
Sbjct: 351 FYYPPMDLCSDNSIMIGWAGI 371

>TPHA0E01350 Chr5 complement(271085..272050) [966 bp, 321 aa] {ON}
           Anc_5.314 YDR297W
          Length = 321

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 37/88 (42%), Gaps = 11/88 (12%)

Query: 61  YELGQLTSWELESAIW----------DYCFYNPEEFDGFQLEDTSKKHL-VISETCLSLP 109
           +E+  +  W      W           Y F   + F GF + DT +  L  +     +L 
Sbjct: 119 FEMNSMWKWRQALPFWVPDVAIYYGYSYAFPFAKIFTGFVIIDTWQYWLHRLMHVNSTLY 178

Query: 110 EFSRNIDHIIFEEYNYGSIYKSPVAGFI 137
           +   ++ H ++  Y YG++Y +P  GF+
Sbjct: 179 KRYHSVHHRLYVPYAYGALYNAPTEGFL 206

>Kpol_1036.15 s1036 complement(31585..40677) [9093 bp, 3030 aa] {ON}
            complement(31585..40677) [9093 nt, 3031 aa]
          Length = 3030

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%)

Query: 355  NNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYR 414
            NN + +   F + +FS+ + SEL++   T WT   +   + + L    +++    T  Y 
Sbjct: 2751 NNRLVVTSLFEVRSFSEPMISELEKLYDTHWTEKNFTHTVISFLCKGLSISSIKTTSLYC 2810

Query: 415  KARITREEYMEHGV 428
              ++ R  Y EH +
Sbjct: 2811 IEQLFRNTYYEHTL 2824

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,809,838
Number of extensions: 2234332
Number of successful extensions: 6526
Number of sequences better than 10.0: 177
Number of HSP's gapped: 6455
Number of HSP's successfully gapped: 279
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)