Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0H014508.254ON67367334460.0
TBLA0E043708.254ON67668021740.0
Smik_12.1428.254ON66365421610.0
NDAI0B023708.254ON72266821650.0
Skud_12.1518.254ON66466421570.0
Suva_10.1678.254ON68468221570.0
Suva_2.2678.254ON67266321480.0
YLR083C (EMP70)8.254ON66766421470.0
Smik_4.3538.254ON69066921470.0
YDR107C (TMN2)8.254ON67266621350.0
NCAS0B049708.254ON66666521130.0
CAGL0B01683g8.254ON69168621130.0
Kpol_543.358.254ON65866920930.0
Skud_4.3688.254ON67266720760.0
KNAG0G019908.254ON66765420450.0
KAFR0B026808.254ON66465420370.0
ZYRO0C01848g8.254ON64765320290.0
KLLA0F18931g8.254ON66565320280.0
Kwal_56.235778.254ON68367019980.0
TPHA0A018408.254ON68568419920.0
NCAS0B038908.254ON66367219790.0
SAKL0H17248g8.254ON66066119730.0
KLTH0G13882g8.254ON68768719370.0
TDEL0F038108.254ON65665718510.0
NDAI0J014208.254ON61962717970.0
AGR097W8.254ON65365516990.0
Ecym_43178.254ON60565414140.0
NCAS0A145207.411ON6707354153e-42
SAKL0F12914g7.411ON7077283845e-38
NDAI0A015107.411ON6797193811e-37
YER113C (TMN3)7.411ON7067113741e-36
Smik_5.2587.411ON7067293534e-34
Suva_5.2347.411ON7067223501e-33
TDEL0C027107.411ON6786993445e-33
KLLA0E20835g7.411ON6766953331e-31
KNAG0C034307.411ON6807153277e-31
ZYRO0B03784g7.411ON6586793268e-31
Skud_5.2667.411ON7077213242e-30
CAGL0G03487g7.411ON7047183082e-28
KAFR0K019507.411ON6646803011e-27
KLTH0C06226g7.411ON6947322949e-27
Kwal_27.107467.411ON6903152049e-16
Ecym_71437.411ON6762431654e-11
AGL295C7.411ON6572311611e-10
Kpol_1045.287.411ON6815711422e-08
TPHA0K007307.411ON7337351404e-08
TBLA0I003307.411ON7137101396e-08
Kwal_33.134861.100ON1229132743.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0H01450
         (673 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...  1332   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   842   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   837   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   838   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   835   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   835   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   832   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   831   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   831   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   827   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   818   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   818   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   810   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   804   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   792   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   789   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   786   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   785   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   774   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   771   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    766   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   764   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   750   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   717   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   696   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   659   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   549   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   164   3e-42
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   152   5e-38
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   151   1e-37
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   148   1e-36
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   140   4e-34
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   139   1e-33
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   137   5e-33
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   132   1e-31
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   130   7e-31
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   130   8e-31
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   129   2e-30
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   123   2e-28
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   120   1e-27
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...   117   9e-27
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    83   9e-16
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    68   4e-11
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    67   1e-10
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    59   2e-08
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    59   4e-08
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    58   6e-08
Kwal_33.13486 s33 complement(245766..249455) [3690 bp, 1229 aa] ...    33   3.3  

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score = 1332 bits (3446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/673 (96%), Positives = 649/673 (96%)

Query: 1   MNSLLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQS 60
           MNSLLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQS
Sbjct: 1   MNSLLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQS 60

Query: 61  VANDKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVP 120
           VANDKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVP
Sbjct: 61  VANDKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVP 120

Query: 121 LCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEH 180
           LCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEH
Sbjct: 121 LCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEH 180

Query: 181 MSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNN 240
           MSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNN
Sbjct: 181 MSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNN 240

Query: 241 NYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDK 300
           NYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDK
Sbjct: 241 NYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDK 300

Query: 301 YLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKL 360
           YLHTYDPSIQWFSLINF            HALLRALKKDISRYTDLNLDNSFTEDSGWKL
Sbjct: 301 YLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKL 360

Query: 361 THGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIF 420
           THGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIF
Sbjct: 361 THGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIF 420

Query: 421 GFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTI 480
           GFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSM            GVHSSGTIPASTI
Sbjct: 421 GFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTI 480

Query: 481 ILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGI 540
           ILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGI
Sbjct: 481 ILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGI 540

Query: 541 VPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQ 600
           VPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQ
Sbjct: 541 VPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQ 600

Query: 601 WRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNM 660
           WRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNM
Sbjct: 601 WRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNM 660

Query: 661 FFVKRIFTSIKVH 673
           FFVKRIFTSIKVH
Sbjct: 661 FFVKRIFTSIKVH 673

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/680 (58%), Positives = 509/680 (74%), Gaps = 11/680 (1%)

Query: 1   MNSLLTSI-LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQ 59
           M  L+T++ +CLI+  +  +N FY+PG++  TYH  D I L VN LTPSM+F+H D +G 
Sbjct: 1   MTKLITAVSICLITLSV--TNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGN 58

Query: 60  SVANDKEHFLYSYDYYYDKFHFCRP--EKVERKSESLGSVLFGDRIYNSPFELYMLEPKE 117
            +++DKE+FLYSYDYYY K HFC+P   +++++ ESLGS+LFGDRIYNSPFEL ML  + 
Sbjct: 59  ELSSDKENFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDEN 118

Query: 118 CVPLCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVS 177
           C  LC T IP DDAKFIN LIK+GF  NWLIDGLP+AR++YD  T+S FY SGF LGSV 
Sbjct: 119 CKELCSTNIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVE 178

Query: 178 ----VEHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIE 233
               V+     +    P V  ++++ +   +  E K     L+++ E  YFANHF+IHIE
Sbjct: 179 MIQVVDEAPSHTTPKQPIVEDVLSQELDEEQATE-KRANQMLVSSVERTYFANHFDIHIE 237

Query: 234 YHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETA 293
           YHDRGNN YR+VGVTV+PIS+KRD    C     +L L+E ++  V+FTYSV F KS+T 
Sbjct: 238 YHDRGNNEYRIVGVTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTV 296

Query: 294 WATRWDKYLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFT 353
           WATRWDKYLH YDP+IQWFSLINF            H L +ALK D  RY + NL++SF 
Sbjct: 297 WATRWDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFD 356

Query: 354 EDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCM 413
           EDSGWKL HGDVFR+P K+M+LSI+VGSG QLF MI   L +AALGF+SPS RG+LPT M
Sbjct: 357 EDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIM 416

Query: 414 FVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSG 473
           F+LYA+FGFVGSYTSMGVY+FF+GPYWKANMILTPL+VPG +             VHSS 
Sbjct: 417 FILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSD 476

Query: 474 TIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIP 533
            +P  T+ LM+ LW+++S+PLSF GS ++FK+C W D+PT  NE+ R+IP QPWY++++P
Sbjct: 477 VVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVP 536

Query: 534 VVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLC 593
             L+ GI PFG+IAVELYFIYSSLW+NKIFYMFGFLLVSF+L+  T+ LV+IIV YHSLC
Sbjct: 537 ATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLC 596

Query: 594 LENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGA 653
           LENWRWQWRSF+ GG+GC+ YIF++SI FT FK  GF++I+LY+GYS+LI ++  ++TGA
Sbjct: 597 LENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGA 656

Query: 654 VSFMCNMFFVKRIFTSIKVH 673
           + F+ NMFFVK+I++SIKV 
Sbjct: 657 IGFISNMFFVKKIYSSIKVE 676

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/654 (59%), Positives = 500/654 (76%), Gaps = 7/654 (1%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
           + AFY+PG++  TY   D I L VN LTPSMY++H DE G +V+ DKE+FLYSYDYY  +
Sbjct: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75

Query: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138
           FHFC+PEKVE++ ESLGS++FGDRIYNSPF+L MLE KECV LCK TIP +DAKFINKLI
Sbjct: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135

Query: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198
           KNGFF NWLIDGLP+AR + D +T++ FY +GF LG V V    G +    P  ++  N+
Sbjct: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQ--GTASEATPNTAETTNQ 193

Query: 199 AVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDD 258
            V+    R+  N    ++   E  YF NH++I IEYHDRG  NYRVVGV V+P+SIKR D
Sbjct: 194 GVEL-DTRDGHN----MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD 248

Query: 259 FESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFX 318
            E+C   G+ L L+E  +N+V FTYSV F++SET+WATRWDKYLH YDPSIQWFSLINF 
Sbjct: 249 PETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFS 308

Query: 319 XXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIY 378
                      H+LLRALK D +RY +LNLD+ F EDSGWKL+HGDVFR P +++ LSI 
Sbjct: 309 LVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSIL 368

Query: 379 VGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGP 438
           VGSGVQLF M+ C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTSMG+YKFF GP
Sbjct: 369 VGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGP 428

Query: 439 YWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLG 498
           YWKAN+ILTPLLVPG++             VHSSG IPAST+  M+ LW L S+PLSF G
Sbjct: 429 YWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAG 488

Query: 499 SFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLW 558
           S VA KKC+W+++PT  N+I R+IP QPWY++++P  L++G+ PFG+IAVELYFIY+SLW
Sbjct: 489 SLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLW 548

Query: 559 YNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLY 618
           +NKIFYMFGFL  SF+L+  T+ LV+I++ YHSLCLENW+WQWR F+ GG GCA Y+F++
Sbjct: 549 FNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIH 608

Query: 619 SIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
           SI FT+FK  GF +I+LY+GYSS+I ++ CL+TG++ F+ +MFF+++I++SIKV
Sbjct: 609 SILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKV 662

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/668 (58%), Positives = 511/668 (76%), Gaps = 4/668 (0%)

Query: 7   SILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKE 66
           S++ L +F +  + AFY+PG++  TYHP D I L VN LTPSMYF+H +E+G+++ +DKE
Sbjct: 58  SLVLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKE 117

Query: 67  HFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTI 126
            FLYSYDYYYD+FHFC+PE +E++ ESLGS++FGDRIYNSPF++ ML+ K CV LCKTTI
Sbjct: 118 RFLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTI 177

Query: 127 PADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSV-EHMSGGS 185
           P  DAKFINKLIKNGFF NWLIDGLP+AR++YDS+T++ FY +GF LG V V +  + G 
Sbjct: 178 PGKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGD 237

Query: 186 KVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVV 245
                      NE ++    R+AKNV   ++   E+ YFANHF+I +EYHDRG NNYRVV
Sbjct: 238 NANTVAKKPTTNEGLEL-DTRDAKNVQ--MLKNFELPYFANHFDIQVEYHDRGENNYRVV 294

Query: 246 GVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTY 305
           GV V+P+SIKR    +C  +G  L L+E+ +N V FTYSV FI SET WATRWDKYLH Y
Sbjct: 295 GVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIY 354

Query: 306 DPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDV 365
           DP+IQWFSLINF            H+LL+ALK D +RY +LNLD+ F E++GWKL HGDV
Sbjct: 355 DPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDV 414

Query: 366 FRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGS 425
           FR+P ++++LS+ VGSGVQLFLMI+C +  AALGF+SPS RG+L T MF+LYA+FGFVGS
Sbjct: 415 FRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGS 474

Query: 426 YTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMIC 485
           YTSMGVYKFF GPYWK NM+LTP+LVPG +             VHSSG IPA T+  MI 
Sbjct: 475 YTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMIL 534

Query: 486 LWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGA 545
           LW + S+PL+  GS +A KKCNW+++PT  N+I R+IP QPWY+++ P  L++GI PFG+
Sbjct: 535 LWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGS 594

Query: 546 IAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFV 605
           IAVELYFIYSSLW+NKIFYMFGFLL SF L+  T+ LV+I++ YHSLCLENW WQWR F+
Sbjct: 595 IAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFI 654

Query: 606 AGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKR 665
            GG+GCA Y+F++SI FT+FK  GF +I+LY+GYS++I ++ C++TGA+ F+ +MFF+++
Sbjct: 655 IGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRK 714

Query: 666 IFTSIKVH 673
           I++SIKV 
Sbjct: 715 IYSSIKVE 722

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/664 (59%), Positives = 505/664 (76%), Gaps = 6/664 (0%)

Query: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68
           L L+ F +  + AFY+PG++  TY   D I L VN LTPSMY++H DE G SV+ DKE+F
Sbjct: 6   LLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENF 65

Query: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128
           LYSYDYYYD+FHFCRP+ VE++ ESLGSV+FGDRIYNSPFEL ML+ KECVPLC TTIP 
Sbjct: 66  LYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPG 125

Query: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVT 188
           +DAKFINKLIKNGFF NWLIDGLP+AR++YD +T++ FY +GF LG V V    G    T
Sbjct: 126 NDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQ--GTRSKT 183

Query: 189 IPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVT 248
            P  ++  NE ++   + E  ++    +   E  YFANHF+I IEYHDRG  +YRVVGV 
Sbjct: 184 APKQAETTNEGLELGTRAEDYSI----VETFEHPYFANHFDIMIEYHDRGGGDYRVVGVI 239

Query: 249 VDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPS 308
           V+P+SIKR    +C    + L L+E  +N+V FTYSV F +S T+WATRWDKYLH YDPS
Sbjct: 240 VNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPS 299

Query: 309 IQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRM 368
           IQWFSLINF            H+LLRALK D +RY +LNL++ F EDSGWKL HGDVFR 
Sbjct: 300 IQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRP 359

Query: 369 PRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTS 428
           P  +++LSI VGSGVQLFLM+ C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTS
Sbjct: 360 PSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTS 419

Query: 429 MGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWL 488
           MG+YKFF+GPYWKAN++LTPLLVPG++             VHSSG IPA T+  M+ LW 
Sbjct: 420 MGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWF 479

Query: 489 LVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAV 548
           L S+PLSF GS +A KKC W+++PT  N+I R+IP QPWY+++IP  L++GI PFG+IAV
Sbjct: 480 LFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAV 539

Query: 549 ELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGG 608
           ELYFIY+SLW+NKIFYMFGFL  SF+L+  T+ LV+I++ YHSLCLENW+WQWR F+ GG
Sbjct: 540 ELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGG 599

Query: 609 LGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFT 668
           +GCA Y+F++SI FT+FK  GFV+I+LY+GYS +I ++ CL+TG++ F+ +MFF++RI++
Sbjct: 600 VGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYS 659

Query: 669 SIKV 672
           SIKV
Sbjct: 660 SIKV 663

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/682 (58%), Positives = 507/682 (74%), Gaps = 22/682 (3%)

Query: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68
           L L+ F +  + AFY+PG++  TY   D I L VN LTPSMY++H DE+G +V+ DKEHF
Sbjct: 6   LFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHF 65

Query: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128
           LYSYDYYYDKFHFC+PE VE++ ESLGS++FGDRIYNSPFEL ML+ KECV LCKT IP 
Sbjct: 66  LYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPG 125

Query: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSV---------- 178
           DDAKFINKLIKNGFF NWLIDGLP+AR+++D +T++ FY +GF LG V V          
Sbjct: 126 DDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQ 185

Query: 179 --------EHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNI 230
                   E        T P   K  NE ++   + + KN    ++   E  YFANHF+I
Sbjct: 186 VQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKN----MVKTREFPYFANHFDI 241

Query: 231 HIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKS 290
            IEYHDRG  NYRVVGV V+P+SIKR    +C   G+ L L+E  +N+V FTYSV F +S
Sbjct: 242 KIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEES 301

Query: 291 ETAWATRWDKYLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDN 350
            T+WATRWDKYLH YDPSIQWFSLINF            H+LLRALK D +RY +LNLD+
Sbjct: 302 PTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDD 361

Query: 351 SFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALP 410
            F EDSGWKL HGDVFR P ++++LSI VGSGVQ+FLM+ C +  AALGF+SPS RG+L 
Sbjct: 362 DFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLA 421

Query: 411 TCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVH 470
           T MF+LYA+FGFVGSYTSMG+YKFF GPYWKAN+I+TPLL+PG++             VH
Sbjct: 422 TVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVH 481

Query: 471 SSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMR 530
           SSG IPAST+  M+ LW L S+PLSF GS VA KKC+W+++PT  N+I R+IP QPWY++
Sbjct: 482 SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLK 541

Query: 531 SIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYH 590
           ++P  L++GI PFG+IAVELYFIY+SLW+NKIFYMFGFL  SF+L+  T+ LV++++ YH
Sbjct: 542 TLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYH 601

Query: 591 SLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLI 650
           SLCLENW+WQWR F  GG+GCA Y+F++SI FT+FK  GF +I+LY+GYSS+I ++ CL+
Sbjct: 602 SLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLV 661

Query: 651 TGAVSFMCNMFFVKRIFTSIKV 672
           TG++ F+ +MFF+++I++SIKV
Sbjct: 662 TGSIGFISSMFFIRKIYSSIKV 683

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/663 (59%), Positives = 502/663 (75%), Gaps = 6/663 (0%)

Query: 15  HIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDY 74
           +I  + AF +PG+S  TY   D I L VNRLTPS+YF+H DENG+ V++DKEHFLYSYDY
Sbjct: 12  YIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDY 71

Query: 75  YYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFI 134
           Y DKFHFC+PE VE++ ESLGSV+FGDRIYNSPF+L MLE KECV LCK+TIP  DAKFI
Sbjct: 72  YNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFI 131

Query: 135 NKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPG-VS 193
           N LIKNGFF NWL+DGLP+AR +YDS+T++ +Y +GF LG   V+   GG   TIP  + 
Sbjct: 132 NTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGK--TIPSTME 189

Query: 194 KLVNEAVKA---YKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVD 250
           +L +E  K       R+ KN+   L+   E+ +F NHFNI +EYHDRGN NYRVVGVTV+
Sbjct: 190 ELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVN 249

Query: 251 PISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQ 310
           P+SI+R    +C+ TG  L L E+ +N V FTYSV FI S+T WATRWDKYLH YDP IQ
Sbjct: 250 PLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQ 309

Query: 311 WFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPR 370
           WFSLINF            H++LRA++ D +RY +LNLDN F ED+GWKL HGDVFR+P 
Sbjct: 310 WFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPP 369

Query: 371 KAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMG 430
           K+MVLS+ VGSG+QLFLMI+C +  AALG +SP+ RG+LPT MFVLYA+FGFVGSYTSMG
Sbjct: 370 KSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMG 429

Query: 431 VYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLV 490
           VYKFFHGPYWKAN+I+TP+L+PG++              HSSG IPA T+  +I LW  V
Sbjct: 430 VYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSV 489

Query: 491 SVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVEL 550
           S+PLSF GS++A K+C W+++PT  N+I R+ P QPWY+R+I   L++GI  FG+IAVEL
Sbjct: 490 SIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVEL 549

Query: 551 YFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLG 610
           YFIYSSLW+NKIFYMFGFLL SF+L+   + LV++ + YHSLCLENW WQWRSF+ GGLG
Sbjct: 550 YFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLG 609

Query: 611 CAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSI 670
           C+ Y+F+++I FT+FK  GFV+++LY+GYS +I  + C++TGA+ F  +M F+++I++ I
Sbjct: 610 CSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRI 669

Query: 671 KVH 673
           KV 
Sbjct: 670 KVE 672

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/664 (59%), Positives = 506/664 (76%), Gaps = 7/664 (1%)

Query: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68
           L L+ F +    AFY+PG++  TY   D I L VN LTPSM ++H DE+G +V+ DKE+F
Sbjct: 10  LLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENF 69

Query: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128
           LYSYDYYY++FHFC+PEKVE++ ESLGSV+FGDRIYNSPF+L ML+ KEC  LCKT IP 
Sbjct: 70  LYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPG 129

Query: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVT 188
           DDAKFINKLIKNGFF NWLIDGLP+AR++YD +T++ FY +GF LG V V    G     
Sbjct: 130 DDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQ--GTDIEA 187

Query: 189 IPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVT 248
            P  ++  ++ V+  + R  +N    ++   E+ YFANHF+I IEYHDRG  NYRVVGV 
Sbjct: 188 TPKGAETTDKDVEL-ETRNDRN----MVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVI 242

Query: 249 VDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPS 308
           V+P+SIKR    +C  TG+ L L+E  +N+V FTYSV F +S T+WATRWDKYLH YDPS
Sbjct: 243 VEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPS 302

Query: 309 IQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRM 368
           IQWFSLINF            H+LLRALK D +RY +LNLD+ F EDSGWKL HGDVFR 
Sbjct: 303 IQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRS 362

Query: 369 PRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTS 428
           P +++ LSI VGSGVQLFLM+ C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTS
Sbjct: 363 PSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTS 422

Query: 429 MGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWL 488
           MG+YKFF+GPYWKAN+ILTPLLVPG++             VHSSG IPAST+  M+ LW 
Sbjct: 423 MGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWF 482

Query: 489 LVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAV 548
           L S+PLSF GS +A K+C+W+++PT  N+I R+IP QPWY+++IP  L++GI PFG+IAV
Sbjct: 483 LFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAV 542

Query: 549 ELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGG 608
           ELYFIY+SLW+NKIFYMFGFL  SF+L+  TS LV+I++ YHSLCLENW+WQWR F+ GG
Sbjct: 543 ELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGG 602

Query: 609 LGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFT 668
            GCA Y+F++SI FT+FK  GF +I+LY+GYSS+I ++ CL+TG++ F+ +M FV++I++
Sbjct: 603 AGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYS 662

Query: 669 SIKV 672
           SIKV
Sbjct: 663 SIKV 666

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/669 (58%), Positives = 508/669 (75%), Gaps = 2/669 (0%)

Query: 7   SILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKE 66
           SI  L+ F+I  + AF +PG+S  TYH  D I L VNRLTPS+YF+H DENG+ +++DKE
Sbjct: 22  SIWLLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKE 81

Query: 67  HFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTI 126
           H+LYSYDYY ++FHFCRPE VER+ ESLGS++FGDRIYNSPF+L MLE KECV LC+ TI
Sbjct: 82  HYLYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTI 141

Query: 127 PADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSK 186
           P  DAKFINKLIK+GFF NWL+DGLP+ARK++DS+T++ +Y +GF LG  +V++   G  
Sbjct: 142 PGKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKV 201

Query: 187 V--TIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRV 244
           +  T+  +    +    A   RE KN+   L+   E+ YF NHF+I +E+HDRG++NYRV
Sbjct: 202 IPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRV 261

Query: 245 VGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHT 304
           VGVTV+P+SI+R   +SC+     L L+E  +N++ FTYSV F+ S+T WATRWDKYLH 
Sbjct: 262 VGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHI 321

Query: 305 YDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGD 364
           YDP IQWFSLINF            H+LLRAL  D+SRY +LNLDN F EDSGWKL HGD
Sbjct: 322 YDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGD 381

Query: 365 VFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVG 424
           VFR P K+M+LS+ VGSGVQLFLMI+C + +AALG +SP  RG+LPT MFV YA+FGFVG
Sbjct: 382 VFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVG 441

Query: 425 SYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMI 484
           SYTSMGVYKFFHGPYWKAN+ILTP+L+PG +              HSSG IPAST+  +I
Sbjct: 442 SYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFII 501

Query: 485 CLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFG 544
            LW  VS+PLSF GS +A K CNW+++PT  N+I R++P QPWY+R+I   L++GI  FG
Sbjct: 502 FLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFG 561

Query: 545 AIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSF 604
           +IAVELYFIYSSLW+NKIFYMFGFLL SF+L+  T+ LV++++ YHSLCLENW+WQWRSF
Sbjct: 562 SIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSF 621

Query: 605 VAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVK 664
           + GGLGC+ Y+F++SI FT+FK  GF++I+LY GYS +I  + C++TGA+ F   M F++
Sbjct: 622 IIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIR 681

Query: 665 RIFTSIKVH 673
           +I++++K+ 
Sbjct: 682 KIYSAVKIE 690

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/666 (59%), Positives = 498/666 (74%), Gaps = 4/666 (0%)

Query: 11  LISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLY 70
           LI  +   +  F +PG+S  TYH GD I L VNRLTPS+YF+H DE G  V+ DKEHFLY
Sbjct: 8   LIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLY 67

Query: 71  SYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADD 130
           SYDYY  +FHFCRPE VE++ ESLGSV+FGDRIYNSPF+L MLE KECV LCK+TIP  D
Sbjct: 68  SYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKD 127

Query: 131 AKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIP 190
           AKFIN LIK+GFF NWL+DGLP+ARK YDS+T++ +Y +GF LG   V+    G  V   
Sbjct: 128 AKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVP-S 186

Query: 191 GVSKLVNEAVKA---YKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGV 247
            + +L +EA         R  KNV   L+   E+ YF NHF+I +E+HDRGN+NYRVVGV
Sbjct: 187 TMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGV 246

Query: 248 TVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDP 307
            V+P+SI+R    +C+ TG  L L+E+ +N+V FTYSV F+ S+T WATRWDKYLH YDP
Sbjct: 247 IVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDP 306

Query: 308 SIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFR 367
            IQWFSLINF            H+LLRALK D++RY +LNLDN F EDSGWKL HGDVFR
Sbjct: 307 QIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR 366

Query: 368 MPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYT 427
            P K+M+LSI VGSG+QLFLM++C +  AA+G +SP  RG+LPT MFVLYA+FGFVGSY 
Sbjct: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYA 426

Query: 428 SMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLW 487
           SMGVYKFF GPYWKANMILTP+L+PG++              HSSG IPA ++  +I LW
Sbjct: 427 SMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLW 486

Query: 488 LLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIA 547
            LVSVPLSF GS VA K+CNW+++PT  N+I R+IP QPWY+R+    L++GI  FG+IA
Sbjct: 487 FLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIA 546

Query: 548 VELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAG 607
           VELYFIYSSLW+NKIFYMFGFLL SF+L+  T+ LV+I++ Y+SLCLENW WQWRSF+ G
Sbjct: 547 VELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIG 606

Query: 608 GLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667
           GLGC+ Y F++SI FT+FK  G ++++LY+GYS +I  + C++TGA+ F  +MFF+++I+
Sbjct: 607 GLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666

Query: 668 TSIKVH 673
           ++IKV 
Sbjct: 667 SAIKVE 672

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/665 (57%), Positives = 499/665 (75%), Gaps = 5/665 (0%)

Query: 8   ILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEH 67
           ++   +F +  + AFY+PG++  TYH GD I L VN LTPS+YF+ TD NG+S   +KEH
Sbjct: 6   LVLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEH 63

Query: 68  FLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIP 127
           FLYS+DYY+D+ HFC+PE +E++ ESLGS++FGDRIYNSPFEL MLE K CV LCK+TIP
Sbjct: 64  FLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIP 123

Query: 128 ADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKV 187
             DAKFINKLIKNGFF NWLIDGLP+A ++YD KT+S FY +GF LG V       G   
Sbjct: 124 GKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAP 183

Query: 188 TIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGV 247
                 +  NE ++  + REAKNV   ++   E+ YF NH++I +EYHDRG   YRVVGV
Sbjct: 184 ATTKPKQTTNEGLEL-ETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGV 240

Query: 248 TVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDP 307
            V+P+SIKR    +C  TG+ L L+E+A+N V FTYSV F+ SET WATRWDKYLHTYDP
Sbjct: 241 IVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDP 300

Query: 308 SIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFR 367
           +IQWFSL+NF            H+L++ALK D +RY + NL++ F ED+GWKL HGDVFR
Sbjct: 301 TIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFR 360

Query: 368 MPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYT 427
           +P K+M+LS+ VGSGVQLFLMI C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYT
Sbjct: 361 IPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 420

Query: 428 SMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLW 487
           SM VYKFF GPYWK NM+LTP ++PG +              HSSG +PA T+  MI LW
Sbjct: 421 SMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLW 480

Query: 488 LLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIA 547
            + S+PL+F GS +A KKC W+++PT  N+I R+IP QPWY+++ P  +++GI PFG+IA
Sbjct: 481 FIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIA 540

Query: 548 VELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAG 607
           VELYFIY+SLW+NKIFYMFGFLL SF+L+  T+ LV+I++ YHSLCLENW+WQWR F+ G
Sbjct: 541 VELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVG 600

Query: 608 GLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667
           G+GCA Y+F++SI FT+FK  GF +I+LY+GYS++I ++ C++TGA+ F+ ++ FV++I+
Sbjct: 601 GVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIY 660

Query: 668 TSIKV 672
           ++IKV
Sbjct: 661 SAIKV 665

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/686 (55%), Positives = 492/686 (71%), Gaps = 22/686 (3%)

Query: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68
           L ++S  +  +  FY+PG +  TY  GD I L VN LTPS+ F+H D++G  +  DK   
Sbjct: 5   LLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARM 64

Query: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128
           LY YDYY +K HFC+PEK+E++ ESLGSV+FG++IYNSPF + MLE  ECV LC TTIP 
Sbjct: 65  LYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPG 124

Query: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVT 188
            DAKFINKLIKNGF  NWLIDGLP+ARK++DS+T + FY  GF LG V V    GG  V+
Sbjct: 125 KDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVS 184

Query: 189 ------------IPGVSKLVNEAVKAYKK---------REAKNVPAGLITAEEVEYFANH 227
                          +    +  +++ K          REAKNV   ++T  EV  FANH
Sbjct: 185 ESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANH 244

Query: 228 FNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCT-PTGNQLHLNENAENQVLFTYSVD 286
           F+I +EYHDRGN ++RVVGV V+P+S+      SC     ++LHL+EN +N+V+FTYSV 
Sbjct: 245 FDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVK 304

Query: 287 FIKSETAWATRWDKYLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDL 346
           F  S+T WATRWDKYLH YDP IQWFSLINF            H+LLRALK DISRY + 
Sbjct: 305 FTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEF 364

Query: 347 NLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYR 406
           NL + F EDSGWKL HGDVFR P+ +M+LS+ VGSG+QLFLMI   + ++ALG +SPS R
Sbjct: 365 NLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSR 424

Query: 407 GALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXX 466
           G+LPT MF+ YAIFGFVGSYTSMG+YKFF GPYWKANMILTP+L+PG +           
Sbjct: 425 GSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLL 484

Query: 467 XGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQP 526
             V SS  IP +T++ M+ LW+L S+PL+F GS +++KKCNW+++PT  NEIPR+IP QP
Sbjct: 485 YFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQP 544

Query: 527 WYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSII 586
           W+++++P  L+ G+V FG+IAVELYFIYSSLW+NKIFYMFGFLL S +L  FT+ L+++I
Sbjct: 545 WFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVI 604

Query: 587 VVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVV 646
           + Y +LC ENW WQWRSF  GGLGC+ YIF++SI FT+FK  GF +I+LY+GYS LI  +
Sbjct: 605 ITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFL 664

Query: 647 SCLITGAVSFMCNMFFVKRIFTSIKV 672
           +C++TGA+ F+C+MFFV+RIF SIKV
Sbjct: 665 TCIVTGAIGFICSMFFVRRIFASIKV 690

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/669 (58%), Positives = 497/669 (74%), Gaps = 13/669 (1%)

Query: 4   LLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVAN 63
           ++ +I CL+S ++  ++AFY+PG++  TY  GD I L VN LTPS+ F+H D+ G  +  
Sbjct: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61

Query: 64  DKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCK 123
           +KEHFLYS+DYY+ K HFC+PE VE++ ESLGS+LFGDRIYNSPF + MLE +EC  LCK
Sbjct: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121

Query: 124 TTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSG 183
            TIPADDAKFINKLIKNGFF NWLIDGLP+ARK++D KT+S FY +GFPLG+V V    G
Sbjct: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181

Query: 184 GSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYR 243
           G        SKL  E       REAKNV   ++   E+ +  NH++I++EYHDRG  NYR
Sbjct: 182 GL-----ASSKLNLEN----PAREAKNV-NNMVHNVEIPFLFNHYDINVEYHDRGEGNYR 231

Query: 244 VVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLH 303
           VVGVTVDP S   D    CT     L L E  +N+V F+YSV FI SET WATRWDKYLH
Sbjct: 232 VVGVTVDPKSSTGD---ICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLH 288

Query: 304 TYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHG 363
            YDP+IQWFSLINF            H+L+RALK D +RY + NLD++F +DSGWKL HG
Sbjct: 289 VYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHG 348

Query: 364 DVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFV 423
           DVFR+P K+M+LSI VGSG QLFLM+   +  AA+G +SPS RG+LP+ MF+LYA+FGF 
Sbjct: 349 DVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFC 408

Query: 424 GSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILM 483
           GSY SMGVYKFF+GPYWKANMILTP+LVPG +               SSGTIP + +I +
Sbjct: 409 GSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFV 468

Query: 484 ICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPF 543
           I LW ++S+PLS  GS +A KKCNW ++PT  NEI R+IP QPWY++++P  L++G+ PF
Sbjct: 469 IVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPF 528

Query: 544 GAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRS 603
           G+IAVELYFIYSSLW+NKIFYMFGFL VSF+L+  T+ LV+I++ Y+SL LENWRWQWRS
Sbjct: 529 GSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRS 588

Query: 604 FVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFV 663
           F+ GG+GCAFYIF++SI FT+FK  GF +I+LY+GYS +I  +  ++TGA+ F+ +M FV
Sbjct: 589 FIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFV 648

Query: 664 KRIFTSIKV 672
           K+I++S+KV
Sbjct: 649 KKIYSSVKV 657

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/667 (56%), Positives = 499/667 (74%), Gaps = 3/667 (0%)

Query: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68
           L L+S+ I  + AF +PG+S  TYH  D I L VNRLTPS+YF+H DENG  +++DKEHF
Sbjct: 7   LALLSY-IPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHF 65

Query: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128
           LYSYDYY ++FHFCRPE VE++ ESLGSV+FGDRIYNSPF+L MLE KECV LCK TIP 
Sbjct: 66  LYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPG 125

Query: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKV- 187
            DA+FIN+LI +GFF NWL+DGLP+AR +YDS+T++ +Y +GF LG   V    G   V 
Sbjct: 126 RDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVP 185

Query: 188 -TIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVG 246
            T+       + A      R  KN+    +   E+ YF NHF I +E+H+RGN++YR+VG
Sbjct: 186 NTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVG 245

Query: 247 VTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYD 306
           VTV+P+SI+R    SC+ T   L L+E+ +N+V FTYSV F+ S T WATRWDKYLH YD
Sbjct: 246 VTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYD 305

Query: 307 PSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVF 366
           P IQWFSLI F            H+LLRALK D++RY +LNL+N F ED+GWKL+HGDVF
Sbjct: 306 PQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVF 365

Query: 367 RMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSY 426
           R P K+M+LS+ VGSG+QLFLMI+C +  AA G +SP  RG+L T MF+LYA+FGFVGSY
Sbjct: 366 RTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSY 425

Query: 427 TSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICL 486
           TSMGVYKFFHGPYWKAN+I+TP+L+PG++              HSSG IPA ++  +I L
Sbjct: 426 TSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFL 485

Query: 487 WLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAI 546
           W +VS+PLSF+GS +A K+C+WN++PT  N+I R+IP QPWY+R+    +++GI  FG+I
Sbjct: 486 WFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSI 545

Query: 547 AVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVA 606
           AVELYFIYSSLW+NKIFYMFGFLL SF+L+  T+ L+++++ YHSLCLENW WQWRSF+ 
Sbjct: 546 AVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFII 605

Query: 607 GGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRI 666
           GGLGC+ Y+F++SI FT+FK  GF++++LY+GYS ++ V+ C++TGA+ F  +M F+++I
Sbjct: 606 GGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKI 665

Query: 667 FTSIKVH 673
           + ++KV 
Sbjct: 666 YYAVKVE 672

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/654 (59%), Positives = 496/654 (75%), Gaps = 6/654 (0%)

Query: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79
           NAFY+PG++  TY   D I L VN L+PSMY++H  E+G+++  DK  +LYSYDYYYD+F
Sbjct: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRF 79

Query: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139
           HFC+PEK+ ++ ESLGS++FGDRIYNSP+++ MLE K CVPLC T IP  DA+FINKLIK
Sbjct: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139

Query: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199
           NGFF NWLIDGLP+AR ++D  T S FY +GF LGSV V      +K T P   K  +  
Sbjct: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAK-THP---KEDDSG 195

Query: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259
                 R+AKNV   ++   E+ YFANH +I +EYHDRG  N RVVGVTVDPISIKR   
Sbjct: 196 SAKLSTRDAKNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSP 253

Query: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFXX 319
            +C  +G+ L L+E  +N+V FTYSV F+ S+T WATRWDKYLHTYDP+IQWFSL+NF  
Sbjct: 254 GTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSI 313

Query: 320 XXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379
                     H LL+AL+ D +RY +LNLDN F EDSGWKLTHGDVFR+P K+M+LSI V
Sbjct: 314 VVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILV 373

Query: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439
           GSG+QLFLMI   +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTSMGVYKFF GPY
Sbjct: 374 GSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPY 433

Query: 440 WKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499
           WKANMILTPLLVPG +            G HSSGTIPA T+  ++ LW ++SVP +  GS
Sbjct: 434 WKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGS 493

Query: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559
            +A KKC+W+++PT  N++ R++P QPWY++++    ++GI PFG+IAVELYFIY+SLWY
Sbjct: 494 LIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWY 553

Query: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619
           NKIFYMFGFL VSF+L+  T+VLV+I++ YHSL LENW+WQWRSF+ GG+GCA Y+F++S
Sbjct: 554 NKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHS 613

Query: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKVH 673
           I FT+ K  GFV+I+LY+GYS++I ++ CL+TG++ F+ +MFFV+RI++SIKV 
Sbjct: 614 ILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/654 (58%), Positives = 495/654 (75%), Gaps = 5/654 (0%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
           + AFY+PG++  TYH GD I L VN L+PSMY++H ++ G+ V++DK  +LYSYDYYYD+
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138
           FHFC+PEK+E++ ESLGS++FGDRIYNSPF+L MLE K+C  LCK+TIP +DAKFINKLI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198
           KNGFF NWLIDGLP+A + +D++T + FY SGF LG V V      ++      +     
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194

Query: 199 AVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDD 258
            + A   R+AKNV    I   E+ YF NH++I IEYHDRGN +YRVVGV V+P+SI+R  
Sbjct: 195 ELDA---RDAKNVKT--IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSS 249

Query: 259 FESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFX 318
             SC  TG  L L E+ +N V FTYSV F+ SET+WATRWDKYLH YDP+IQWFSL+NF 
Sbjct: 250 PGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFS 309

Query: 319 XXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIY 378
                      H+LL+ALK D +RY + NLD+ F ED+GWKL HGDVFR+P K+M+LS+ 
Sbjct: 310 LIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVL 369

Query: 379 VGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGP 438
           VGSGVQLF+MI   +  AALGF+SPS RG L T MF+LYA+FGFVGSYTSMGVYKFF GP
Sbjct: 370 VGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGP 429

Query: 439 YWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLG 498
           YWKANM+LTP+LVPGS+             VHSSG IPA T+  M+ LW + S+P +F G
Sbjct: 430 YWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAG 489

Query: 499 SFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLW 558
           S VA KKCNWN++PT   +I R+IP QPWY+++IP   ++GI PFG+IAVE+YFIY+SLW
Sbjct: 490 SLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLW 549

Query: 559 YNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLY 618
           YNKIFYMFGFL VS +L+  T+ LV++++ YHSLCLENW WQWRSF+ GG+GCA Y+F++
Sbjct: 550 YNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIH 609

Query: 619 SIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
           SI FT+FK  GF +++LY+GYSS+I ++ C++TG++ F+ +MFFV++IF+SIKV
Sbjct: 610 SILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKV 663

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/653 (59%), Positives = 486/653 (74%), Gaps = 23/653 (3%)

Query: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79
            AFY+PG++  TYH  D I+L VN LTPSM F+H DE+G  V  DKEH+LYSYDYYY KF
Sbjct: 17  KAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYSKF 76

Query: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139
           HFC+PE V R+  SLGSV+FGDRI+NSPF+L MLE KECVPLC + IP +DAKF+NKLIK
Sbjct: 77  HFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIK 136

Query: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199
           NGF  NWLIDGLP+ R+I+DS+T S FY +GF LG V V            G S   +E 
Sbjct: 137 NGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE----------GFSDSNDEE 186

Query: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259
            K  K  E             V Y ANH++I+IEYHDRGN+NYRVVGVTVDP+SIKR   
Sbjct: 187 KKIMKTLE-------------VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSS 233

Query: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFXX 319
           +SC      L L+E  EN+V FTYSV FIKS+T WATRWDKYLH YDP+IQWFSLIN   
Sbjct: 234 DSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSV 293

Query: 320 XXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379
                     H LLRALK D+SRY + NLDN F EDSGWKL+HGDVFR+P ++++LSI V
Sbjct: 294 IVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILV 353

Query: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439
           GSGVQLFLMI C +  AALGF+SPS RG+LPT MF+LYA+FGFVGSYTSM +YKFF GP 
Sbjct: 354 GSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPL 413

Query: 440 WKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499
           WK N++LTP+LVPG +             V SSG IPA T+  +I LW + S+PLSF GS
Sbjct: 414 WKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGS 473

Query: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559
            +A K+C  +++PT  N+I R+IPIQPWY+++IPV L++G+ PF +IAVELYFIY+SLW+
Sbjct: 474 LIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWF 533

Query: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619
           NKIFYMFGFLL SF+L+ FT+ LV+I+  YHSLCLENW+WQWRSF+ GG GCA Y+F++S
Sbjct: 534 NKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHS 593

Query: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
           I FT+FK  GF +++LY+GYS LI V+ C++TG++ F+ +MFF+++I++S+KV
Sbjct: 594 ILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKV 646

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/653 (56%), Positives = 477/653 (73%), Gaps = 9/653 (1%)

Query: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79
            AFY+PG++  TYH GD + L VN LTPS +++H D + Q    DKE FLYSYDYYY KF
Sbjct: 21  EAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTD-QHDTGDKEGFLYSYDYYYKKF 79

Query: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139
           HFC+P +++++ ESLGS++FGDRIYNSPF+L +L+  EC  LCK+ IP  DAKFINKLI 
Sbjct: 80  HFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLIL 139

Query: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199
           NGFF NW+IDGLP+ARK+ D+KT  IFY +GF LG V V  +S       P    L +E 
Sbjct: 140 NGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV--LSDYE----PDTRSLHDEL 193

Query: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259
                 ++    P   +T  E+ YF NH++I IEYHDRG NNYR+VGVTV+P SIKRD  
Sbjct: 194 ELQLNAKKNVLSPGDKVT--EIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSP 251

Query: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFXX 319
           +SC  TG  L L+E  +N+V FTYSV FIKS+T WATRWDKYLH YDP IQWFSLINF  
Sbjct: 252 DSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFST 311

Query: 320 XXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379
                     H+L  ALK D++RY +LNLD  F E++GWKL HGDVFR P KA++LS+ V
Sbjct: 312 IVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLV 371

Query: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439
           GSG QL LM+   +  A LGF+SPS RG+L T MF+LYAIFG  GS+TSM  YKFF+G  
Sbjct: 372 GSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKA 431

Query: 440 WKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499
           W+ N++LTPLLVPGS+             VHSSG IP  T+++++ LW ++S+PLS +GS
Sbjct: 432 WRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGS 491

Query: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559
            +A+KKCNWN++PT  N+I R+IP QPWY+++IPV LL+GI PFG+IAVELYFIYSSLW+
Sbjct: 492 VIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWF 551

Query: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619
           NKI+YMFGFL  SFIL+  T+ L+++++ YHSLC+ENW+WQWRSFV GG GCAFY+F +S
Sbjct: 552 NKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHS 611

Query: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
           I FT+F+  G  +I+LY+GYS LI  + CL+TGA+ F+ ++  V++I++ +KV
Sbjct: 612 ILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKV 664

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/670 (55%), Positives = 481/670 (71%), Gaps = 22/670 (3%)

Query: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79
             FY+PG++  TYH GD I L VN LTPSMYF+H D++G+    D+E FLYSYDYYYDKF
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTG-DRESFLYSYDYYYDKF 76

Query: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139
           HFC+PEK+E++ ESLGS++FGDRIYNSPF+L ML+ KEC  LC + IPA+DAKFINKLI 
Sbjct: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136

Query: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSK----- 194
           NGFF NWL+DGLP+ARK  D +T+S FY+ GF LG + V    GG+K+ + G  +     
Sbjct: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDV----GGAKLRMDGQGEEDAHP 192

Query: 195 -----------LVNEAVKAYKKREAKNV-PAGLITAEEVEYFANHFNIHIEYHDRGNNNY 242
                       ++   K+  ++  K V P  L+   E  YFANHFNI ++YHDRGN +Y
Sbjct: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252

Query: 243 RVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYL 302
           RVVGV V+P SIKRD   SC  TG  L L+E  E  V F+YSV F  S+T WATRWDKYL
Sbjct: 253 RVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYL 312

Query: 303 HTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTH 362
           H YDP IQW+SLINF            H+L R L+ D+SRY  LNLD+ F E++GWKL H
Sbjct: 313 HVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372

Query: 363 GDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGF 422
           GDVFR P K+++LS+ VGSG QLF+M  C +  A LG +SPS RG+L T MF+LYA+FG 
Sbjct: 373 GDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGS 432

Query: 423 VGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIIL 482
           +GSYTSM  YKFF G YWK NMILTP+LVPG +             V S+G IP  T+  
Sbjct: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492

Query: 483 MICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVP 542
           ++ LW + S+PLS  GS +A KKC WN++PT   +IPR+IP QPWY+++ P  L++GI P
Sbjct: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552

Query: 543 FGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWR 602
           FG+IAVELYF+YSSLW+NKIFYMFGFL VSF+L+  T+ LV++++ Y+SLCLENW+WQWR
Sbjct: 553 FGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWR 612

Query: 603 SFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFF 662
            F  GG GCA Y+FL++I FT+FK  GFV+I+LY+GYS +I +++CLITGAV FM +++F
Sbjct: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672

Query: 663 VKRIFTSIKV 672
           V+RI++SIKV
Sbjct: 673 VRRIYSSIKV 682

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/684 (54%), Positives = 495/684 (72%), Gaps = 28/684 (4%)

Query: 11  LISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLY 70
           LI+  + F NAFY+PG++ +TY+ GD + L VN LTPS+ ++  D+ G+ V + +E  LY
Sbjct: 7   LIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLY 65

Query: 71  SYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADD 130
           S+DYY+ K HFC+PEK+ ++ +SLGS+LFGDRIYNSPF + ML+P+  V LC  TIP  D
Sbjct: 66  SFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSD 125

Query: 131 AKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIP 190
           AKFINKLIKNGFF NWLIDGLP+ARKIYDS T + FY  GFPLG V ++   GG  + + 
Sbjct: 126 AKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMD 185

Query: 191 GVSK---------------------LVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFN 229
             +K                        E     +KRE K + + L+   E  Y ANH+ 
Sbjct: 186 AKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRI-SKLVHNVEFPYLANHYV 244

Query: 230 IHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP-TGNQLHLNENAENQVLFTYSVDFI 288
           I++E HDRG  NYRVVGVTVDP S      +S  P  GN+L L+E  +N+V F+YSV+FI
Sbjct: 245 INVEVHDRGEGNYRVVGVTVDPYSTT----DSANPEKGNKLFLDEKKDNEVTFSYSVNFI 300

Query: 289 KSETAWATRWDKYLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNL 348
           +SET WATRWDKYLHTY+P+IQWFSL+NF            ++LL+ALK D +RY + NL
Sbjct: 301 ESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNL 360

Query: 349 DNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGA 408
           DNSF EDSGWKL HGDVFR+P ++M+LSI VGSG QLFLMI+  + +AA+G +SPS RG+
Sbjct: 361 DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS 420

Query: 409 LPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXG 468
           LP+ MF  YA+FGF GSY SM VYKFF GPYWKANMILTPLLVPG +             
Sbjct: 421 LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF 480

Query: 469 VHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWY 528
           VHSSGTIP + ++L++ +W ++S+PLSFLGS +A K+ NW ++PT  N+I R+IP Q WY
Sbjct: 481 VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY 540

Query: 529 MRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVV 588
           +++IP +L++GI PFGAIAVELYFIY+SLW+NKIFYMFGFL VSF+L+  T+ LV++++ 
Sbjct: 541 LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLIT 600

Query: 589 YHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSC 648
           Y SLC+ENW WQWRSF  GG+GC+ YIF++SI FT+FK  GF +++LY+GY+ L+ ++SC
Sbjct: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660

Query: 649 LITGAVSFMCNMFFVKRIFTSIKV 672
           ++TGAV F+ +M FV++I+++++V
Sbjct: 661 IVTGAVGFISSMIFVRKIYSNVRV 684

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/672 (53%), Positives = 473/672 (70%), Gaps = 10/672 (1%)

Query: 1   MNSLLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQS 60
           MN ++ S+L  +S       AF +PG+   TY  GD I L VN LTPSM+F H +E G+ 
Sbjct: 1   MNYVILSLLFCLSV----VEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKD 56

Query: 61  VANDKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVP 120
           ++  K++ ++SYDYYY+KFHFC+P  +E+   S+GS+LFGDRIYNSPF+L MLE K CVP
Sbjct: 57  ISTAKKYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVP 116

Query: 121 LCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEH 180
           LC++ IP  DA+FINKLIKNG++ NW IDGLP+AR++YD +T+S FY +GF LG V +  
Sbjct: 117 LCESIIPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQ 176

Query: 181 MSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNN 240
            +G  K+    V  + + A     KR+AKN+   LI   EV YF NHF+I IEYH+RGN 
Sbjct: 177 TTG-DKLLPDSVHDISDLA-----KRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNG 230

Query: 241 NYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDK 300
           NYRVVG TV+P+SI R     CTPTG  L LNE  +N V  TYSV F+ S+T+W TRWDK
Sbjct: 231 NYRVVGATVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDK 290

Query: 301 YLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKL 360
           YLH YDP IQWFSLINF            ++LL+ALK D +RY ++NLD+   E+SGWKL
Sbjct: 291 YLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKL 350

Query: 361 THGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIF 420
            HG VFR+P+  M+LSI VGSG QLFL+I+C + +AA+  +SP YRGALPT M +LY +F
Sbjct: 351 VHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILF 410

Query: 421 GFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTI 480
           GF+ SY SMGVYKFF GPYWK NM+LTP+LVPG +               SS  +PA TI
Sbjct: 411 GFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTI 470

Query: 481 ILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGI 540
           + +I LW  VS+PLS  GS +A KKC+W+++PT  N+I + IP Q WY+++IP  L+ G+
Sbjct: 471 MTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGL 530

Query: 541 VPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQ 600
             FG+I+V+LYFIY+SLW+N IFYM+GFLL S  L   T  LV+I+  YHSLC ENW+WQ
Sbjct: 531 FSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQ 590

Query: 601 WRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNM 660
           WR F  GGLGC+ Y+ L+S+ F   K  GF +ILLYMGYSS++  +  L+TG+V F+ +M
Sbjct: 591 WRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSM 650

Query: 661 FFVKRIFTSIKV 672
           FF+KRIF+S+KV
Sbjct: 651 FFIKRIFSSVKV 662

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/661 (56%), Positives = 476/661 (72%), Gaps = 21/661 (3%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
           ++AFY+PG++  TYH GD I L VN LTPS YF+H D+ G +++ DKE FLYSYDYYYDK
Sbjct: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72

Query: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138
           FHFCRPE + ++ ESLGS++FGDRIYNSPFEL MLE K CVPLCK+ IP DDAKFINKLI
Sbjct: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132

Query: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKL--- 195
           +NGFF+NWL+DGLP+AR+++D +T S FY +GF LG V V        +  P   K+   
Sbjct: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVV-----DTIEDPDTKKVSES 187

Query: 196 ----VNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDP 251
               + +A K  K+R AK          E+ YF NHF+I IEYHDRG +NYRVVGV+V P
Sbjct: 188 DYIEIADADKELKERSAK--------LTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIP 239

Query: 252 ISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQW 311
            SIKRD  +SC   G  L L+E+A+N V FTYSV F+ S+T WATRWDKYLH YDP IQW
Sbjct: 240 ASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQW 299

Query: 312 FSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRK 371
           FSLI+F            H+L RALK D+SRY +LNLD+ F E++GWKL HGDVFR P +
Sbjct: 300 FSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPER 359

Query: 372 AMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGV 431
            M+LS+ VGSG QLFLM    +  A LG +SPS RG+L T MF+LYA+FG  GSYTSM V
Sbjct: 360 TMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAV 419

Query: 432 YKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVS 491
           YKFF+G  WK NMILTP+L+P  +             VHSSG IP  T++ ++ LW + S
Sbjct: 420 YKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFS 479

Query: 492 VPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELY 551
           +PLS  GS ++ KK  W D PT  N+I R+IP QPWY++++P  L++G  PFG+I VELY
Sbjct: 480 IPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELY 538

Query: 552 FIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGC 611
           FIYSSLW+NKIFYMFGFL  SF+L+  T+ LV++++ Y+SLC+ENW+WQWR F  GG GC
Sbjct: 539 FIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGC 598

Query: 612 AFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIK 671
           AFY+F+++I FT+FK  G  +++LY+GYS +I  + CLITGAV F+ +++FV++I+ SIK
Sbjct: 599 AFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIK 658

Query: 672 V 672
           V
Sbjct: 659 V 659

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/687 (53%), Positives = 484/687 (70%), Gaps = 19/687 (2%)

Query: 4   LLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVAN 63
           ++++IL L        + FY+PG++  TYH GD I L VN LTP+MY++H DE+G  +  
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG- 59

Query: 64  DKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCK 123
           DKE  LYSYDYYY KFHFCRPEK+E++ ESLGS++FGDRIYNSPF++ ML+ KEC  LC 
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 124 TTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVE---- 179
            +IPADDAKFINKLI NGFF NWL+DGLP+ARK  D +T+S FY+ GF LG V +     
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 180 HMSG------GSKVTIPGVSKLVNE--------AVKAYKKREAKNVPAGLITAEEVEYFA 225
            M+G      G      G +K V+E        A ++  KR+  +    L+   E  YFA
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFA 239

Query: 226 NHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSV 285
           NHF I ++YHDRGN NYRVVGV V+P SIKR+  ++C  TG  L L+E    +V F+YSV
Sbjct: 240 NHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSV 299

Query: 286 DFIKSETAWATRWDKYLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTD 345
            F  SET WATRWDKYLH YDP IQWFSLINF            H L   L  D+SRY  
Sbjct: 300 KFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQ 359

Query: 346 LNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSY 405
           +NLD+ F E++GWKL HGDVFR P ++++LS+ VGSG QLFLM  C +  A LG +SPS 
Sbjct: 360 INLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSS 419

Query: 406 RGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXX 465
           RG+L T MF+LYA+FG  GSYTSM  YKFF GPYWK NM+LTP+LVPG +          
Sbjct: 420 RGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFF 479

Query: 466 XXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQ 525
              V S+G IP  T+ +++ LW L S+PLS  GS +A KKC W+++PT   +IPR+IP Q
Sbjct: 480 LVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQ 539

Query: 526 PWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSI 585
           PWY++++P  L++GI PFG+IAVELYFIYSSLW+NKIFYMFGFL VSF+L+  T+ L+++
Sbjct: 540 PWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITV 599

Query: 586 IVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICV 645
           ++ Y+SLCLENW+WQWR F  GG GCA Y+F+++I FT+F+  GF +I+LY+GYS ++ +
Sbjct: 600 LLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSL 659

Query: 646 VSCLITGAVSFMCNMFFVKRIFTSIKV 672
           +SCLITG V F+ +++FV+RI++S+KV
Sbjct: 660 LSCLITGTVGFLSSLWFVRRIYSSVKV 686

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/657 (51%), Positives = 450/657 (68%), Gaps = 19/657 (2%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
           S A ++PGIS   Y     I L VN LTPS +F+H D++G ++ +DKEH+LYSYDYY  K
Sbjct: 15  SRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSK 74

Query: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138
            HFC+PE V  ++ESLGSVLFGDR+YNSPF+L MLE K CV LCK+ IP +DA FINKLI
Sbjct: 75  LHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLI 134

Query: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198
           KNGF +NWL+DGLP+   I + +  S   ++GFPLGSV +        +  P        
Sbjct: 135 KNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP-------- 186

Query: 199 AVKAYKKREAKNVPA---GLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIK 255
                  RE   + A    ++   E+ +  NH++I I+YH+     YR+VGV V+P SIK
Sbjct: 187 -------REETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIK 239

Query: 256 RDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLI 315
           +    SC  TG Q+ L+E+ +N+VL+TYSV +++    WATRWD Y  +YD ++QWFSLI
Sbjct: 240 QTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLI 298

Query: 316 NFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVL 375
           +             H LLRALK D +RY +LNLD+ F E+SGWKL+HGDVFRMP K+++L
Sbjct: 299 SCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLL 358

Query: 376 SIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFF 435
           S+ VGSGVQL L+ +  + +AA+ F +   R  LPT  FVLYA+FGFVGSY SMGVY+FF
Sbjct: 359 SVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFF 418

Query: 436 HGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLS 495
            GPY K NMILTP L+PG +              HSS  IP S +  ++ LWL++SVPLS
Sbjct: 419 KGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLS 478

Query: 496 FLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYS 555
             GS  A K C+W+ +PT  N+I R+IP QPWY++++P  L++GI PF +IAVELYFIY+
Sbjct: 479 LAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYN 538

Query: 556 SLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYI 615
           SLW+++ FYMFGF +VS  L++ T+ LV++++ YHSLCLENW+WQWRSF+ GGLG A YI
Sbjct: 539 SLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYI 598

Query: 616 FLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
           F++SI FT FK  GF +I+LY+GYS LI ++ CL TGAV F  +MF V++IF+S+KV
Sbjct: 599 FIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKV 655

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/627 (52%), Positives = 436/627 (69%), Gaps = 12/627 (1%)

Query: 49  MYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPF 108
           M++ H ++ GQ ++ D +  +YSYDYYY+K HFC+PE VE+   S+GSVLFGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 109 ELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYS 168
           +L ML+ K C  LC +TI   DAKFINKLIKNG++ NWLIDGLP+AR++YD++T+S FY 
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 169 SGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK---KREAKNVPAGLITAEEVEYFA 225
           +GF LG V +   +G          KL+  +   ++   KR+AKN+   L+   EV YF 
Sbjct: 121 NGFELGLVEIRQTTG---------EKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFV 171

Query: 226 NHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSV 285
           NHF+I IEYHDRGN+NYRVVGVTV+P+SI R     C PTG  L L+E+  N + FTYSV
Sbjct: 172 NHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSV 231

Query: 286 DFIKSETAWATRWDKYLHTYDPSIQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTD 345
           +FI SETAW TRWDKYLH YDP+IQW S++NF             +LL+ALK D SRY +
Sbjct: 232 EFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGE 291

Query: 346 LNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSY 405
           LNLD +  ED+ WKL HGDVFR P   M+LSI VGSGVQLFLMI+C + + A+G ++P  
Sbjct: 292 LNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGS 351

Query: 406 RGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXX 465
           RG LPT MF+LY  F F+ S+ SMGVYKFF+G  W  N ILTP LVPG +          
Sbjct: 352 RGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIF 411

Query: 466 XXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQ 525
              VHSSG IP +T   +I LW  + VPLS  GS +A K C+W+ +PT  N + + IP Q
Sbjct: 412 LIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQ 471

Query: 526 PWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSI 585
            WY+++IP  L+ G+  FG+++VELYF+Y+SLW+NKIFYM+GFL  S IL   T  LV++
Sbjct: 472 KWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTV 531

Query: 586 IVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICV 645
           +  Y+SL  ENW+WQWRSF+  GLGC+FY+FL+S+ FT  K  GF + LLYMGYS +I  
Sbjct: 532 LFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITS 591

Query: 646 VSCLITGAVSFMCNMFFVKRIFTSIKV 672
           ++ ++TGA+ F+ +M FV+ I++++KV
Sbjct: 592 LAFVVTGALGFLSSMLFVRTIYSAVKV 618

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/655 (50%), Positives = 452/655 (69%), Gaps = 15/655 (2%)

Query: 18  FSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYD 77
            +  FY+PG +  TY  GD I L VN +TP+++ +  D  G     DKE +LY+YDYYY 
Sbjct: 13  LAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSD--DRAGTDGQRDKERYLYAYDYYYP 70

Query: 78  KFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKL 137
           + H CRP+K+E+ SESLGS++FGDR++NSPFEL MLE K CV LC+ T+PA+DAKFIN+L
Sbjct: 71  RLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQL 130

Query: 138 IKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVN 197
           I++GFF+NWL+DGLP+ R+++D++T ++FY +GF LG V            I G      
Sbjct: 131 IRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV------------IRGTEDRNQ 178

Query: 198 EAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRD 257
           E     + +  + +  G  +   V YF NHF I ++YH R  +  RVVGV+V P S++  
Sbjct: 179 EEPGEIELQTRRVLQPGE-SVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNP 237

Query: 258 DFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINF 317
             + C  +GN L L+E A+ +V FTYSV F +S+ +WATRW KYLH YDP +QW+SLINF
Sbjct: 238 VGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINF 297

Query: 318 XXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSI 377
                       H+L RALK D+ RY D NLDN F ED GWKL H DVFR P K ++LS+
Sbjct: 298 SLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357

Query: 378 YVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHG 437
           +VGSG QLFLM  C L +A LGF+SPS RG+L T MFVLYAIFG  GSY SM  YK F G
Sbjct: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGG 417

Query: 438 PYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFL 497
             WK NM+LTPLLVPG +             V SSG +P  T++ ++ LW ++S+P+S +
Sbjct: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477

Query: 498 GSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSL 557
           GS  A KK  W+ +PT  ++I ++IP QPWY+R+ P   ++G+ PFGAIAVELYFIY+S+
Sbjct: 478 GSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSI 537

Query: 558 WYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFL 617
           W+N +FYMFGFL  +F+L+  T+ LV+I++ Y+SLC+ENW WQWRSF+ GG+GC+ Y+F+
Sbjct: 538 WFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFI 597

Query: 618 YSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
            SI FT+F+  GFV+I+LY+GYS LI  + CL+TG + F+ +++FV++I++SIKV
Sbjct: 598 NSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKV 652

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/654 (43%), Positives = 405/654 (61%), Gaps = 63/654 (9%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
           S  FY PG+S  TYH GD I L VN L+                     FL++ DYY D 
Sbjct: 14  SYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYYSDS 54

Query: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138
              C+P  ++ +SESLGSV+FGDR+YNSPF++ ML+  ECV LC TTI   D    N   
Sbjct: 55  IGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFF 111

Query: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198
              + YNWL+DGLP      D  +++  Y +                           +E
Sbjct: 112 GYRYSYNWLVDGLPVLG--IDGTSDANGYHNN--------------------------SE 143

Query: 199 AVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDD 258
               Y+             A+E +Y  NHF+I+I Y+DRG   YRVV     PIS+ R  
Sbjct: 144 LFMGYQ-------------ADEQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTG 190

Query: 259 FESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFX 318
            E C+     + +       + FTYSV F KS+ +W+TRWD+YLH YD  IQ   LI+F 
Sbjct: 191 SELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFS 250

Query: 319 XXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIY 378
                      H+L R LK+DI+ Y++ NLD+ F +D  WK+ HG+VFR P KA++LS++
Sbjct: 251 LVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVF 310

Query: 379 VGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGP 438
           VGSG QLF M LC + + + GF+SPS RG+L T MFVLYA+FG VGSYTSM +YKFF G 
Sbjct: 311 VGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQ 370

Query: 439 YWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLG 498
            WK N+ILTPLL+P  +               SSG +P  T++ +I LW ++SVP+S +G
Sbjct: 371 NWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIG 430

Query: 499 SFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLW 558
           S +++K   W+++P   N+I R++P QPWY+++     L+G+ PFGA+AVELY+IY+S+W
Sbjct: 431 SLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIW 490

Query: 559 YNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLY 618
              IF+M+GFL V+FIL+  T+ LV+I++ Y+SLC+ENW+WQWRSF+ GG+GC+ Y+FL+
Sbjct: 491 GEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLH 550

Query: 619 SIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672
           S+ F +FKF GFVS++LY+GYS+++ +V CL+TG++ F+ N++FV++I+++IKV
Sbjct: 551 SLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKV 604

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  164 bits (415), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 183/735 (24%), Positives = 298/735 (40%), Gaps = 134/735 (18%)

Query: 2   NSLLTSILCLISFHIIFSNAFYIPG-----------ISANTYHPGDPIELEVNRLTPSMY 50
            +L+ ++LCLIS +I+F    Y              +  N Y  GDP+EL VN+      
Sbjct: 6   RALVLTLLCLISIYILFGKGVYQRSRKGSILENSGWLRPNYYSKGDPVELIVNK------ 59

Query: 51  FEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEKVERKSE-SLGSVLFGDRIYNSPFE 109
                     V +D     Y+Y   YD    C P   ++    SL  ++ GDR + S + 
Sbjct: 60  ----------VESDLTQLPYAY---YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSDYI 106

Query: 110 LYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYNWLIDG-LPSARKIYDSKTESIFYS 168
           L   E  +C  LC      +  K   +L+KNG+   WLID  LP+      +     +Y+
Sbjct: 107 LNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWLIDDELPAVTTFISTTDHKKYYA 166

Query: 169 SGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFAN-H 227
           SGF                                        P G +  E  + + N H
Sbjct: 167 SGF----------------------------------------PLGFVDPETGKTYLNTH 186

Query: 228 FNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHL----NENAENQVLFTY 283
             I I Y+    N + + G  + P S         +    Q  L    N++    + FTY
Sbjct: 187 VMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTFIPFTY 246

Query: 284 SVDFIKSE--TAWATRWDKYLH----TYDPSIQ--WFSLINFXXXXXXXXXXXXHALLRA 335
           SV + + E    W  RWD YL+    + D S Q  W SL N               L R 
Sbjct: 247 SV-YWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITAVILYRT 305

Query: 336 LKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRK---------AMVLSIYVGSGVQLF 386
            K  ISR        SF++ S  +   G ++ + RK         A VL I+V  GVQ  
Sbjct: 306 FK--ISR-------RSFSDISKEEDDKGSIYVVARKWLLNEQTPLANVLIIFVSMGVQFL 356

Query: 387 LMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFH---------- 436
             +L  L ++       + R ++ T   + +    F+ S+T   + K             
Sbjct: 357 FTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCSESQMKP 416

Query: 437 GPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSF 496
             Y+    +L   L+P  +               S+  +P  T++ +I ++ +V +PLS 
Sbjct: 417 TRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSL 476

Query: 497 LGSFVAFKKCNWN-------DNPTTVNEIPREIPIQPWYMRSIPV----VLLSGIVPFGA 545
           LG ++A K  N          N +    + + I + P  + + P+    +L  G+ PF  
Sbjct: 477 LGGYIAVKSTNSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILAGGLFPFII 536

Query: 546 IAVELYFIYSSLWYNK--IFYMFGFLLVSFILMIFTSVLVSII---VVYHSLCLENWRWQ 600
           I VEL ++Y SLW  K   +Y +GFLL + +L+      +SII   ++ +S    +  W+
Sbjct: 537 IYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNNWR 596

Query: 601 WRSFVAGGLGCAFYIFLYSIAFTRF--KFTGFVSILLYMGYSSLICVVSCLITGAVSFMC 658
           W SF  G   CAFY+ +YS+ +  F     GF SI + + Y +L  ++    TG+++ + 
Sbjct: 597 WTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIACLT 655

Query: 659 NMFFVKRIFTSIKVH 673
           + +FV++I+  +K H
Sbjct: 656 SHWFVQKIY-KMKYH 669

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  152 bits (384), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 186/728 (25%), Positives = 295/728 (40%), Gaps = 161/728 (22%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           I  N Y   DP+E+ VN+                + +D   F Y+Y   Y+    C P  
Sbjct: 56  IRPNVYEENDPVEIIVNK----------------IESDLTQFPYAY---YELPFTCPPTN 96

Query: 87  VERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
           V++    SL  ++ GDR + S + L+  + + C+ LC      D  +  ++LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           WLID  LP+A         + F S+                               K +K
Sbjct: 157 WLIDDELPAA---------TTFIST-------------------------------KDHK 176

Query: 205 KREAKNVPAGLITAEEVE-YFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCT 263
           K  A   P G +  +  + Y  NH  + I YH    N + +VG+ V P S+   D+    
Sbjct: 177 KYYASGFPLGFMDKDTGKTYLNNHVMLVIRYHTVDINKFTIVGLEVYPKSV--SDYHCPG 234

Query: 264 PTGNQLHLNENAENQ----VLFTYSVDFIKS-ETAWATRWDKYLHTYDPSIQWFSLINFX 318
            + N  H   N E      + FTYS+ + +     W  RW+ ++++ + S +  S  ++ 
Sbjct: 235 ASKNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWI 294

Query: 319 XXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTE-DSGWKLTHGDVFRMPRKAMVLSI 377
                        L+ AL    S  TD  +  S ++  S W + H  +         L++
Sbjct: 295 SLANSVVIVTLMTLVVALILAKSVSTDETVSTSTSQVASQWVVQHSYLLNH------LNV 348

Query: 378 YVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFV-GSYTSMGVYKFF- 435
           +   GVQ    IL  L ++       + R ++ T      A+  F+ G+YTS  V     
Sbjct: 349 FTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLT-----MALMCFISGAYTSSFVGALLS 403

Query: 436 --HGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVP 493
             H    K ++     L PG                 S+  +P  TI+L+I ++ +V +P
Sbjct: 404 ANHNTTIKISIACGSAL-PGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIP 462

Query: 494 LSFLGSFVAF---KKC-----------------NWNDNPTTVNEI--PR-----EIPIQP 526
           LS LG   A    +KC                 +++D P   N++  PR     ++P+  
Sbjct: 463 LSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPL-- 520

Query: 527 WYMRSIPVVL--LSGIVPFGAIAVELYFIYSSLWYNKI--FYMFGFLLVSFILMIFTSVL 582
             M   PV+L  +SGIVPF  I VEL F+Y SLW  K   +Y++GFLL + +L+      
Sbjct: 521 --MLRQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCE 578

Query: 583 VSIIVVY---------------------HSLCLENWR----------------WQWRSFV 605
           +SII  Y                     HS  L+  R                W+W+SF 
Sbjct: 579 ISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRWKSFQ 638

Query: 606 AGGLGCAFYIFLYSIAF--TRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFV 663
            GG   A+Y+  YS+ +  T  K   F SILL+  YS+L   +     GA+ ++   +FV
Sbjct: 639 IGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWFV 697

Query: 664 KRIFTSIK 671
            RI T+ K
Sbjct: 698 NRIHTNSK 705

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  151 bits (381), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 173/719 (24%), Positives = 291/719 (40%), Gaps = 107/719 (14%)

Query: 2   NSLLTSILCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSV 61
            +L+ +I   I F+I + N         +     + I  +   L P+ YF+   +  + +
Sbjct: 6   KTLVFAITSFILFYIFYGNV--------SNKRGNNTILEKAGWLQPNFYFQ--GDEVELI 55

Query: 62  ANDKEHFLYSYDYYYDKFHFCRPEKVERK--SESLGSVLFGDRIYNSPFELYMLEPKECV 119
            N  E  L    Y Y    F  P  + +K    SL  ++ GDR + S + L   +   C 
Sbjct: 56  VNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCH 115

Query: 120 PLCKTTIPADDAKFINKLIKNGFFYNWLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSV 178
            LC      +  K   KL+++G+   WLID  LP+A     +  +  +Y+SGFPLG V  
Sbjct: 116 ILCTRKTTKEGLKNAKKLVEDGYVVQWLIDEELPAATTFISTIDQKKYYASGFPLGFVD- 174

Query: 179 EHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRG 238
                      P   K+                           Y   H  + I Y+   
Sbjct: 175 -----------PDTGKV---------------------------YLNTHVMLVIRYNTVD 196

Query: 239 NNNYRVVGVTVDPISIKRDDFESCTPTGN----QLHLNENAENQVL--FTYSVDFIKSE- 291
            N + +VG  V P S+   DF     + N    ++ + EN ++     FTYSV + + E 
Sbjct: 197 VNKHTIVGFEVYPKSV--SDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSV-YWREEY 253

Query: 292 -TAWATRWDKYLHTYDPS------IQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYT 344
              W  RWD YL++ + S        W SL N               LLR+ K      T
Sbjct: 254 LVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRDIST 313

Query: 345 DLNLDNSFTEDSGWKLTHGDVF--RMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMS 402
           D+N          +++    +   R P  A +L ++V  GVQ    +L  LT++      
Sbjct: 314 DINKSEEHRNGLVYEVARNWIINERTPL-ANLLILFVSMGVQFLFTVLGSLTISCSLNKL 372

Query: 403 PSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKAN----------MILTPLLVP 452
                ++ T   + + +  F+ SY    + +  +    K             IL    +P
Sbjct: 373 HDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLP 432

Query: 453 GSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFK---KCNWN 509
           G +               S+  +P  T+++ I ++ +V +PLS LG ++A     K +  
Sbjct: 433 GIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLT 492

Query: 510 DNPTTVNEIPREI---PIQP--------WYMRSIPV---VLLSGIVPFGAIAVELYFIYS 555
           D     +    E+    ++P          ++SI +   +LLSGI PF  I VEL ++Y 
Sbjct: 493 DPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYK 552

Query: 556 SLWYNK--IFYMFGFLLVSFILMIFTSVLVSIIVVY---HSLCLENWRWQWRSFVAGGLG 610
           S+W  K   +Y +GFL  + +L+      ++II  Y   H     N  W+W SF  G   
Sbjct: 553 SVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-S 611

Query: 611 CAFYIFLYSIAFTRF--KFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667
           CA+Y+ LYS+ +  F     GF SI + + Y +L   +     G+++ + + FFV++++
Sbjct: 612 CAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  148 bits (374), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 174/711 (24%), Positives = 272/711 (38%), Gaps = 132/711 (18%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           I+ N Y  GDP+EL VN+                V +D     Y+Y   YD    C P  
Sbjct: 52  ITPNFYRKGDPLELIVNK----------------VESDLTQLPYAY---YDLPFTCPPTM 92

Query: 87  VERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
            ++    SL  ++ GDR + S ++L   E   C  LC      +  + ++KL++ G+   
Sbjct: 93  HKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQ 152

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           WLID  LP+A     +     +Y+SGFPLG +             P   K          
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFID------------PDTDK---------- 190

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP 264
                             Y  NH  + I +H   N+   +VG  V P S+        + 
Sbjct: 191 -----------------TYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASK 233

Query: 265 TGNQLHL----NENAENQVLFTYSVDFIKS-ETAWATRWDKYLH----TYDPSIQ--WFS 313
              Q  +    +EN    + FTYSV + +  E  W  RWD +L+    + + SIQ  W S
Sbjct: 234 NYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMS 293

Query: 314 LINFXXXXXXXXXXXXHALLRALKKDISRYTD----LNLDNSFTEDSGWKLTHG------ 363
           L N                +R +  D S        +N++   TED      +G      
Sbjct: 294 LANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYT 353

Query: 364 ---DVFRMPRKAM----VLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVL 416
              D  +  R  +    VL + V  GVQ    I+  LT++       + R ++ T   + 
Sbjct: 354 VAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILF 413

Query: 417 YAIFGFVGSYTSMGVYKFFHGPYWKAN------------------MILTPLLVPGSMXXX 458
           + +  F+ S+    +         KAN                   IL    +PG +   
Sbjct: 414 FVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVS 473

Query: 459 XXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVA------------FKKC 506
                       S+  +P  TI+  + ++ +V +PLS  G  VA              K 
Sbjct: 474 TFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKD 533

Query: 507 NWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNK--IFY 564
             N +   +          P     I    L GI P   I VE+ ++Y SLW  K   +Y
Sbjct: 534 ESNSDGNGLFVPKSRAKFNPLVYCGI---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYY 590

Query: 565 MFGFLLVSFILMIFTSVLVSIIVVY--HSLCLENW----RWQWRSFVAGGLGCAFYIFLY 618
            +GFL +S IL+   ++ +SII  Y     C E+      W+W+ F  G  G   Y+ LY
Sbjct: 591 FYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELY 649

Query: 619 SI--AFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667
           S+   F      GF SIL+ + YS +  V+  L  GA+S++   +F+ +I+
Sbjct: 650 SLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 175/729 (24%), Positives = 285/729 (39%), Gaps = 144/729 (19%)

Query: 16  IIFSNA--FYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYD 73
           II+S+    Y   I+ N Y  GDP+EL VN+                V +D     Y+Y 
Sbjct: 39  IIYSSQSNLYDGWITPNFYKNGDPLELIVNK----------------VESDLTQLPYAY- 81

Query: 74  YYYDKFHFCRPEKVERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAK 132
             YD    C P   +     SL  ++ GDR + S ++L   E   C  LC      +  +
Sbjct: 82  --YDLPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQ 139

Query: 133 FINKLIKNGFFYNWLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPG 191
            ++KLI+ G+   WLID  LP+A     +     +Y+SGFPLG +             P 
Sbjct: 140 TLDKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD------------PD 187

Query: 192 VSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDP 251
             K                            Y  NH  + I +H   N    +VG  V P
Sbjct: 188 TGK---------------------------TYLHNHVMLVIRFHSGDNGKNTIVGFEVYP 220

Query: 252 ISIKRDDFESCTPTGNQLHL----NENAENQVLFTYSVDFIKS-ETAWATRWDKYLHTYD 306
            S+        + T  Q  +    +EN    + FTYSV + +  E  W  RWD +L++ +
Sbjct: 221 RSVSDYHCPGASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGE 280

Query: 307 PS------IQWFSLINFXXXXXXXXXXXXHALLRALKKDI----SRYTDLNLDNSFTED- 355
            S        W S  N                +  +  D     S    +N++    ED 
Sbjct: 281 LSDEQSSQFHWMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDV 340

Query: 356 -SGWKLTHGDVFRMPRKAMV-----------LSIYVGSGVQLFLMILCCLTVAALGFMSP 403
            +  K +   V+ + +  +            L + V  GVQ    ++  LT++       
Sbjct: 341 LNNDKYSKNSVYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLH 400

Query: 404 SYRGALPTCMFVLYAIFGFVGSYTSMGV-----YKFFHGPYWKAN-------------MI 445
           + R ++ T   + + I  F+ S+    +      + F+  Y+  N              I
Sbjct: 401 NVRNSVLTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAI 460

Query: 446 LTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKK 505
           +    +PG +               S+  +P  TI+  I ++ +V +PLS  G  VA   
Sbjct: 461 ICGSSLPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVA--- 517

Query: 506 CNWNDNP--------TTVNEIPRE-----IPIQPWYMRSIPVV----LLSGIVPFGAIAV 548
              N+ P         T++E   +     +P  P   +  P+V     L G+ P   I V
Sbjct: 518 ---NNIPLPQYWLSGITIDESDSKNNKLFLPKSP--NKFNPLVNCGIYLCGVFPLLVIYV 572

Query: 549 ELYFIYSSLWYNK--IFYMFGFLLVSFILMIFTSVLVSIIVVY--HSLCLENW----RWQ 600
           E+ ++Y SLW  K   +Y +GFL +S IL+   ++ +S+I  Y     C E+      W+
Sbjct: 573 EMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWR 632

Query: 601 WRSFVAGGLGCAFYIFLYSI--AFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMC 658
           W+ F  G  G   Y+ LYS+   F      GF SIL+ + YS L  ++  L  GA+S++ 
Sbjct: 633 WKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLT 691

Query: 659 NMFFVKRIF 667
             +F+ +I+
Sbjct: 692 ASWFINKIY 700

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  139 bits (350), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 173/722 (23%), Positives = 281/722 (38%), Gaps = 134/722 (18%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
            N +Y   I+ N Y  GDP+EL VN+                V +D     Y+Y   YD 
Sbjct: 44  DNTYYDGWITPNFYKKGDPLELIVNK----------------VESDLTQLPYAY---YDL 84

Query: 79  FHFCRPEKVERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKL 137
              C P   ++    SL  ++ GDR + S + L   E   C  LC      +  + ++KL
Sbjct: 85  PFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKL 144

Query: 138 IKNGFFYNWLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLV 196
           ++ G+   WLID  LP+A     +     +Y+SGFPLG V             P   K  
Sbjct: 145 VREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD------------PDTGK-- 190

Query: 197 NEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKR 256
                                     Y  NH  + I +H   N+   +VG  V P S+  
Sbjct: 191 -------------------------TYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSD 225

Query: 257 DDFESCTPTGNQLHL----NENAENQVLFTYSVDFIKS-ETAWATRWDKYLHTYDPS--- 308
                 +    Q  +    +EN    + FTYSV + +  E  W  RWD +L++ + S   
Sbjct: 226 YHCPGASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEK 285

Query: 309 ---IQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTD-----LNLDNSFTEDSGWKL 360
                W S  N                ++ + +D  + TD     +N++ +  ED+    
Sbjct: 286 SAQFHWMSFANSMGIVLSISFITAVIYIQVMHRD-KKNTDSTKYLINIEGAEVEDNLDDD 344

Query: 361 THG---------DVFRMPRKAM----VLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRG 407
            +G         D  +  R  M    VL + V  GVQ    ++  LT++       + R 
Sbjct: 345 KYGKNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRN 404

Query: 408 ALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMI-----------LTPLL------ 450
           ++ T   + + +  F+ S+    +         + N +            +P+       
Sbjct: 405 SVITMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGS 464

Query: 451 -VPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFK---KC 506
            +PG +               S+  +P  TI+  I ++ +V +PLS  G  VA       
Sbjct: 465 SLPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPR 524

Query: 507 NW----NDNPTTVNE----IPR-EIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSL 557
           +W      + T  N     +PR      P     I    L G+ PF  I VEL ++Y S+
Sbjct: 525 HWLSGITKDETCGNSSRLFVPRSRTKFNPLVYCGI---YLCGLFPFLVIYVELQYVYKSV 581

Query: 558 WYNK--IFYMFGFLLVSFILMIFTSVLVSIIVVYH--SLCLENW----RWQWRSFVAGGL 609
           W  K   +Y +GFLL++ IL+   ++ +SII  Y     C E+      W+W+ F  G  
Sbjct: 582 WLEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFS 641

Query: 610 GCAFYIFLYSI--AFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667
           G   Y+ LYS+   F      GF S L+ + YS L  ++  L  G +S++   +F+ +I+
Sbjct: 642 G-GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIY 700

Query: 668 TS 669
            S
Sbjct: 701 HS 702

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  137 bits (344), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 162/699 (23%), Positives = 269/699 (38%), Gaps = 122/699 (17%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           +  N Y  GD +EL VN+                V +D   F Y Y   YD    C P +
Sbjct: 41  LQPNVYRWGDHVELLVNK----------------VESDLTQFPYGY---YDLPFTCPPTE 81

Query: 87  VERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
            ++    SL  ++ GDR + S ++L   +   C  LC         +   +L++ G+   
Sbjct: 82  DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQ 141

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           WLID  LP+A     +     +Y SGFPLG V  +                         
Sbjct: 142 WLIDQELPAATTFISTIDHKKYYVSGFPLGFVDPD------------------------- 176

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP 264
                          E  Y   H  + I Y+      + +VG  V P S+        + 
Sbjct: 177 --------------TEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASK 222

Query: 265 TGNQLHL----NENAENQVLFTYSVDFIKS-ETAWATRWDKYLHTYDPS------IQWFS 313
              Q  L    NE+    + FTYSV + +  +  W+ RW+ +L++ + S        W +
Sbjct: 223 GYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMT 282

Query: 314 L---INFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPR 370
           L   +              + ++R   +  S       D +   DS + +    + +   
Sbjct: 283 LGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDS 342

Query: 371 KAM---VLSIYVGSGVQLFLMILCCLTVA-ALGFMSPSYRGALPTCMFVL----YAIFGF 422
            ++   +L+I+V  GVQ    I+  L  + +L  +       L    F L    Y    F
Sbjct: 343 SSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLF 402

Query: 423 VGSYTSMGVYKFFHGPYWKANM--ILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTI 480
           VG++  +       G   +     IL    +PG +               SS  +P  TI
Sbjct: 403 VGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTI 462

Query: 481 ILMICLWLLVSVPLSFLGSFVA---------------------FKKCNWNDNPTTVNEIP 519
           +L + ++ ++ +PLS LG  V+                      K C     PTT+   P
Sbjct: 463 VLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSIKPCR---APTTLA--P 517

Query: 520 REIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNK--IFYMFGFLLVSFILMI 577
           R+I  +  +        + G +PF  I VEL +IY S+W  K   +Y++GFLL + IL+ 
Sbjct: 518 RKISERLTF--DFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLC 575

Query: 578 FTSVLVSIIVVY-----HSLCLENWRWQWRSFVAGGLGCAFYIFLYSI--AFTRFKFTGF 630
                VS +  Y     H        W+W+ F+  G  CA+Y+ LYS+   F   K TGF
Sbjct: 576 IVVCEVSFLGCYVMMRKHKRVATFDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLKMTGF 634

Query: 631 VSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTS 669
            SI + + YS +  ++     G++ ++ + + V R+F +
Sbjct: 635 PSIFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  132 bits (333), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 161/695 (23%), Positives = 274/695 (39%), Gaps = 137/695 (19%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           +S N Y  GD +++ VN+                V +D  HF Y Y   YD  HF  P  
Sbjct: 57  LSPNFYEYGDKVDITVNK----------------VESDLTHFSYGY---YD-LHFTCPPS 96

Query: 87  VERKSESL--GSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFY 144
            + K   L    +L+G++ + S ++L   + ++CV LC      +  K   +LIK  +  
Sbjct: 97  QDMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVV 156

Query: 145 NWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
            WL D                                       +PG +  +N   K  K
Sbjct: 157 QWLADD-------------------------------------DLPGATTYLN--TKDKK 177

Query: 205 KREAKNVPAGLITAEEVE-YFANHFNIHIEYH--DRGNNNYRVVGVTVDPISIKRDDFES 261
           K  +   P G    E  E Y  NH  I I YH  D+G N   +VG  V P S+       
Sbjct: 178 KYYSSGFPLGQYDPETDEAYINNHVMIVIRYHTIDQGKNT--IVGFEVYPKSVSDHHCPG 235

Query: 262 CTPTGNQLHLNENAENQ--VLFTYSVDFIKS-ETAWATRWDKYLH------TYDPSIQWF 312
            +       ++   E+   + FTY+V + +  +  W  RW+ +++      +      W 
Sbjct: 236 ASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWI 295

Query: 313 SLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKA 372
           +  N              A+L+  + D S  T L  +        W      +F      
Sbjct: 296 TFANGIIVTSCLLLIVI-AILKRQETDGSITTQLAAE--------WSKARVPLF------ 340

Query: 373 MVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFV-GSYTSMGV 431
             L++ V  G+      L  L ++     +     ++ TC     A+F F+ GS+TS  +
Sbjct: 341 FQLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTC-----AVFLFISGSFTSSFI 395

Query: 432 YKFFHGPYWK---ANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWL 488
                G   +    N I+    +PG                +++ T+P  T+ L+   + 
Sbjct: 396 GALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYF 455

Query: 489 LVSVPLSFLGSFVAFKKCNWNDNPTTVNEIP----REIPIQPWYMRS-----------IP 533
           +V VP+S +G   A +    N   T +N        +   +P Y+ S           I 
Sbjct: 456 IVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIA 515

Query: 534 VVLLSGIVPFGAIAVELYFIYSSLWYNK--IFYMFGFLLVSFILMIFTSVLVSIIVVYHS 591
           + L  G++PF  I VEL F Y SLW  K  ++Y++GFLL + +++     L+SII  Y  
Sbjct: 516 ITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIH 575

Query: 592 LCLEN------W------------RWQWRSFVAGGLGCAFYIFLYSIAFTRF--KFTGFV 631
           L   N      W             W+W++F  GG   A+Y+  YSI +  F  ++  F+
Sbjct: 576 LNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFI 634

Query: 632 SILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRI 666
           S  L++ YS+L  ++     G++S++ +++F+ ++
Sbjct: 635 SSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  130 bits (327), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 161/715 (22%), Positives = 280/715 (39%), Gaps = 143/715 (20%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           ++   Y  GDP+E+ VN+                + +D     Y Y   YD   F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNK----------------IESDATQLPYGY---YD-LPFTCPPT 72

Query: 87  VERK--SESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFY 144
           V++K    SL  V+ GDR + S +EL   +  EC  LC      D  + ++K IK  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 145 NWLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAY 203
            W ID  LP+A     +  +  +Y SGFPLG V  E      KV                
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFVDEE----TGKV---------------- 172

Query: 204 KKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKR------- 256
                              Y  NH  + I YH   + N+ +VG  + P S+         
Sbjct: 173 -------------------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGAS 213

Query: 257 ---DDFESCTPTGNQLHLNENAENQVLFTYSVDFIKS-ETAWATRWDKYLHTYDPS---- 308
              D +E   P         N +  + FTYSV + +  +  W  R++ +  + + S    
Sbjct: 214 KDYDQYEVVVPE------IANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVS 267

Query: 309 --IQWFSLINFXXXXXXXXXXXXHALLR--ALKKDISRYTDLNLDNSFTEDSGWKLTHGD 364
               W SL N                ++   +   +    +    + F     W   + D
Sbjct: 268 RKFHWISLANSASIAFLMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNW--FYDD 325

Query: 365 VFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVG 424
              MP   + +   V  GV     ++  LT++       + R ++ T   + + +  F+ 
Sbjct: 326 RPVMPHLFICI---VSMGVHFLFTVIGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMA 382

Query: 425 SYTSMGVYKFFHGPYWK--------ANMILTPL----LVPGSMXXXXXXXXXXXXGVHSS 472
           S+    +    +    +        +N++L  +    L+PG +               S+
Sbjct: 383 SFVGGTLLIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTST 442

Query: 473 GTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCN----------------------WND 510
             +P +TI+ ++ ++ +V +PLS LG  +A  K +                       ++
Sbjct: 443 NVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDE 502

Query: 511 NPTTVNEIPREIPIQ-PWYMR-------SIPVVLLSGIVPFGAIAVELYFIYSSLWYNK- 561
           +  T     R++  +  W ++       ++  +L SGI PF  I VEL F+Y S+WY K 
Sbjct: 503 DQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKT 562

Query: 562 -IFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENW----RWQWRSFVAGGLGCAFYIF 616
             +Y +GFLL + IL+      ++II  Y  + + +      W+W++F      CA+Y+ 
Sbjct: 563 TFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYME 621

Query: 617 LYSI--AFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTS 669
            YSI   F       F SIL+ + YS L   +  L  G++ ++ +++FVKR++ S
Sbjct: 622 AYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  130 bits (326), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 154/679 (22%), Positives = 280/679 (41%), Gaps = 108/679 (15%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           +  N Y  GDP+EL VN +      E TD                + YY     F  P  
Sbjct: 41  LKPNVYSIGDPLELVVNTVES----EITD--------------IPFGYY--DLPFTCPPT 80

Query: 87  VERKSE--SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFY 144
            E+K    SL  ++ GDR + S ++L + +   C  LC      +  +    LIK+G+  
Sbjct: 81  PEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMV 140

Query: 145 NWLIDGLPSARKIYDSKTESI-FYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAY 203
            W+ID    A   Y S T+++ +Y+ GFPLGSV             P  S++        
Sbjct: 141 QWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD------------PRSSRV-------- 180

Query: 204 KKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCT 263
                              +F NH  + I Y+   ++   +VG    P S+        +
Sbjct: 181 -------------------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGAS 221

Query: 264 PTGNQLHLNENAENQVLF---TYSVDFIK-SETAWATRWDKYLH------TYDPSIQWFS 313
                  + +    ++++   TYSV + + +E  W+ RW  Y++      +   +  W +
Sbjct: 222 KDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMA 281

Query: 314 LINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAM 373
           L N               L+      I R  +  L++   EDS       + +   R+  
Sbjct: 282 LANSVGIVLFVTFIVIVNLIM-----IFRNPNEQLESKENEDSSDIFNVANNWLRARQGF 336

Query: 374 VLS---IYVGSGVQLFLMIL----CCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSY 426
            L+   + V  G+Q+  MIL      L++  L  +  S       C      +  FVG++
Sbjct: 337 QLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTW 396

Query: 427 TSM----GVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIIL 482
             M      Y F++  +     +L    +PGS+               S+  +P  T+++
Sbjct: 397 LKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVV 452

Query: 483 MICLWLLVSVPLSFLGSFVAFK--KCNWNDNPTTVNEIPREIPIQPWYMRSIPVV----L 536
            +  + +V + +S LG  VA +  +   +D P       R++  +   +    VV    L
Sbjct: 453 FVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGL 512

Query: 537 LSGIVPFGAIAVELYFIYSSLWYNK--IFYMFGFLLVSFILMIFTSVLVS-----IIVVY 589
           +SG +PF  I VEL ++Y S+W  K  ++Y++ FL  + +L+      +S     +++  
Sbjct: 513 ISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKL 572

Query: 590 HSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRF--KFTGFVSILLYMGYSSLICVVS 647
           +   + +  W+WR FV    GC++Y+ +YS+ +  F    TG  ++ + + YS +  V+ 
Sbjct: 573 NHKFINDQNWRWRCFVIST-GCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLC 631

Query: 648 CLITGAVSFMCNMFFVKRI 666
            L TG++ ++ + +FVK+I
Sbjct: 632 GLATGSLGYLTSSWFVKKI 650

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  129 bits (324), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 176/721 (24%), Positives = 280/721 (38%), Gaps = 136/721 (18%)

Query: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78
           +N +Y   I+ N Y   D +EL VN+                V +D     Y+Y   YD 
Sbjct: 45  NNLYYDGWITPNFYKKNDFLELIVNK----------------VESDLTQLPYAY---YDL 85

Query: 79  FHFCRPEKVERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKL 137
              C P   ++    SL  ++ GDR + S ++L   E   C  LC         + ++KL
Sbjct: 86  PFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKL 145

Query: 138 IKNGFFYNWLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLV 196
           ++ G+   WLID  LP+A     +     +Y+SGFPLG V             P   K  
Sbjct: 146 VREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD------------PDTDK-- 191

Query: 197 NEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKR 256
                                     Y  NH  + I +H  G++   VVG  V P S+  
Sbjct: 192 -------------------------TYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSD 226

Query: 257 DDFESCTPTGNQLHL----NENAENQVLFTYSVDFIKS-ETAWATRWDKYLHTYDPS--- 308
                 +    Q  +    +E+    + FTYSV + +  E  W  RW+ +L+  + S   
Sbjct: 227 YHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQ 286

Query: 309 ---IQWFSLINFXXXXXXXXXXXXHALLRALKKDISRYTD-----LNLDNSFTEDS--GW 358
                W SL N                +R ++ D  + TD     +N +    EDS    
Sbjct: 287 SAQFHWMSLANSLGIVLSISFITFVIYIRVMRTD-KKNTDSHKYLINTEGIEAEDSLDDD 345

Query: 359 KLTHGDVFRMPRKAM-----------VLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRG 407
           K     V+ + +  +           VL + V  GVQ    I+  LT++       + R 
Sbjct: 346 KYGKNSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRN 405

Query: 408 ALPTCMFVLYAIFGFVGSY--TSMGVYK---------FFHGPYWKANMILTPLL------ 450
           ++ T   + + +  F+ S+  T +G+             H   +K     +P+       
Sbjct: 406 SVLTMAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGS 465

Query: 451 -VPGSMXXXXXXXXXXXXGVH-SSGTIPASTIILMICLWLLVSVPLSFLGSFVA------ 502
            +PG M            G H S+  +P  TI+  I ++ +V +PLS  G  VA      
Sbjct: 466 SLPG-MVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLP 524

Query: 503 ------FKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSS 556
                   K   + N + + +        P        V L GI P   I VE+ ++Y S
Sbjct: 525 KYWLSGITKDETDGNGSKLFKPKSRTRFNPLVHCG---VYLCGIFPLLVIYVEMQYVYKS 581

Query: 557 LWYNKI--FYMFGFLLVSFILMIFTSVLVSIIVVY--HSLCLENWR----WQWRSFVAGG 608
           LW  K   ++ +GFL +S IL+   ++ +SII  Y     C ++      W+WR F  G 
Sbjct: 582 LWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGF 641

Query: 609 LGCAFYIFLYSI--AFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRI 666
            G   Y+ LYS+   F      GF SIL+ + YS L  ++  L  GA+S +   +F+ RI
Sbjct: 642 SG-GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRI 700

Query: 667 F 667
           +
Sbjct: 701 Y 701

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 167/718 (23%), Positives = 275/718 (38%), Gaps = 147/718 (20%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           ++ N Y  GD +EL VN+                V +D     Y+Y   YD    C P K
Sbjct: 51  VNPNLYKIGDHVELIVNK----------------VESDLTQLPYAY---YDLPFICPPTK 91

Query: 87  VERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
            ++    SL  +  GDR + S ++L       C  LC      +      +L++ G+   
Sbjct: 92  EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQ 151

Query: 146 WLID-GLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           WLID  LP+A     S   + +Y++GFP+G V                            
Sbjct: 152 WLIDESLPAATTFISSTNHNKYYAAGFPVGYVD--------------------------- 184

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP 264
            R  K             +  NH  + I YH      + +VG  V P S+   D+    P
Sbjct: 185 DRTGKT------------FLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSV--SDYH--CP 228

Query: 265 TGNQLH--------LNENAENQVLFTYSVDFIKS-ETAWATRWDKYLHTYDPS------I 309
             N+ H          ++    + FTYSV + +  E  W  RW+ +L+  + S       
Sbjct: 229 GANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQF 288

Query: 310 QWFSLINFXXXXXXXXXXXXHALLRALKK------DISRYTDLNLDNSFTEDSGWKLTHG 363
            W S +N               LL+   K      +I+  T+L  DN   ED       G
Sbjct: 289 HWMSFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDN---EDDNDDKISG 345

Query: 364 DVF----------RMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPT-- 411
            VF          ++P    ++ +    G+Q    IL  L ++       + R  + T  
Sbjct: 346 SVFVNAKTWITVGKIPYWKALICL-TSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMS 404

Query: 412 --CMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLL---------VPGSMXXXXX 460
             C     AI G++GS   +  Y+   G Y +  +  T +          +PG +     
Sbjct: 405 LICFICGAAISGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISF 462

Query: 461 XXXXXXXGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPT------- 513
                     S+  +P  T + ++ ++ +  +PLS LG  +A   C  +   T       
Sbjct: 463 SLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLAL-NCKVDSYNTLKRITSL 521

Query: 514 TVNEIPRE-----IPIQPWYMRSIPVVLLSGIVPFGAIA----------VELYFIYSSLW 558
             N I R+           Y R +  +       FGA+A          VEL ++Y S+W
Sbjct: 522 RRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVW 581

Query: 559 YNKI--FYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWR-----WQWRSFVAGGLGC 611
             K   +Y +GFLL + +++   ++ ++II  Y  L  +N R     W W+SF+ G   C
Sbjct: 582 LEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SC 640

Query: 612 AFYIFLYSIAFTRF--KFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667
           A+Y+ LYS+ +  F     GF SI + + YS L   +     G++S++ +   V +I+
Sbjct: 641 AWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY 698

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  120 bits (301), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 161/680 (23%), Positives = 268/680 (39%), Gaps = 109/680 (16%)

Query: 41  EVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEKVERK--SESLGSVL 98
           + NRLTP++Y +  D   + + N  E  L    Y Y    F  P   +RK    SL  +L
Sbjct: 33  DANRLTPNIYRKGDDV--ELIVNKIESDLTKLPYGYYDLPFICPPTNQRKPLHMSLTEIL 90

Query: 99  FGDRIYNSPFELYMLEPKECVPLC-KTTIPADDAKFINKLIKNGFFYNWLIDG-LPSARK 156
            GDR + S + L   +  +C  LC + T P    K IN L+K  +   W ID  LP++  
Sbjct: 91  RGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWSIDNDLPASTT 149

Query: 157 IYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYKKREAKNVPAGLI 216
              +     +Y  GF LG V  +                                     
Sbjct: 150 FISTSENRKYYIPGFSLGFVDPD------------------------------------- 172

Query: 217 TAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAE 276
              E  Y  NH  + I YH   + ++ +VG+ V P S+        +    Q  L  N +
Sbjct: 173 --TETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDD 230

Query: 277 NQVL---FTYSVDFIKS-ETAWATRWDKYLHTYDPS------IQWFSLINFXXXXXXXXX 326
            +V    FTYSV + +  +  W  R+  + ++ + S       +W  L N          
Sbjct: 231 EEVTYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITDKFRWILLANSSGLALFISM 290

Query: 327 XXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAM---------VLSI 377
                 LR  KK+ +            E+S  +   G +  + RK +          L +
Sbjct: 291 IVSVIFLRISKKNKN------------ENSAIESKKGSMDVIARKWLRNDRTIHFNFLIV 338

Query: 378 YVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHG 437
            V  GV     +L  L ++       + R ++ T + + + + GF+ S+    +    + 
Sbjct: 339 LVSFGVHFAFTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTCLIMQKNK 398

Query: 438 PYWKANMI---LTPL-------LVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLW 487
             +K ++     +PL       L+P  +               SS  +P  TI+ +I ++
Sbjct: 399 TMYKGSLKRLHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIY 458

Query: 488 LLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYM-RSIPVVL---------- 536
            +V +PLS LG   A   C         +   +++ +    + R+I  +           
Sbjct: 459 FIVCIPLSLLGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLAS 518

Query: 537 LSGIVPFGAIAVELYFIYSSLWYNK--IFYMFGFLLVSFILMIFTSVLVSIIVVY---HS 591
           + G+ PF  I VEL  +Y  +W  K   +Y+  FL  + I++    V ++II  Y   HS
Sbjct: 519 IGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHS 578

Query: 592 --LCLENWRWQWRSFVAGGLGCAFYIFLYSI--AFTRFKFTGFVSILLYMGYSSLICVVS 647
               LEN  W+WRSF      CA+Y+ LYS+   F     TGF SILL +  S+L   + 
Sbjct: 579 SRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLC 636

Query: 648 CLITGAVSFMCNMFFVKRIF 667
               G++ ++   +FV R++
Sbjct: 637 GCALGSIGYLATCWFVGRVY 656

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score =  117 bits (294), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 168/732 (22%), Positives = 276/732 (37%), Gaps = 166/732 (22%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           I  N Y  GD ++L VN+                V ++  +  Y Y   YD    C P +
Sbjct: 44  IKPNVYKRGDKVDLTVNK----------------VESEITNLPYGY---YDLRFVCPPSE 84

Query: 87  VERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
            ++    SL  V+ GDR + S + L     ++C  LC      D  +  ++LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           WLIDG LP+A     +++   FY++GFPLG V  E                         
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLGRVDHE------------------------- 179

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP 264
                          +  +  NH  + I Y     N Y +VG  V P S+        + 
Sbjct: 180 --------------TDKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASK 225

Query: 265 TGNQLHLN--ENAENQVLFTYSVDFIK-SETAWATRWDKYLH--TYDPS-----IQWFSL 314
           +     +N  E     + FTYSV + + S   W+ RW+ +    +  P+       W SL
Sbjct: 226 SFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISL 285

Query: 315 INFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMV 374
            N                L+    D            F     ++     V+ + +    
Sbjct: 286 ANSAIVVALMTLFIALIFLKIRADD------------FVGTLAFEWASQPVYYLTQ---- 329

Query: 375 LSIYVGSGVQLFLMILCCLTVAALGFMSPSYRG-ALPTCMFVLYAIFGFVGSYTSMGVYK 433
           L++    G+Q    I+   T++       + R   L T      AI   +G+YTS  V  
Sbjct: 330 LNLAASMGIQFLFSIIGSSTISCSLCKVHNIRSWELSTA-----AICFVLGAYTSSLVGS 384

Query: 434 FFHGPYWKANM---ILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMICLWLLV 490
               P  K N+   +L    +P                  SS  +P  T++ ++  + ++
Sbjct: 385 LL-APGPKMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVI 443

Query: 491 SVPLSFLGSFVAFKKCNWNDNPTTVNE--IPREIPIQPWYM----------RSIPVVL-- 536
            +PLSFLG F A K  +   N     +  +P    +   Y           + IP +L  
Sbjct: 444 CLPLSFLGGFSARKLRSAPANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSN 503

Query: 537 ------LSGIVPFGAIAVELYFIYSSLWYNK--IFYMFGFLLVSFILMIFTSVLVSIIVV 588
                 ++G  PF     EL F+Y SLW  K  ++ ++GFLLV+FI +  T   VS++V 
Sbjct: 504 PFLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVC 563

Query: 589 Y-----------------------HSLC---------LEN--------WR-----WQWRS 603
           Y                        S+C         L+N        W+     W+W++
Sbjct: 564 YVLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKA 623

Query: 604 FVAGGLGCAFYIFLYSIAFTRF--KFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMF 661
           F+AG    A+Y  LYS+ +  F      F SILL++ Y+SL  ++     GA+ ++  ++
Sbjct: 624 FMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLW 682

Query: 662 FVKRIFTSIKVH 673
           F+  +    K H
Sbjct: 683 FLNFVSAPHKSH 694

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 125/315 (39%), Gaps = 78/315 (24%)

Query: 18  FSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYD 77
           FS ++    I  N Y  GD +++ +N+                V ++   F Y Y   YD
Sbjct: 31  FSQSYDFGWIKPNVYKKGDKVDVIINK----------------VVSETARFPYGY---YD 71

Query: 78  KFHFCRP-EKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINK 136
               C P +K +    SL  ++ GDR + S + L   E  +C+ LC      +  K  + 
Sbjct: 72  LQFVCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADA 131

Query: 137 LIKNGFFYNWLI-DGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKL 195
           LI+ G+  +WLI D LP+A     +K+   FY++GFPLG V            + G ++L
Sbjct: 132 LIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD----------AVTGKTRL 181

Query: 196 VNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIK 255
                                         NH  + + Y     N + ++G  V P S+ 
Sbjct: 182 Y-----------------------------NHLMLVVRYQTVDVNKHTIIGFEVYPKSVS 212

Query: 256 RDDFESCTPTGN------QLHLNENAENQVLFTYSVDFI-KSETAWATRWDKYLHTYDPS 308
               ++  P  N      +++  E+    + FTYS+ +  +S   W+ RW+ ++H    S
Sbjct: 213 ----DAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIHDDTSS 268

Query: 309 -------IQWFSLIN 316
                    W SL N
Sbjct: 269 HSKRQSLFHWISLAN 283

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 114/274 (41%), Gaps = 74/274 (27%)

Query: 471 SSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCN----------------------W 508
           SS  IP  T+++ +  + ++S PLS LG F A K  N                      +
Sbjct: 420 SSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAKLAPANAISKSPFSFLLTLSY 479

Query: 509 NDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYN--KIFYMF 566
           +        + +  PI       I + +L+GI PF  I VEL+++Y S+W      +Y++
Sbjct: 480 DTRSWPATALGKPFPIA--LSNPILLTILAGIAPFVVICVELFYVYKSMWLQTTNFYYLY 537

Query: 567 GFLLVSFILMIFTSVLVSIIVVY------------------------------------- 589
           GFLLV+F+ +      VS++V Y                                     
Sbjct: 538 GFLLVNFMFLCIIVCEVSLLVCYVLMVHNHSGQAPEIESDPYTKLSNSRRCSPITIVNKL 597

Query: 590 --------HSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRF--KFTGFVSILLYMGY 639
                   H L      W+W+SFVAGG   A+Y+ LYS+ +  F        SILL++ Y
Sbjct: 598 KNVLASIAHHLKASFSSWRWKSFVAGG-SVAWYLELYSLYYLIFVLHLRDLSSILLFVCY 656

Query: 640 SSLICVVSCLITGAVSFMCNMFFVKRIFTSIKVH 673
           ++L   +     GA+ ++  ++F+  I +S K H
Sbjct: 657 TALFNFMCWCAFGALGYLSCLWFLSHISSSSKAH 690

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 93/243 (38%), Gaps = 48/243 (19%)

Query: 75  YYDKFHFCRPEKVERK-SESLGSVLFGDRIYNSPFELYMLEPKECVPLC-KTTIPADDAK 132
           YYD    C P K  R    SL  V  GDR + S ++LY     +C  LC + T P+   +
Sbjct: 69  YYDLQFTCTPTKSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE 128

Query: 133 FINKLIKNGFFYNWLIDGLPSARKIYDS-KTESIFYSSGFPLGSVSVEHMSGGSKVTIPG 191
             + LI+  +    LID +  A K Y S +    +Y  GFPLG V  E            
Sbjct: 129 -ADSLIRQNYTVQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVDPE------------ 175

Query: 192 VSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDP 251
                                       +V Y  NHF + I Y+    N Y +VG  V P
Sbjct: 176 ---------------------------TDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYP 208

Query: 252 ISIKRDDFESCTPTGNQLHLNENAENQVL--FTYSVDFIKSE--TAWATRWDKYLHTYDP 307
            S+  D     +       +N + ++ V    TYSV + + E    W  RW+ YL   D 
Sbjct: 209 KSVSDDHCPGSSKDYENYAVNPSEKDVVFIPITYSV-YWREEFMVDWENRWNFYLSAGDL 267

Query: 308 SIQ 310
            + 
Sbjct: 268 DVN 270

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 105/250 (42%), Gaps = 55/250 (22%)

Query: 469 VHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCN--------------------- 507
           +     +P   I L++ L+ +VS+PLS LG   A  K                       
Sbjct: 422 IERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLKDQHFQLYSLSTKYTGTPVSPS 481

Query: 508 ----WNDNPTTVNEIP----REIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559
               W +        P     +IP+  W  +   +  + GI+PF AI +++ FI+  LW 
Sbjct: 482 KPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWT 539

Query: 560 N--KIFYMFGFLLVSFILMIFTSVLVSIIVVY--------HSLCLENW-----------R 598
           +   +F ++  L++  IL     + + I+++Y           C ++             
Sbjct: 540 HSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSS 599

Query: 599 WQWRSFVAGGLGCAFYIFLYSIAFTRF--KFTGFVSILLYMGYSSLICVVSCLITGAVSF 656
           W+W++F  GG   A+Y   YS+ +  F  +   F SILLY+ Y +L+ V      G++ +
Sbjct: 600 WRWKAFYMGG-AAAWYWEAYSLYYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGY 658

Query: 657 MCNMFFVKRI 666
           +   +F+ ++
Sbjct: 659 LACCWFLNKL 668

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 88/231 (38%), Gaps = 44/231 (19%)

Query: 75  YYDKFHFCRPEKVERK-SESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKF 133
           YY+    C P    R    SLG V   +  + S + L++    +C PLC   +  D  + 
Sbjct: 64  YYETLFTCPPPAEARAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRR 123

Query: 134 INKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVS 193
           + ++I++G    W +DGLP+A   Y  +  S  Y +GF LG V  E  +G  ++      
Sbjct: 124 LIQMIRDGAQVRWTLDGLPAA-TTYPDRQSSYRYEAGFKLGEVDAE--TGHVRLH----- 175

Query: 194 KLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPIS 253
                                           NH  + + Y    +  Y +VG    P S
Sbjct: 176 --------------------------------NHVMLVVRYRILDDGRYVIVGFEAYPRS 203

Query: 254 IKRDDFESCTPTGNQLHLNENAENQVL--FTYSVDF-IKSETAWATRWDKY 301
           +  +             LN +A+  ++  FTY+V +  +S   W  RW  Y
Sbjct: 204 VAGEGCTGGQTEYEHFWLNPDAQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 118/571 (20%), Positives = 210/571 (36%), Gaps = 97/571 (16%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           +  N Y  GD ++L VN+   ++            A+ K +       Y+D    C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTLN-----------ADLKPYI------YHDLPFVCPPTS 89

Query: 87  VERKSE-SLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
           V +       S+  GD +  S ++L   +  EC  LC      +       +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           W ID  LP +     + T+   Y  GFPLG                            + 
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLGR---------------------------FD 182

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP 264
           K + K             Y  NH  + I Y+   ++ + +VG  V   S+   D+     
Sbjct: 183 KDKNK------------VYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSV--SDYHCPGA 228

Query: 265 TGN----QLHLNENAENQVL--FTYSVDFIKS-ETAWATRW---DKYLHTYDPSIQWFSL 314
           + N    +L + EN ++     FTYSV + +  +  W +RW   D  +   DP +   S+
Sbjct: 229 SKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINKSM 288

Query: 315 INFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSG-----WKLTHGDVFRMP 369
           ++               ++ ++   I +  +    N FT ++      W  ++    +  
Sbjct: 289 LSNIMQPTRTGLFLLPLIIFSII--IVKVVENGEKNKFTTEAQLASKCWIESNNINLKSS 346

Query: 370 RKAMVLSIYVGSGVQ-LFLMI-LCCLTVAALGFMSPSYRGALPTCMFVLYAIFG--FVGS 425
             A +L++ +  GVQ +F +I +  L ++       S    L   ++ +  I    F+G+
Sbjct: 347 FSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGT 406

Query: 426 YTSMGVYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILMIC 485
           +  M +       Y     IL   L+P  +             + SS   P  T+ +MI 
Sbjct: 407 WLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMIS 466

Query: 486 LWLLVSVPLSFLGSFVAFK----------------KCNWNDNPTTVNEIPREIPIQPWYM 529
            + ++ VP S +G  +A K                + N ND         R   I    +
Sbjct: 467 FFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKL 526

Query: 530 RSIPVVLLSGIVPFGAIAVELYFIYSSLWYN 560
            ++   L++ IVPF  I  ELY+I+++ W N
Sbjct: 527 GTLVYSLITAIVPFFIIKSELYWIFTNKWLN 557

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 156/735 (21%), Positives = 256/735 (34%), Gaps = 147/735 (20%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           +  NTY  GDP+E+ VN++      +  D  G S     E   Y    Y+D  + C P  
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDS----NEGVSYK---YHDLPYICPPTN 93

Query: 87  VERK-SESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
            ++    SL  +  GD    S + L      +C  LC         +   ++I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           W ID  LP+A     S T    Y  GF LG                            +K
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLG----------------------------WK 185

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP 264
             E  +            Y  NH  + I Y+   +N + +VG  V P SI          
Sbjct: 186 DPETGSY-----------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARR 234

Query: 265 TGNQLHLNENAENQ----VLFTYSVDFIKS-ETAWATRWDKY-------LHTYDPSIQWF 312
                 L +   N     + F+YSV + +  E  W TRW  +       L   D S+Q  
Sbjct: 235 GHGHYELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLG 294

Query: 313 SLIN----FXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRM 368
            + N    +              L+  L  DI+ +  + + N  T    W  T  +    
Sbjct: 295 FISNLLHWYSPYTTVIIFTILLFLVSLLVLDINSHKLVFMSNPKTV-IAWATT-ANKLNK 352

Query: 369 PRKAMVLSIYVGSGVQ-LFLMILCCLTVAALGFMS--PSYRGALPTCMFVLYAIFG-FVG 424
             K ++L+I V  G Q LF+ +   +  ++L  +    +Y      C      + G FVG
Sbjct: 353 TWKNILLNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVG 412

Query: 425 SYTSMGVYKFFHGPYWKANM-ILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILM 483
           ++  M +++    P +   M I+   ++PG               +  + + P   +  +
Sbjct: 413 TWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWL 472

Query: 484 ICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPR-----------------EIPIQP 526
           I ++ + S+P+S +G  +A K  ++  N ++  +  R                 E  IQ 
Sbjct: 473 IFVYFIFSIPMSLIGGSLAVKIQHYYTNFSSRKDYGRVRSMSYTDPNLYKPDIIESDIQK 532

Query: 527 ----------------------WYMRSIPVVLLSGI-----------------VPFGAIA 547
                                 W  +S+ V     I                 +PF  I 
Sbjct: 533 NQDNEDNYVIELDDKQAKKRKIWRRKSLYVKFKQAISFSNIISLLLRNFITNGIPFQIIK 592

Query: 548 VELYFIYSSLW--YNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCL----------E 595
            E+     S W  +   F +FG+L   +I++I    + S+I     L            E
Sbjct: 593 NEVIIFNQSSWLRHCSFFNLFGYLFTKYIMIIAIIFMGSVISCNLYLIQSTSDKGSNIKE 652

Query: 596 NWRWQWRSFVAG-GLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAV 654
           NWR   + F  G  L  A      S    R        +LL +GYS L  ++  L  G +
Sbjct: 653 NWR--GKCFQLGFNLFFAMEFNSLSHILNRSNEKWGTLLLLSIGYSLLFNLLIGLAAGFI 710

Query: 655 SFMCNMFFVKRIFTS 669
           S+M +++F+   F S
Sbjct: 711 SYMASVWFIVNRFKS 725

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 145/710 (20%), Positives = 248/710 (34%), Gaps = 153/710 (21%)

Query: 27  ISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKFHFCRPEK 86
           I  N Y  GD +++  N+  P         +  +V+            YYD    C P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP---------DDPAVSQPALC-------YYDLPFVCPPSD 103

Query: 87  VERK-SESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIKNGFFYN 145
            +R    SL  +  GD +  S + L   + + C  LC         +    LIKN +   
Sbjct: 104 TKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQ 163

Query: 146 WLIDG-LPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEAVKAYK 204
           W +D  LP       +K     Y  GF LG    ++ +G +                   
Sbjct: 164 WYVDNDLPVGTTYISNKVNKKQYLPGFSLG--YFDNQTGQA------------------- 202

Query: 205 KREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISI-------KRD 257
                             Y   H    + YH   ++ + +VG+ V P SI          
Sbjct: 203 ------------------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASK 244

Query: 258 DFESCTPTGNQLHLNENAENQVLFTYSVDFIKS-ETAWATRWDKY------LHTYDPSIQ 310
           DF    P   ++  N +    + F+YSV + +  +  W  RWD +      L   D S  
Sbjct: 245 DF---IPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFH 301

Query: 311 WFSLINFXXXXXXXXXXXXHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPR 370
           W+SLIN               ++  L   IS      L N   +     +T     R P 
Sbjct: 302 WYSLIN--------SNSITVGVITFLCLVISMNRMRILYNKSWKKRQLSITTTTTTRYPN 353

Query: 371 KAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAI-FG-----FVG 424
              + +I + SG+Q F +++  + +    F    +     T +  L+ I FG     F+G
Sbjct: 354 ---IFTICITSGIQFFFLLISSVLIT---FQISKFHQIKDTIIVALFFIAFGIIVSVFIG 407

Query: 425 SYTSMG-VYKFFHGPYWKANMILTPLLVPGSMXXXXXXXXXXXXGVHSSGTIPASTIILM 483
           +      +   F   Y+  N IL    +P  +                +   P    +  
Sbjct: 408 TLIQRTFILTNFPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYF 467

Query: 484 ICLWLLVSVPLSFLG-----SFVAFKKCNWNDNPTTVN-------------EIPREIPIQ 525
              + ++S+PLS +       F++F K      PT+ N                      
Sbjct: 468 FTSYFILSIPLSIISGVLSTRFISFPKYPSRSLPTSPNLNLDFEKTSSTSSSSSLSKYSM 527

Query: 526 PWYMRSIPVVL-LSGIVPFGAIAVELYFIYSSLW--YNKIFYMFGFLLVS--FILMIFTS 580
            + +  I + L L+G++P   + +E+  I +S+W   + I+ +   +L+S   + +I TS
Sbjct: 528 KYRVAMILLYLSLTGLIPSIILYLEISLIINSVWNLNSNIYQLLIVILISSQILCIIITS 587

Query: 581 V--LVSIIVVYH------------------------SLCLENWRWQWRSFVAGG---LGC 611
           +  L++   ++                         +       WQWRSF  G    +  
Sbjct: 588 ISYLINSQFIFRNTNTNTTTTNPLTNNNNANNSNNNNNNNNKISWQWRSFFIGASPFIFI 647

Query: 612 AFYI--FLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCN 659
            FYI  F++ I       T   SI     Y +L+ V+  L+ G++S+M N
Sbjct: 648 EFYIFYFVFGIKVITVSATQIASIY----YFTLLNVLFSLMLGSISYMVN 693

>Kwal_33.13486 s33 complement(245766..249455) [3690 bp, 1229 aa]
           {ON} YNL257C (SIP3) - 1:1 [contig 116] FULL
          Length = 1229

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 57/132 (43%), Gaps = 22/132 (16%)

Query: 130 DAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTI 189
           DA F   L    + YN L++      ++Y       F+     L +  ++ + G  +V +
Sbjct: 72  DAFFAQSLPPEDYLYNGLVED-----QMYTPSIVKDFHKDLCDLSTELLQRVRGDPEVFL 126

Query: 190 PGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYF-ANHFNIHIEYHDRGNNNYRVVGVT 248
             +SK+  E V+ YK+           T +  +Y+ + H  +  +Y      + R+ G  
Sbjct: 127 SELSKIQKEVVEPYKE-----------TRKNFDYYQSKHDTLLSKYQ-----STRISGSN 170

Query: 249 VDPISIKRDDFE 260
           V+P SI+ D F+
Sbjct: 171 VEPSSIREDAFQ 182

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,129,080
Number of extensions: 3265571
Number of successful extensions: 10774
Number of sequences better than 10.0: 58
Number of HSP's gapped: 10857
Number of HSP's successfully gapped: 93
Length of query: 673
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 557
Effective length of database: 40,180,143
Effective search space: 22380339651
Effective search space used: 22380339651
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)