Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0H012908.318ON66765326900.0
TBLA0E02630singletonON68939415460.0
TPHA0A015808.318ON60034010831e-139
Smik_12.1868.318ON57237910651e-137
Skud_12.1928.318ON56937810581e-136
Suva_10.2118.318ON56637710571e-136
YLR120C (YPS1)8.318ON56937910401e-133
Kpol_543.618.318ON58834410131e-129
CAGL0M04191g8.318ON60134310081e-128
SAKL0H15664g8.318ON5563469591e-121
Skud_12.1938.319ON4973419471e-120
KAFR0B057108.318ON5753319431e-118
YLR121C (YPS3)8.319ON5083429311e-118
Smik_12.1878.319ON5073429291e-117
Kwal_26.7254singletonON5703469281e-116
Skud_4.4038.318ON5903449251e-116
YDR144C (MKC7)8.318ON5963579241e-115
Suva_10.2128.319ON7453439351e-115
Suva_2.3058.318ON5973439211e-115
NCAS0B035608.318ON5863499151e-114
NDAI0J010308.318ON6523479151e-113
KNAG0I009108.318ON5693519061e-113
ZYRO0F10274gsingletonON5723459051e-113
Smik_4.3888.318ON5973489051e-113
ZYRO0F10230g8.318ON5803388911e-111
NCAS0C033008.318ON5593478891e-111
KNAG0G024108.318ON5303518741e-109
Kwal_56.239028.318ON6293508811e-109
TBLA0D00140singletonON6073608721e-108
NDAI0G026208.318ON5903458671e-107
ZYRO0G02904gsingletonON5313438621e-107
KLTH0G12386g8.318ON5803458561e-106
KAFR0B06530singletonON5383458481e-105
TDEL0F044508.318ON5243348311e-103
KAFR0H023008.318ON5213438281e-102
KLLA0E04049g8.318ON5893458211e-100
TBLA0A039108.318ON5963318048e-98
ZYRO0F10318g8.319ON4863587888e-97
ZYRO0F10252gsingletonON5513377894e-96
KAFR0I01700singletonON5523497702e-93
Ecym_42518.318ON5023447532e-91
AGL192W8.318ON4993457392e-89
KAFR0E03940singletonON6383397343e-87
SAKL0C02970gsingletonON5923567052e-83
KNAG0E03220singletonON5403406847e-81
Kwal_33.14239singletonON6513306795e-79
KLTH0F06754gsingletonON7673296849e-79
SAKL0F07172g7.182ON5423286663e-78
CAGL0E01419g8.318ON5913636677e-78
ZYRO0F10296gsingletonON5283376601e-77
ZYRO0E02266gsingletonON5063356582e-77
CAGL0E01793gsingletonON5163456363e-74
KNAG0I009008.319ON5313416373e-74
CAGL0E01815gsingletonON5193516346e-74
KNAG0I01200singletonON6773406412e-73
CAGL0E01837gsingletonON5213476302e-73
CAGL0E01749gsingletonON4823306091e-70
CAGL0E01771gsingletonON5193436121e-70
CAGL0E01859gsingletonON5053485891e-67
Suva_9.13singletonON4643405686e-65
CAGL0E01727gsingletonON5393365674e-64
TPHA0C008408.318ON10003465876e-64
YIR039C (YPS6)singletonON5373265622e-63
Suva_34.1singletonON3873155477e-63
Suva_16.14singletonON5403255561e-62
CAGL0E01881gsingletonON5083475532e-62
KAFR0B06700singletonON5313335393e-60
NCAS0A124607.182ON5403105325e-59
Smik_65.1singletonON3423074992e-56
SAKL0E15356gsingletonON5573405115e-56
Skud_9.1547.182ON5163384938e-54
KLLA0D15917g7.182ON5113314902e-53
ZYRO0D15554g7.182ON5213454753e-51
TDEL0H026507.182ON5523034712e-50
Ecym_43947.182ON5183234664e-50
Smik_9.1757.182ON5933064662e-49
YIL015W (BAR1)7.182ON5873084635e-49
CAGL0J02288g7.182ON5413114456e-47
NDAI0B017207.182ON5473314431e-46
KNAG0H027607.182ON5633604291e-44
AGR240W7.182ON4523304203e-44
SAKL0H00330gsingletonON5783344018e-41
Smik_5.7singletonON3042283691e-38
Suva_79.1singletonON2272133402e-35
Suva_9.1877.182ON3331502722e-25
Suva_9.186singletonOFF5431552722e-24
TBLA0D045807.182ON3953302664e-24
Kpol_1063.227.182ON3362252572e-23
TBLA0B038308.677ON4133111963e-15
Kwal_26.88028.677ON4123141954e-15
ZYRO0F07392g8.677ON4183101955e-15
YPL154C (PEP4)8.677ON4053141911e-14
TPHA0D012608.677ON4193181911e-14
Skud_16.1288.677ON4053171892e-14
Smik_6.3518.677ON4053171892e-14
KNAG0J017108.677ON4153141893e-14
KLTH0D11264g8.677ON4173141874e-14
Suva_16.1568.677ON4063141874e-14
SAKL0H06512g8.677ON4043131865e-14
Smik_5.6singletonON123961725e-14
NCAS0C013608.677ON4063131849e-14
KLLA0D05929g8.677ON4093131841e-13
KLLA0F22088g5.401ON5583041851e-13
NDAI0E021058.677ON4083111803e-13
ACR144W8.677ON4083181742e-12
Kpol_1013.68.677ON4023091732e-12
Kpol_1072.158.677ON3993211633e-11
KAFR0H024208.677ON4163021634e-11
KLTH0E02596g5.401ON5961921601e-10
ACR143WsingletonON3933131544e-10
Ecym_13245.401ON5762741546e-10
AGR407CsingletonON2683001401e-08
KNAG0C051405.401ON5983211412e-08
Suva_62.1singletonON252961355e-08
TDEL0A062308.677ON4083171376e-08
Kwal_55.200345.401ON5932131342e-07
Ecym_23968.677ON4153001332e-07
ZYRO0A06578g5.401ON7202901306e-07
SAKL0G07524g5.401ON6322851297e-07
Smik_67.1singletonON110551178e-07
CAGL0M02211g8.677ON4153401271e-06
YDR349C (YPS7)5.401ON5963171271e-06
CAGL0A02431g5.401ON5872551261e-06
Suva_2.5205.401ON5982871208e-06
YGL259W (YPS5)singletonON165781131e-05
TPHA0E019205.401ON6243331191e-05
Smik_4.6135.401ON5963101191e-05
Skud_4.6185.401ON5862931172e-05
TDEL0E022305.401ON5731281154e-05
ACR150W5.401ON5532241135e-05
NCAS0F031505.401ON6452351073e-04
NDAI0C046105.401ON6091281064e-04
YGL258W-AsingletonON7749920.001
TBLA0H016805.401ON6092411010.002
KAFR0E040805.401ON5963151010.002
Kpol_1059.335.401ON662354890.043
KAFR0I013504.40ON23660732.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0H01290
         (667 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...  1040   0.0  
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   600   0.0  
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   421   e-139
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   414   e-137
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   412   e-136
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   411   e-136
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   405   e-133
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   394   e-129
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   392   e-128
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   374   e-121
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   369   e-120
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   367   e-118
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   363   e-118
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   362   e-117
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   362   e-116
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   360   e-116
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   360   e-115
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   364   e-115
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   359   e-115
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   357   e-114
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             357   e-113
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              353   e-113
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   353   e-113
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   353   e-113
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   347   e-111
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              347   e-111
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   341   e-109
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   343   e-109
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                340   e-108
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   338   e-107
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   336   e-107
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   334   e-106
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            331   e-105
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   324   e-103
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   323   e-102
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   320   e-100
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   314   8e-98
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   308   8e-97
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   308   4e-96
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   301   2e-93
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   294   2e-91
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   289   2e-89
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              287   3e-87
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   276   2e-83
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   268   7e-81
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   266   5e-79
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   268   9e-79
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   261   3e-78
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   261   7e-78
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   258   1e-77
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   258   2e-77
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   249   3e-74
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              249   3e-74
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   248   6e-74
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              251   2e-73
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   247   2e-73
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   239   1e-70
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   240   1e-70
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   231   1e-67
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   223   6e-65
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   223   4e-64
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   230   6e-64
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   221   2e-63
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   215   7e-63
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   218   1e-62
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   217   2e-62
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   212   3e-60
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   209   5e-59
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       196   2e-56
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   201   5e-56
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   194   8e-54
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   193   2e-53
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   187   3e-51
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   186   2e-50
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   184   4e-50
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   184   2e-49
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   182   5e-49
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   176   6e-47
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   175   1e-46
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   169   1e-44
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   166   3e-44
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   159   8e-41
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       146   1e-38
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   135   2e-35
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...   109   2e-25
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...   109   2e-24
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   107   4e-24
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   103   2e-23
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    80   3e-15
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    80   4e-15
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    80   5e-15
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    78   1e-14
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    78   1e-14
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    77   2e-14
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    77   2e-14
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    77   3e-14
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    77   4e-14
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    77   4e-14
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    76   5e-14
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        71   5e-14
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    75   9e-14
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    75   1e-13
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    76   1e-13
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     74   3e-13
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    72   2e-12
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    71   2e-12
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    67   3e-11
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    67   4e-11
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    66   1e-10
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    64   4e-10
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    64   6e-10
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    59   1e-08
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    59   2e-08
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    57   5e-08
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    57   6e-08
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    56   2e-07
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    56   2e-07
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    55   6e-07
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    54   7e-07
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        50   8e-07
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    54   1e-06
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    54   1e-06
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    53   1e-06
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    51   8e-06
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    48   1e-05
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    50   1e-05
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    50   1e-05
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    50   2e-05
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    49   4e-05
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    48   5e-05
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    46   3e-04
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    45   4e-04
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    40   0.001
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    44   0.002
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    44   0.002
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    39   0.043
KAFR0I01350 Chr9 (279516..280226) [711 bp, 236 aa] {ON} Anc_4.40...    33   2.3  

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/653 (81%), Positives = 534/653 (81%)

Query: 1   MKDHXXXXXXXXXXNVSISDPIPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIE 60
           MKDH          NVSISDPIPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIE
Sbjct: 1   MKDHAILLALLALINVSISDPIPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIE 60

Query: 61  YDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSI 120
           YDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSI
Sbjct: 61  YDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSI 120

Query: 121 TVLVDTGSSDLWVTGSDNPYCKSNSGKSTNLLTPTXXXXXXXXXXQPDLEXXXXXXXXXX 180
           TVLVDTGSSDLWVTGSDNPYCKSNSGKSTNLLTPT          QPDLE          
Sbjct: 121 TVLVDTGSSDLWVTGSDNPYCKSNSGKSTNLLTPTDSDSDSDSDSQPDLESGSSSGNNDG 180

Query: 181 XXXXILSXXXXXXXXXXXXXXXXVAKKNIVIIDDVLQIKNAQADSEKPDWNPFGWXXXXX 240
               ILS                VAKKNIVIIDDVLQIKNAQADSEKPDWNPFGW     
Sbjct: 181 DDGSILSWFEKFKFWKNNNKQEEVAKKNIVIIDDVLQIKNAQADSEKPDWNPFGWGSTAT 240

Query: 241 XXXXXXXXYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGR 300
                   YQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGR
Sbjct: 241 ATTGGNSGYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGR 300

Query: 301 DVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLK 360
           DVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLK
Sbjct: 301 DVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLK 360

Query: 361 NSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFD 420
           NSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFD
Sbjct: 361 NSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFD 420

Query: 421 ITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM 480
           ITLQGLG             QIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM
Sbjct: 421 ITLQGLGVTDNTNNYTVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM 480

Query: 481 NCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYV 540
           NCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYV
Sbjct: 481 NCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYV 540

Query: 541 VYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIFXXXX 600
           VYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF    
Sbjct: 541 VYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIFGSTT 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQANDASNLFSPTNS 653
                                                  QANDASNLFSPTNS
Sbjct: 601 YSINPSSSNSGDSHDSTSTVQGTGSTSSRISTRTTSKTKQANDASNLFSPTNS 653

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/394 (77%), Positives = 335/394 (85%), Gaps = 3/394 (0%)

Query: 205 AKKNIVIIDDVLQIKNAQADSEKPDWNPFGWXXXXXXXXXXXXXYQTMSLDPSQATINCD 264
           AKK I   ++  Q+K  Q +  K +W+PF W             + T S   S+ATINCD
Sbjct: 227 AKKKIDNKNNFPQMKITQPELGKAEWDPFSWESTTTDTSSGLG-FATRSSSSSRATINCD 285

Query: 265 TYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNS 324
            YGTFDIE+SST+QSN+T FAIRYADTS+A+G+WGRDVLTFSDGLNVTGLSFAVANQTNS
Sbjct: 286 AYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVANQTNS 345

Query: 325 TVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNV 384
           TVGVLGIGLPQLEVTY+GVYQ+TKPY YDNFPLVLKNSGAIHKS YSLYLNKQ+AKNGNV
Sbjct: 346 TVGVLGIGLPQLEVTYAGVYQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQSAKNGNV 405

Query: 385 LFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XXXXXXXXXXXQIV 443
           LFGA+DHSQY+GDTLYT+PLVN D+SSGYS PIEFD+TLQGLG              QIV
Sbjct: 406 LFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTVTTTQIV 465

Query: 444 ALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINAN 503
           ALLDSGTTLTYFPKDMLNLLAK INASYS+ALGYYVMNCPDS DNTQ+VFDFGGFHI  N
Sbjct: 466 ALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGGFHIKTN 525

Query: 504 LTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSN-ED 562
           LTNFVLSSASGKCVLGLLPYNGNSAILGD+FLTHAYVVYNLDDLEISMAQAN++N N ED
Sbjct: 526 LTNFVLSSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMAQANFNNGNDED 585

Query: 563 IEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           IEVI+ST+PNAVKAPGYSYTYS SKSIV GG+IF
Sbjct: 586 IEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDIF 619

 Score =  176 bits (445), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 108/148 (72%), Gaps = 7/148 (4%)

Query: 1   MKDHXXXXXXXXXXNVSISDPIPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIE 60
           MKD+          N++ +DPI   E + N   +   +  FLKL F+KFYADS+NDI   
Sbjct: 1   MKDNIFLLIILALSNITRADPILLPEKTENSKNIVGKDK-FLKLEFQKFYADSVNDIPPR 59

Query: 61  YDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSI 120
                 DY   KRDS++DLK SKPY+ LIKR+DGYE+IQIINQQSFYSVNL+IGTPAQSI
Sbjct: 60  ------DYSFNKRDSVLDLKNSKPYIKLIKRHDGYEKIQIINQQSFYSVNLQIGTPAQSI 113

Query: 121 TVLVDTGSSDLWVTGSDNPYCKSNSGKS 148
           TVLVDTGSSDLWVTGS+NPYCK NSGK+
Sbjct: 114 TVLVDTGSSDLWVTGSNNPYCKGNSGKA 141

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  421 bits (1083), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/340 (61%), Positives = 261/340 (76%), Gaps = 2/340 (0%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           SQ++I+C  YGTFDI+DSS+F SN TSFAI Y D SYA G WG+DVL+  D ++VTGLSF
Sbjct: 136 SQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQD-IDVTGLSF 194

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
           AVAN TNSTVGVLGIGLP LE TYSG    + PY YDN PLVL+NSGA+    YSL+LN 
Sbjct: 195 AVANYTNSTVGVLGIGLPSLEATYSGSLAGSNPYQYDNLPLVLRNSGAVKSYAYSLFLND 254

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
           +++  G++LFG VDHS+YEG TL T+PLVN   SSG+ +P EFDITLQGLG         
Sbjct: 255 EDSSEGSILFGGVDHSKYEG-TLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTSSKNTT 313

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFG 496
               QIVALLDSGTTLTY P  + +LLA  +NASYS  LGYY M+CP S D+T+IVFDFG
Sbjct: 314 VSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSSDSTEIVFDFG 373

Query: 497 GFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANY 556
           GFHIN  LT+F+++S+   C+LG++P +G+ AILGD FL HAYVVY+L++LEIS+AQA Y
Sbjct: 374 GFHINVPLTSFIVTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDLENLEISLAQAKY 433

Query: 557 DNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            +S+EDIE I S+VP+AV+A  YS T+ST+ +I SGG+IF
Sbjct: 434 GSSSEDIEAIVSSVPSAVRAASYSNTWSTAATINSGGDIF 473

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (65%), Gaps = 22/105 (20%)

Query: 40  NFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQ 99
           NF+K  F+K Y DS       Y N +              K +KP ++++KR DGYEEI+
Sbjct: 43  NFIKFKFDKSYGDS-------YKNSS--------------KRNKPKLDIVKR-DGYEEIE 80

Query: 100 IINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           + N+ SFYS+ L IGTPAQ++TVL+DTGSSDLWVTGSDNP C S+
Sbjct: 81  LKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSSD 125

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  414 bits (1065), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 218/379 (57%), Positives = 282/379 (74%), Gaps = 15/379 (3%)

Query: 229 DWNPFGWXXXX-------XXXXXXXXXYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNK 281
           D NPFGW                      T S+  S+AT++C  YGTF   DSSTF+SN 
Sbjct: 148 DINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNN 207

Query: 282 TSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYS 341
           T F+I Y D ++A+G +G DVL  SD LNVTGLSFAVAN+TNST+GVLGIGLP+LEVTYS
Sbjct: 208 TYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 266

Query: 342 G--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTL 399
           G    +  +P+ YDNFP+VLKNSGAI  + YSLYLN  +A++G +LFGAVDHS+Y G TL
Sbjct: 267 GSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTG-TL 325

Query: 400 YTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XXXXXXXXXXXQIVALLDSGTTLTYFPKD 458
           YT+P+VN  S+SG+S+PI+FD+T+ G+G              +I ALLDSGTTLTY P+ 
Sbjct: 326 YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPET 385

Query: 459 MLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVL 518
           ++ L+A  I A YS  LGYYV++CP SDD+TQIVFDFGGFHINA+L++F+LS+ S  C+L
Sbjct: 386 VVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTGS-TCLL 443

Query: 519 GLLPYNGNSA-ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAP 577
           G++P + N+  ILGD FLT+AYVVY+LD+LEISMAQA Y+ + E+IEVI+S++P+AVKAP
Sbjct: 444 GIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAP 503

Query: 578 GYSYTYSTSKSIVSGGNIF 596
           GY+ T+STS +IV+GGNIF
Sbjct: 504 GYTNTWSTSATIVTGGNIF 522

 Score =  105 bits (262), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 67/105 (63%), Gaps = 21/105 (20%)

Query: 41  FLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQI 100
           F+KL F K Y DS++++                      ++ KP  +L KR DGYEEI I
Sbjct: 41  FVKLPFHKLYGDSLDNVG---------------------RDKKPEAHLFKRADGYEEIII 79

Query: 101 INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNS 145
            NQQSFYSV L +G+P Q++TVLVDTGSSDLW+ GS+NPYC S++
Sbjct: 80  TNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDT 124

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  412 bits (1058), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 281/378 (74%), Gaps = 14/378 (3%)

Query: 229 DWNPFGWXXXXXXX-------XXXXXXYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNK 281
           D NPFGW                      T S+  S+AT+NC  +GTF   DSSTF+SN 
Sbjct: 145 DINPFGWLTGTGSAIGPTATGSGGGSGTATQSVPASEATMNCQEFGTFTTSDSSTFRSNN 204

Query: 282 TSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYS 341
           T F+I Y D ++A+G +G D+L  SD LNVTGLSFAVAN+TNST+GVLGIGLP+LEVTYS
Sbjct: 205 TYFSISYGDGTFASGTFGTDILDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 263

Query: 342 G--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTL 399
           G     S +PY YDNFP+VLKNSGAI  + YSLYLN  +AK+G +LFGAVDHS+Y G TL
Sbjct: 264 GSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLNDSDAKHGTILFGAVDHSKYAG-TL 322

Query: 400 YTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XXXXXXXXXXXQIVALLDSGTTLTYFPKD 458
           YTVP+VN  S+SG+S+PI+FD+T+ G+G              QI ALLDSGTTLTY P+ 
Sbjct: 323 YTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKTLTTTQIPALLDSGTTLTYLPQA 382

Query: 459 MLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVL 518
           ++ ++A  ++A YS  LGYYV++CP + ++TQIVFDFGGFHINA+L++F+L+ A   C+L
Sbjct: 383 VVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVFDFGGFHINASLSSFILN-AGNICLL 441

Query: 519 GLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPG 578
           G++  + ++ ILGD FLT+AYVVY+LD+LEISMAQA Y+ +NE+IEVITS++P+A+KAPG
Sbjct: 442 GIIATD-DTTILGDSFLTNAYVVYDLDNLEISMAQAQYNITNENIEVITSSIPSAIKAPG 500

Query: 579 YSYTYSTSKSIVSGGNIF 596
           Y+ T+STS SIV+GGNIF
Sbjct: 501 YTSTWSTSASIVTGGNIF 518

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 71/120 (59%), Gaps = 26/120 (21%)

Query: 22  IPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKE 81
           IP     ++D      NS F+KL F K Y D+ +D+                       +
Sbjct: 24  IPAASKRDDDS-----NSKFVKLPFHKLYGDTRDDVG---------------------TD 57

Query: 82  SKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
            KP V L+KR DGYEEI I NQQSFYSV+L +GTP Q++TVLVDTGSSDLW+ GS+NPYC
Sbjct: 58  KKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYC 117

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 216/377 (57%), Positives = 277/377 (73%), Gaps = 13/377 (3%)

Query: 229 DWNPFGWXXXX-----XXXXXXXXXYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTS 283
           D NPFGW                    T S+  S+AT++C+ YGTF   DSSTF+SN T+
Sbjct: 143 DINPFGWLTETGSVTGATATATGSGTATQSVPASEATMDCEEYGTFTSSDSSTFKSNNTA 202

Query: 284 FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGV 343
           F I Y D ++A G +G DVL  SD LNVTGLSFAVAN+TNST+GVLGIGLP LEVTYSG 
Sbjct: 203 FEISYGDGTFAAGTFGTDVLNLSD-LNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGS 261

Query: 344 YQST--KPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYT 401
             S   K Y YDNFP+VLKNSGAI  + YSLYLN  +AK+G +LFG VDH++Y G TLYT
Sbjct: 262 SASNGGKSYKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGGVDHNKYSG-TLYT 320

Query: 402 VPLVNGDSSSGYSTPIEFDITLQGLGXXXXXX-XXXXXXXQIVALLDSGTTLTYFPKDML 460
           V LVN  + SG+++PI+FDITL GLG              +I  LLDSGTTLTY P +M+
Sbjct: 321 VALVN--TLSGFTSPIQFDITLNGLGIIDDNGDEKTLTTTKIPVLLDSGTTLTYLPVEMV 378

Query: 461 NLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGL 520
            L+A+ + A YS  +GYYVM CP SD++T+IVFDFGGFHINA+L++F+LS++   C+LG+
Sbjct: 379 ELIAENVGAQYSSRIGYYVMECPSSDNSTEIVFDFGGFHINASLSSFILSTSGNTCLLGI 438

Query: 521 LPYNGNS-AILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGY 579
           +P + ++ +ILGD FLT+AYVVY+L++LEISMAQA Y+ ++EDIEVI+++VPNAVKAPGY
Sbjct: 439 IPTSDSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNVTSEDIEVISTSVPNAVKAPGY 498

Query: 580 SYTYSTSKSIVSGGNIF 596
           + T+ST+ SI +GGNIF
Sbjct: 499 TNTWSTTASIATGGNIF 515

 Score =  112 bits (281), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 70/114 (61%), Gaps = 21/114 (18%)

Query: 31  DGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIK 90
           DG      S F+KL F+K Y DS+         DT              ++ KP V L K
Sbjct: 29  DGDGGDTGSKFVKLSFDKLYGDSL---------DTAG------------RDKKPEVRLSK 67

Query: 91  RNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           R DGYEEI I NQQSFYSV+L +GTPAQ+ITVLVDTGSSDLW+ GS NPYC S+
Sbjct: 68  RADGYEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSSNPYCSSD 121

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  405 bits (1040), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 279/379 (73%), Gaps = 15/379 (3%)

Query: 229 DWNPFGWXXXXXXXXXXXXX-------YQTMSLDPSQATINCDTYGTFDIEDSSTFQSNK 281
           D NPFGW                      T S+  S+AT++C  YGTF    SSTF+SN 
Sbjct: 145 DINPFGWLTGTGSAIGPTATGLGGGSGTATQSVPASEATMDCQQYGTFSTSGSSTFRSNN 204

Query: 282 TSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYS 341
           T F+I Y D ++A+G +G DVL  SD LNVTGLSFAVAN+TNST+GVLGIGLP+LEVTYS
Sbjct: 205 TYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 263

Query: 342 G--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTL 399
           G     S K Y YDNFP+VLKNSGAI  + YSLYLN  +A +G +LFGAVDHS+Y G TL
Sbjct: 264 GSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTG-TL 322

Query: 400 YTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XXXXXXXXXXXQIVALLDSGTTLTYFPKD 458
           YT+P+VN  S+SG+S+PI+FD+T+ G+G              +I ALLDSGTTLTY P+ 
Sbjct: 323 YTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKTLTTTKIPALLDSGTTLTYLPQT 382

Query: 459 MLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVL 518
           +++++A  + A YS  +GYYV++CP SDD+ +IVFDFGGFHINA L++F+LS+ +  C+L
Sbjct: 383 VVSMIATELGAQYSSRIGYYVLDCP-SDDSMEIVFDFGGFHINAPLSSFILSTGT-TCLL 440

Query: 519 GLLPYNGNSA-ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAP 577
           G++P + ++  ILGD FLT+AYVVY+L++LEISMAQA Y+ ++E+IE+ITS+VP+AVKAP
Sbjct: 441 GIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAP 500

Query: 578 GYSYTYSTSKSIVSGGNIF 596
           GY+ T+STS SIV+GGNIF
Sbjct: 501 GYTNTWSTSASIVTGGNIF 519

 Score =  117 bits (293), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 74/124 (59%), Gaps = 25/124 (20%)

Query: 22  IPPVENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKE 81
           I P  N  +D      NS F+KL F K Y DS+ ++                       +
Sbjct: 23  IIPAANKRDDDS----NSKFVKLPFHKLYGDSLENVG---------------------SD 57

Query: 82  SKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
            KP V L+KR DGYEEI I NQQSFYSV+L +GTP Q++TVLVDTGSSDLW+ GSDNPYC
Sbjct: 58  KKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117

Query: 142 KSNS 145
            SNS
Sbjct: 118 SSNS 121

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  394 bits (1013), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/344 (57%), Positives = 259/344 (75%), Gaps = 4/344 (1%)

Query: 255 DPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGL 314
           D +   ++C  +GTF+   S T+ SN+TSF+I YAD+SYA+G WG+D L   D L+VTGL
Sbjct: 147 DSNSDAVDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQD-LDVTGL 205

Query: 315 SFAVANQTNSTVGVLGIGLPQLEVTYSGVYQ-STKPYIYDNFPLVLKNSGAIHKSVYSLY 373
           SFAVAN TNSTVGVLGIGLP LEVTYSG    +   Y Y+NFPL+LKNSGA   + YSLY
Sbjct: 206 SFAVANYTNSTVGVLGIGLPSLEVTYSGSNNVAGTRYQYENFPLLLKNSGATKANAYSLY 265

Query: 374 LNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX-XX 432
           LN  +++ G+VLFG VDH++Y G TLYT+PLVN   ++G+S P+EFD+TLQG+G      
Sbjct: 266 LNDLDSRTGSVLFGGVDHNKYSG-TLYTIPLVNTLRAAGFSQPVEFDVTLQGMGISDDEH 324

Query: 433 XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIV 492
                   +I ALLDSGTTL Y P  +++L+A   +A Y+   GYYVMNCPDSD+++QIV
Sbjct: 325 GNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCPDSDEDSQIV 384

Query: 493 FDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
           FDFGGFHI+ NLT +++ +  G CVLG+LP +  +AILGD FL HAYVVY+LD+LEISMA
Sbjct: 385 FDFGGFHISTNLTTYIIQAVGGICVLGILPQSSGTAILGDSFLQHAYVVYDLDNLEISMA 444

Query: 553 QANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           QA+++  +E++EVI+S++P+AVKAPGYS T+ST  SI SGGNIF
Sbjct: 445 QASFETDDENVEVISSSIPSAVKAPGYSSTWSTFSSISSGGNIF 488

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 54/61 (88%)

Query: 81  ESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPY 140
           ++K Y N++KR++G EE++I+NQ +FYSV+L IG+ AQ++TVL+DTGSSDLWVTGS+NP 
Sbjct: 83  KNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPL 142

Query: 141 C 141
           C
Sbjct: 143 C 143

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  392 bits (1008), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 252/343 (73%), Gaps = 5/343 (1%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           ++ATINC  YGTFD   SST+ SN T+F I+Y D+++A+G WG D L  SD LNVTGLSF
Sbjct: 188 ARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSD-LNVTGLSF 246

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYL 374
           AVAN+TNSTVGVLGIGLP LEVTYSG       +PY YDNFPLVL  +GAI  + YSL+L
Sbjct: 247 AVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFL 306

Query: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXX 434
           N  +A+ G+VLFGAVDHS+Y GD LYT+P+VN  +S GY  PI+F++TL GLG       
Sbjct: 307 NNASAETGSVLFGAVDHSKYLGD-LYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDN 365

Query: 435 XXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFD 494
                 +I ALLDSGTTLTY P+ ++  + + + A+YS+  GYYV +CP   D+T++VFD
Sbjct: 366 TTITTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFD 425

Query: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           FGGFHINA +TNF++ S+   C+LG++P +G   ILGD FL  AYVVY+L++ EISMAQA
Sbjct: 426 FGGFHINAPITNFIIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQA 485

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTYST-SKSIVSGGNIF 596
           NY    EDIEVI+S+VP AV+APG+S T+ST + S  + G+IF
Sbjct: 486 NYAGGQEDIEVISSSVPGAVRAPGFSSTWSTLATSFNTQGDIF 528

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 71/114 (62%), Gaps = 20/114 (17%)

Query: 35  NSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDG 94
           N  + +++KL F+K+Y ++              +   KR        S+  + + KR +G
Sbjct: 21  NVADLSYVKLDFDKYYGET--------------FETAKRG------RSQADIRVNKRANG 60

Query: 95  YEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKS 148
           YEE+QI NQ SFYSV L +GTP QS+ VLVDTGSSDLW+TGSDNPYC+ ++G S
Sbjct: 61  YEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDNPYCRGSTGTS 114

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  374 bits (959), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/346 (54%), Positives = 250/346 (72%), Gaps = 4/346 (1%)

Query: 253 SLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVT 312
           SL  + ATI+C  YGTF+   SSTF SN T F I Y D+SYA G WG+D L   D +++ 
Sbjct: 171 SLSSALATIDCSQYGTFNTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHD-IDIG 229

Query: 313 GLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTK-PYIYDNFPLVLKNSGAIHKSVYS 371
           GLSFAVANQTNSTVGVLGIGLP LEVTYSG   S +  Y YDNFPL+LK +  I  + YS
Sbjct: 230 GLSFAVANQTNSTVGVLGIGLPGLEVTYSGYASSARNRYQYDNFPLILKRNNVIKANAYS 289

Query: 372 LYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX 431
           L+LN  N+ +G++LFGAVDHS+Y G  LYTVPL+N   SSGY+ PI+F++ +QG+G    
Sbjct: 290 LFLNSTNSSSGSLLFGAVDHSKYSGQ-LYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTS 348

Query: 432 XXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQI 491
                     I ALLDSG TL+YFP  +  ++A  ++A+YS + GYY+++CP SDD+T+I
Sbjct: 349 GSNTTLTTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSDDDTEI 408

Query: 492 VFDFGGFHINANLTNFVLSS-ASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEIS 550
           ++DFGGFHI + LT+++L++     CVLG++P N N  ILGD+FLT AYVVY+LD+ EIS
Sbjct: 409 IYDFGGFHIASKLTDYILTTNRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEIS 468

Query: 551 MAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           +AQANY+  +E IEVI+ +VP+A+KAP YS T  +S S  +GG+IF
Sbjct: 469 LAQANYEGGDEQIEVISESVPSAIKAPSYSSTRFSSASASTGGDIF 514

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 44/66 (66%), Positives = 56/66 (84%)

Query: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNP 139
           K +KPY  L KR+DG++EI++ NQ SF+SV L IGTP Q++TVLVDTGSSDLWVTGS+NP
Sbjct: 46  KHNKPYAVLSKRDDGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNP 105

Query: 140 YCKSNS 145
           YC++ S
Sbjct: 106 YCRAGS 111

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  369 bits (947), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 244/341 (71%), Gaps = 7/341 (2%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTS-FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           ++CD YG FD   SSTF++NK+S F   Y D ++A G +G+D L + +GL+++GLSFAVA
Sbjct: 101 MDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKY-NGLDLSGLSFAVA 159

Query: 320 NQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           N++NST GVLGIGLP LEVTYSG       K Y YDNFPL LK SGAI  + YSL+LN +
Sbjct: 160 NESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLNDE 219

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXX 437
           +  +G++LFGAVDHS+YEG  LYTVPLVN   S GY  P+ FD+TL G+G          
Sbjct: 220 SQSSGSILFGAVDHSKYEGR-LYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRHNTTL 278

Query: 438 XXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG 497
              +I ALLDSGTTLTY P   + LLAK++NA+YS ALGYY   CP SD++T + FDFGG
Sbjct: 279 TATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSVAFDFGG 338

Query: 498 FHINANLTNFVL-SSASGKCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDLEISMAQAN 555
           FHINA +++F + +S  G CVL ++P  GN+ AILGD FL +AYVVY+LD+ E+S+AQA 
Sbjct: 339 FHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLAQAK 398

Query: 556 YDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           Y    EDIE I STVP+A +APGY+ T+S   S+ SGGNIF
Sbjct: 399 YGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNIF 439

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 45/56 (80%)

Query: 88  LIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           L KR++G+E+  + N+QSFYSV L IGTP+QS+TVL+DTGS+DLWV    NPYC S
Sbjct: 44  LGKRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGS 99

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  367 bits (943), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 246/331 (74%), Gaps = 3/331 (0%)

Query: 266 YGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNST 325
           YGTF+  DSST+ SN TSF I Y D+S A G WG+DVL+ SD ++V+G+SFAVAN TNST
Sbjct: 187 YGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISD-VDVSGVSFAVANYTNST 245

Query: 326 VGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVL 385
           VGVLGIGL  LE TYSG   S++ YIY+N P++LK+SG I    YSL+LN+++   GN+L
Sbjct: 246 VGVLGIGLSGLETTYSGT-SSSESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNLL 304

Query: 386 FGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVAL 445
           FGAVDHS+Y G +LYT+P+VN  +S GY  P+EFD+T+ GLG             +I AL
Sbjct: 305 FGAVDHSKYSG-SLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPAL 363

Query: 446 LDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLT 505
           LDSGTT+ YFP+ +L L+A  + ASYSD LG+Y M+C  S D+T+ VFDFGGFHI   L+
Sbjct: 364 LDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPLS 423

Query: 506 NFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEV 565
           +F++  +  +C+L +   +  S ILGD FLT+AYVVY+L++ EISMAQANYD+ +EDIEV
Sbjct: 424 DFLIRVSGSECILAMAAQDDESIILGDYFLTNAYVVYDLENYEISMAQANYDSEDEDIEV 483

Query: 566 ITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           I+STVP+AVKA  YS ++S++ SI SGG+IF
Sbjct: 484 ISSTVPSAVKAASYSNSWSSTGSITSGGDIF 514

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 58/103 (56%), Gaps = 27/103 (26%)

Query: 41  FLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQI 100
           +LKLGF+K+  +S       +D  + D  LQKR                     Y    +
Sbjct: 39  YLKLGFDKYVGES-------FDKSSKD-SLQKRAE-------------------YAIFNL 71

Query: 101 INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
            NQ SFYSV L IGTP+Q++TVLVDTGSSDLWVTGSDNP C +
Sbjct: 72  TNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSDNPLCST 114

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  363 bits (931), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 187/342 (54%), Positives = 243/342 (71%), Gaps = 6/342 (1%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTS-FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           + ++CD YG FD   SSTF++NK+S F   Y D +YA G +G+D L +++ L+++GLSFA
Sbjct: 99  SVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNE-LDLSGLSFA 157

Query: 318 VANQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           VAN++NST GVLGIGL  LEVTYSG       + Y YDNFPL LK+SGAI  + YSL+LN
Sbjct: 158 VANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLN 217

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
            ++  +G++LFGAVDHS+YEG  LYT+PLVN   S GY  P+ FD+TLQGLG        
Sbjct: 218 DESQSSGSILFGAVDHSKYEGQ-LYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNI 276

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                ++ ALLDSGTTLTY P   + LLAK++NASYS  LGYY   CP SD+ T + FDF
Sbjct: 277 TLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDF 336

Query: 496 GGFHINANLTNFVLSSASGKCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDLEISMAQA 554
           GGF INA L++F + ++ G CVL ++P  GN+ AILGD FL +AYVVY+LD+ EIS+AQA
Sbjct: 337 GGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQA 396

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            Y    E++EVI STVP+A++AP Y+ T+S   S  SGGNIF
Sbjct: 397 KYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIF 438

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 46/56 (82%)

Query: 88  LIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           L KR++G+E+  + N+QSFYSV L IGTP+Q++TVL+DTGS+DLWV G  NPYC S
Sbjct: 44  LSKRSNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGS 99

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  362 bits (929), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/342 (54%), Positives = 240/342 (70%), Gaps = 6/342 (1%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTS-FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           + ++CD YG FD   SSTF++NK+S F   Y D ++A G +G+D L +++ L+++GL FA
Sbjct: 99  SVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNN-LDLSGLPFA 157

Query: 318 VANQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           VAN++NST GVLGIGL  LEVTYSG       + Y YDNFPL LK+SGAI  + YSL+LN
Sbjct: 158 VANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSLFLN 217

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
            ++  +G++LFGAVDHS+YEG  LYT+PLVN   S GY  P+ FD+TLQGLG        
Sbjct: 218 DESQASGSILFGAVDHSKYEGQ-LYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKRNT 276

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                +  ALLDSGTTLTY P   + LLAK++NASYS  LGYY   CP SD+ T I FDF
Sbjct: 277 TLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSIAFDF 336

Query: 496 GGFHINANLTNFVLSSASGKCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDLEISMAQA 554
           GGF INA L++F + ++ G C L L+P  GN+ AILGD FL +AYVVY+LD+ EIS+AQA
Sbjct: 337 GGFRINAPLSDFTMQTSVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQA 396

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            Y  + E+IE I STVP A +AP Y+ T+ST  S+ SGGNIF
Sbjct: 397 KYGKAKENIEAIKSTVPGATRAPSYNNTWSTYASVTSGGNIF 438

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 44/56 (78%)

Query: 88  LIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           L KR+ G+E   + N+QSFYSV L IGTP+Q++TVL+DTGS+DLWV G  NPYC S
Sbjct: 44  LSKRSSGHENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGS 99

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  362 bits (928), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 244/346 (70%), Gaps = 4/346 (1%)

Query: 253 SLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVT 312
           S+  S AT++C +YGTF    SS+F+SN T F I+Y D +YA G WG D +T  D + V+
Sbjct: 167 SVAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTYALGTWGHDDVTLQD-ITVS 225

Query: 313 GLSFAVANQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVY 370
            LS AVAN++NST GVLGIGL  LEVT  G  V  S   Y Y N P +L + G IH++ Y
Sbjct: 226 DLSMAVANESNSTFGVLGIGLTGLEVTNVGSLVSSSRSAYTYQNLPALLVDQGKIHQNAY 285

Query: 371 SLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX 430
           SL+L+  +A++G+VLFGAVDHS+Y G+ LYTVPLVN   SSG+  PI+ D+TLQGLG   
Sbjct: 286 SLFLDDLDAEHGSVLFGAVDHSKYTGN-LYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSA 344

Query: 431 XXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQ 490
                      I ALLDSGTTLTY P  M+  +A+ ++A YS  +GYYV+ C +  D+ +
Sbjct: 345 NKTNITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQYSYDVGYYVLECSEVSDSDE 404

Query: 491 IVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEIS 550
           +VFDFGGFHI + L NF++ ++S  C LGL+P + + AILGD FLT AYVVY+L++LE+S
Sbjct: 405 LVFDFGGFHIKSKLQNFLIKASSNFCALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVS 464

Query: 551 MAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           MAQANYD  +EDIEVI+ST+P AVKAPGYS T+S+   I +GGNIF
Sbjct: 465 MAQANYDGGSEDIEVISSTIPGAVKAPGYSSTWSSRIPISTGGNIF 510

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 54/69 (78%)

Query: 84  PYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           P   L+KR DG E I+I NQ +FYSV + +G+PAQ++T+L+DTGSSD+WV GS+NP+C+ 
Sbjct: 56  PRAELVKRADGSETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFCEG 115

Query: 144 NSGKSTNLL 152
           +S  S ++L
Sbjct: 116 SSRSSKHVL 124

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  360 bits (925), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 191/344 (55%), Positives = 247/344 (71%), Gaps = 10/344 (2%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           INC TYGTFD   SSTF+SNKT F+I Y D+++A+G WG D L  ++ LNVTGLSFAVAN
Sbjct: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNN-LNVTGLSFAVAN 229

Query: 321 QTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
           +TNSTVGVLGIGLP LE TYSGV  S+  K Y Y+NFP+VLKNSGAI  S YSL+ NK N
Sbjct: 230 ETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSN 289

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX---XXXXX 435
           +++G +LFGAVDH +Y GD LYT+P++N   ++GY  PI+F +TLQG+            
Sbjct: 290 SEHGTILFGAVDHGKYTGD-LYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNAT 348

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC-PDSDDNTQIVFD 494
                +I ALLDSGTT++Y P  ++ LLA  + ASYS   GYYVMNC  +   +  +VFD
Sbjct: 349 TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFD 408

Query: 495 FGGFHINANLTNFVL--SSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
           FGGFHI++ L+NF L   S+S  C+LG  P +  + ILGD FL   Y+VY+LD++EISMA
Sbjct: 409 FGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMA 468

Query: 553 QANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            A++ +++E I+VI S VP+A+KAP YS T+ST +SIV GGNIF
Sbjct: 469 NADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 69/115 (60%), Gaps = 22/115 (19%)

Query: 36  SVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGY 95
           + + +++ + FEK Y DS       ++N ++D                   +L++R D Y
Sbjct: 31  ATSESYVIMNFEKKYGDS-------FENASNDRNAG--------------AHLVRREDDY 69

Query: 96  EEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           E +++ N+ SFYSV L IGTP Q ITVLVDTGSSDLWVTGS+NPYC S  GK T+
Sbjct: 70  ELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYC-STKGKDTS 123

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  360 bits (924), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/357 (52%), Positives = 253/357 (70%), Gaps = 13/357 (3%)

Query: 251 TMSLDPSQAT---INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSD 307
           T + D + +T   I+C TYGTF+   SSTF SN T F+I Y DT++A+G WG D L+ +D
Sbjct: 158 TATFDSTASTSQLIDCATYGTFNTSKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLND 217

Query: 308 GLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDNFPLVLKNSGAI 365
            LN+TGLSFAVAN+TNSTVGVLGIGLP LE TYSGV  S+  K Y Y+NFP+VLKNSG I
Sbjct: 218 -LNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVI 276

Query: 366 HKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
             + YSL+ N  ++K+G +LFGAVDH +Y GD LYT+P++N     GY  PI+F +TLQG
Sbjct: 277 KSTAYSLFANDSDSKHGTILFGAVDHGKYAGD-LYTIPIINTLQHRGYKDPIQFQVTLQG 335

Query: 426 LGXXXXXXX---XXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC 482
           LG                +I  LLDSGTT++Y P +++ +LA  + A+YS A GYY+M+C
Sbjct: 336 LGTSKGDKEDNLTTLTTTKIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIMDC 395

Query: 483 -PDSDDNTQIVFDFGGFHINANLTNF--VLSSASGKCVLGLLPYNGNSAILGDMFLTHAY 539
             + ++ + I+FDFGGF+++  L++F  V  S S  C+LG+ P +  + ILGD FL + Y
Sbjct: 396 IKEMEEESSIIFDFGGFYLSNWLSDFQLVTDSRSNICILGIAPQSDPTIILGDNFLANTY 455

Query: 540 VVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           VVY+LD++EISMAQAN+ +  E IE+I S VP+A+KAPGYS T+ST +SIVSGGN+F
Sbjct: 456 VVYDLDNMEISMAQANFSDDGEYIEIIESAVPSALKAPGYSSTWSTYESIVSGGNMF 512

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 66/112 (58%), Gaps = 21/112 (18%)

Query: 38  NSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEE 97
           N  ++K+ F+K Y  S       ++N  DD + + R              L+ R+D YE 
Sbjct: 33  NEVYVKMNFQKKYGSS-------FENALDDTKGRTR--------------LMTRDDDYEL 71

Query: 98  IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKST 149
           +++ NQ SFYSV L IGTP Q +TVLVDTGSSDLWVTGSDNPYC +    +T
Sbjct: 72  VELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTKKKDTT 123

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  364 bits (935), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/343 (54%), Positives = 240/343 (69%), Gaps = 6/343 (1%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTS-FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           + +NCD YG FD  +SSTF +N ++ F   Y D ++A G +G+D L +S GL+++GLSFA
Sbjct: 100 SAMNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFA 159

Query: 318 VANQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           VAN++NSTVGVLGIGLP LEVTYSG       + Y YDNFPL LK SGAI  + YSL+LN
Sbjct: 160 VANKSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAYSLFLN 219

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
            +   +G+VLFGAVDHS+Y G  LYT+PLVN   + GY  P+ FD+TLQGLG        
Sbjct: 220 DETQTSGSVLFGAVDHSKYLGQ-LYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAHNT 278

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDN-TQIVFD 494
                +I ALLDSGTTLTY P D + L+AK++NA++S  LGYY   CP S DN T +VFD
Sbjct: 279 TLTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATSVVFD 338

Query: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDLEISMAQ 553
            GGFHINA L++F + +  G CVL ++P  GN+ AILGD FL  AYVVY+LD+ E+S+AQ
Sbjct: 339 LGGFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQ 398

Query: 554 ANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           A Y +  EDIE I S+VP A +APGY+ T+    S+ SGGNIF
Sbjct: 399 AKYGSGKEDIEAIRSSVPGATRAPGYNSTWVNYASVTSGGNIF 441

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%)

Query: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNP 139
           +++ P   L KR  G E   + N+QSFYSV L +GTP+Q++TVL+DTGS+DLWV  + NP
Sbjct: 37  RQNGPGSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNANP 96

Query: 140 YCKS 143
           YC S
Sbjct: 97  YCGS 100

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  359 bits (921), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/343 (55%), Positives = 250/343 (72%), Gaps = 8/343 (2%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           TI+C TYG FD   SSTFQSNKT F+I Y D ++A+G WG D L  ++ LNVTGLSFAVA
Sbjct: 174 TIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNN-LNVTGLSFAVA 232

Query: 320 NQTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           N+TNSTVGVLGIGL  LE TYSG   S+  + Y Y+NFP+VLKNSGAI  + YSL+LN+ 
Sbjct: 233 NETNSTVGVLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNET 292

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX-XXXXX 436
           NAK+G++LFGAVDH +Y GD LYT+P++N     GY  PI+F +TLQGLG          
Sbjct: 293 NAKHGSILFGAVDHGKYSGD-LYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSESTT 351

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNT-QIVFDF 495
               +I ALLDSGTT++Y P +++ +LA  + ASYS  +GYY+M+C    D+   +VFDF
Sbjct: 352 ITTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDF 411

Query: 496 GGFHINANLTNFVLS--SASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQ 553
           GGF+I+ NL+++ LS  S+S  C+LG  P + ++ ILGD FL++AYVVY+LD++EISMAQ
Sbjct: 412 GGFYISGNLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQ 471

Query: 554 ANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            +    +EDI+VI  +VP+AVKAP YS T+ST  SIVSGG+IF
Sbjct: 472 VDLSGRSEDIDVIEDSVPSAVKAPSYSSTWSTDGSIVSGGDIF 514

 Score = 98.6 bits (244), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 71/111 (63%), Gaps = 21/111 (18%)

Query: 40  NFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQ 99
           N++++ F+K Y DS       ++N + + + + R              L+KR D YE + 
Sbjct: 35  NYVRIQFQKKYGDS-------FENASSNKKTEAR--------------LVKRGDDYEVVD 73

Query: 100 IINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           + NQ SFYSV+L IGTP+Q +TVLVDTGSSDLWVTGS+NPYC + SG +++
Sbjct: 74  LSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGSNNPYCSTKSGHTSS 124

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  357 bits (915), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 246/349 (70%), Gaps = 6/349 (1%)

Query: 250 QTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGL 309
           QT ++  S+ TI+C  YGTFD   SSTFQ+N TSF   Y D+++A+G W  DVL    GL
Sbjct: 184 QTNNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNLG-GL 242

Query: 310 NVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSV 369
           N+TGLSFAVAN +NSTVGVLGIGLP LE TYSG   ++K Y Y+NFP++LK SGAI  + 
Sbjct: 243 NITGLSFAVANMSNSTVGVLGIGLPGLETTYSG--STSKLYQYNNFPMLLKQSGAIDSTS 300

Query: 370 YSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX 429
           YSL+L+  +AK G+VLFGAVDH++Y G+ LYTVP+VN  +S GY  PI+FD+TL G+G  
Sbjct: 301 YSLFLDDLDAKQGSVLFGAVDHTKYVGN-LYTVPMVNILASKGYPNPIQFDVTLAGIGIQ 359

Query: 430 XXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNT 489
                      +  ALLDSGTT++YFP++++  +A+ + A YS ALG+Y M+C     +T
Sbjct: 360 NDSKNYTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSST 419

Query: 490 QIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEI 549
             VFDFGGFHI   +++F+L ++   CVL + P      +LGD+FLTHAYVVY+LD+ EI
Sbjct: 420 NFVFDFGGFHITGPVSDFLLPTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEI 479

Query: 550 SMAQANYDNSNED--IEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           S+AQAN    N D  I++I+ +VP+A+KAP YS T+S +  I +GGNIF
Sbjct: 480 SLAQANTGTQNLDSNIQIISDSVPSAIKAPLYSETWSKAMPISTGGNIF 528

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%)

Query: 81  ESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPY 140
           + KP+  L+KR+  YE + I N+QSFYSV L IGTP+Q ITVLVDTGSSDLW+ GSDNPY
Sbjct: 55  DKKPHFALVKRDGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPY 114

Query: 141 CKSNS 145
           C S S
Sbjct: 115 CASTS 119

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  357 bits (915), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 247/347 (71%), Gaps = 9/347 (2%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           S+ T++C  YGTF+   SSTF++N TSF+I Y D+++A+G W +DVL  SD LNVTGLSF
Sbjct: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD-LNVTGLSF 296

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKP--YIYDNFPLVLKNSGAIHKSVYSLYL 374
           AVAN TNSTVGVLGIGLP LE TYSG   +T+   Y Y NFP+VLK SGAIH + YSL+L
Sbjct: 297 AVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFL 356

Query: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXX 434
           +  +  +G+VLFGA+DHS+Y G  LYTVP++N   +SGYS PI+FD+TL G+G       
Sbjct: 357 DDLDESHGSVLFGAIDHSKYTGQ-LYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERN 415

Query: 435 XXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFD 494
                 ++ ALLDSGTT++YFP  ++ L+A+ INA YS  LG+Y + C     NT +VFD
Sbjct: 416 LTLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFD 475

Query: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           FGGFHI+  L +F++ ++   C+L + P      ILGD+FLTHAYVVY+LD+  I++AQA
Sbjct: 476 FGGFHISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALAQA 535

Query: 555 N----YDNSNEDIEVIT-STVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           +      +S+ DIE+IT ST+P A++AP YS T++ ++ + SGGNIF
Sbjct: 536 DTSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 74/139 (53%), Gaps = 30/139 (21%)

Query: 15  NVSISDPIPPVENSNNDGKVNSVNS-----NFLKLGFEKFYADSINDIVIEYDNDTDDYR 69
           NV  +  IP  +  N      S N       ++KL FEK+  DS                
Sbjct: 26  NVIATTSIPSQQEQNKKQGEASENQPAPTLKYVKLPFEKYTGDSFESAT----------- 74

Query: 70  LQKRDSIIDLKESKPYVNLIKRND----GYEEIQIINQQSFYSVNLRIGTPAQSITVLVD 125
                     + +KP   L+KR++    GYE+++I NQQSFYSV L IGTP Q +TVLVD
Sbjct: 75  ----------RNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVD 124

Query: 126 TGSSDLWVTGSDNPYCKSN 144
           TGS+DLWVTGS NP+C+S+
Sbjct: 125 TGSADLWVTGSMNPFCQSS 143

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/351 (53%), Positives = 242/351 (68%), Gaps = 13/351 (3%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           ++AT+ C TYGTFD   SSTF+SN T+FAI Y DTSYA+G WG D ++ +  LNV+G+SF
Sbjct: 153 AEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINK-LNVSGVSF 211

Query: 317 AVANQTNSTVGVLGIGLPQLEVT------YSG----VYQSTKPYIYDNFPLVLKNSGAIH 366
           AVAN +NS++GVLGIGLP LEVT       SG       S+  Y Y NFP+VLKN G IH
Sbjct: 212 AVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271

Query: 367 KSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426
           K  YSL+LN    + G+VLFGAVDHS+Y G TLYTVPLV+    S  S P+EFDITL GL
Sbjct: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSASSKPVEFDITLYGL 330

Query: 427 GXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD 486
           G              I ALLDSGTT++YFP  + N +A+  NA+Y    G+Y M+C    
Sbjct: 331 GVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT 390

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDD 546
            NT +VFDFGGFHI A L +FV+  +S  CVL + P   N  +LGD+FL++AYVVY+L++
Sbjct: 391 SNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450

Query: 547 LEISMAQANYDNS-NEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           LE+SMAQAN+D+S  E +EVI+STVP+AVKA  YS  +S++  + +GGNIF
Sbjct: 451 LEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIF 501

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 2/58 (3%)

Query: 88  LIKRN--DGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           L KR+  DGY  + + NQ SFYSV+L IGTP Q +TVLVDTGSSDLWV G+DNP C S
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  353 bits (905), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/345 (52%), Positives = 245/345 (71%), Gaps = 10/345 (2%)

Query: 258 QATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           + T++C  YGTFD+  S +F+SNKT F I Y D S+A+G WG D + F++ +N+ G+SFA
Sbjct: 175 EPTMDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFAN-MNLEGVSFA 233

Query: 318 VANQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           VAN+TNSTVGV GIGLP+ E TY+         PY Y NFP VLK+ GAI+K+ YSL+LN
Sbjct: 234 VANETNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLN 293

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
             +A +G++LFGAVD S+Y+GD LYT+PL+N D +  Y  P+EFD+TLQG+G        
Sbjct: 294 SLDASSGDILFGAVDRSKYKGD-LYTLPLLNSDPTK-YKNPMEFDVTLQGVGFTNGSSKT 351

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                +I ALLDSGT+L Y P  +   +A  +  SY++ +GYYV+ CP  +D++Q+VFDF
Sbjct: 352 TFTTTKIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDF 411

Query: 496 GGFHINANLTNFVLSSA----SGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
           GGF I  NL+N++L S       +CVLG+LP +   AILGD+FL  AYVVY+LDD E+S+
Sbjct: 412 GGFTIKNNLSNYLLGSPDDGDDSQCVLGILPSD-VQAILGDVFLADAYVVYDLDDYEVSL 470

Query: 552 AQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           AQA++DNS EDI++I+ ++P A +APGYS T+ST  SI SGGNIF
Sbjct: 471 AQASFDNSKEDIQIISDSIPGAKRAPGYSKTWSTPASIKSGGNIF 515

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSG 146
           +L  RN+      + NQQ+FYSV+L +GTP Q+ITVL+DTGSSDLW+T  +NPYCKSN+G
Sbjct: 51  SLETRNNKEFNFIVENQQNFYSVDLLVGTPGQNITVLLDTGSSDLWLTAKNNPYCKSNAG 110

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  353 bits (905), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/348 (52%), Positives = 248/348 (71%), Gaps = 11/348 (3%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           SQA +NC TYGTFD   SSTF+SNKT F+I Y D+++A+G WG D L+ ++ LNVTGLSF
Sbjct: 168 SQA-MNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNN-LNVTGLSF 225

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDNFPLVLKNSGAIHKSVYSLYL 374
           AVAN+TNSTVGVLGIGLP LE TYSGV  S+  K Y Y+NFP++LKNSGAI  + YSL+ 
Sbjct: 226 AVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFT 285

Query: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXX- 433
           N  ++K+G +LFGAVDH +Y GD LYT+P++N   + GY  PI+F +TLQG+G       
Sbjct: 286 NHSDSKHGTILFGAVDHGKYAGD-LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERD 344

Query: 434 --XXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS-DDNTQ 490
                    +I  LLDSGTT++Y P D++ ++A  + A+YS   GYY+M+C +  ++ + 
Sbjct: 345 ENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESS 404

Query: 491 IVFDFGGFHINANLTNFVL--SSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLE 548
           ++FDFGGF+I   L+NF L   S S  C+LG+ P +  + ILGD FL   YVVY+LD++E
Sbjct: 405 LIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNME 464

Query: 549 ISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           ISMA A++ +  E I+ I  +VP+A+KAPGYS T+ST +SIV GGN+F
Sbjct: 465 ISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 65/105 (61%), Gaps = 21/105 (20%)

Query: 37  VNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYE 96
           +N  ++K+ F++ Y DS       +++ T+D + + R              L+ R D YE
Sbjct: 32  INDGYVKMNFQRKYGDS-------FESATNDTKARAR--------------LVTRGDDYE 70

Query: 97  EIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
            +++ NQ SFYSV L IGTP Q +TVLVDTGSSDLWVTGSDNPYC
Sbjct: 71  LVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC 115

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  347 bits (891), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 241/338 (71%), Gaps = 4/338 (1%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           I+C  YGTFD   SST++SN T+F I Y D S+A+GEWGRD +     LN++ +S AVAN
Sbjct: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGS-LNISDVSMAVAN 257

Query: 321 QTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
            TNSTVGVLGIGLP LE TYS      S   ++Y NFP+VLK  G   K+VYSLYLN  +
Sbjct: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXX 438
           A NG++LFGAVD S+++G +LYT+P++N   S G S PI+FD+TLQGLG           
Sbjct: 318 AHNGSILFGAVDKSKFDG-SLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLS 376

Query: 439 XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGF 498
             +I ALLDSG+TL Y P+D+L ++A  + A +S+ L YY+M+CP   D T+IVF+FGGF
Sbjct: 377 TTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436

Query: 499 HINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDN 558
           +I  NLT +    +S  CVL +LP   +SAILGD FL HAYVVY+L+D EISMAQAN+D 
Sbjct: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496

Query: 559 SNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           ++EDIEV++S++P A  A GYS TYS+SKSI SGGNIF
Sbjct: 497 NHEDIEVVSSSIPQATAAAGYSSTYSSSKSITSGGNIF 534

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 61/76 (80%), Gaps = 3/76 (3%)

Query: 73  RDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLW 132
            +S++  +++ P+V   KR+DG  E+ + N+Q+FYSV+L +G+P+Q ITVL+DTGSSDLW
Sbjct: 46  EESLLGKRDALPFV---KRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLW 102

Query: 133 VTGSDNPYCKSNSGKS 148
           +TGSDNPYCKSNS  S
Sbjct: 103 ITGSDNPYCKSNSHSS 118

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  347 bits (889), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 187/347 (53%), Positives = 239/347 (68%), Gaps = 7/347 (2%)

Query: 255 DPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGL 314
           D S   I+C  +GTFD   SSTF +N T+F I Y D S+A G WG D ++  D + +  L
Sbjct: 117 DTSTTGIDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGTDTVSIDD-ITLDAL 175

Query: 315 SFAVANQTNSTVGVLGIGLPQLEVTYSGVY--QSTKPYIYDNFPLVLKNSGAIHKSVYSL 372
           S AVAN +NS++GV+G+GL  LE TYS  +  +S + Y Y NFPL LKN+G +  + YSL
Sbjct: 176 SLAVANSSNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPLALKNAGIVAANAYSL 235

Query: 373 YLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XX 431
           YLN      GN+LFGAVDHS Y G  LYT+PLVN  S SG+   +EFD+TL G+G     
Sbjct: 236 YLNDPEETTGNILFGAVDHSLYSGQ-LYTIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSS 294

Query: 432 XXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC-PDSDDNTQ 490
                     I+ALLDSGTTLTYFP   ++LLA  + A YS + GYY ++C    D  T+
Sbjct: 295 GSATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTK 354

Query: 491 IVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEIS 550
           +VFDFGGFHINA L +FV+ S +  C L ++P N +SAILGD FL +AYVVY+LD+LEIS
Sbjct: 355 LVFDFGGFHINATLADFVVQSGTSTCFLSIIPQNSSSAILGDTFLNNAYVVYDLDNLEIS 414

Query: 551 MAQANYD-NSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           MAQA +D +S+EDIEVI+S+VP+AVKAPGYS T+ST+ SI SGGNIF
Sbjct: 415 MAQAKWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTTMSITSGGNIF 461

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 23/110 (20%)

Query: 35  NSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDG 94
           N + + F+ L F K Y D        YD  + D R             KP + L+KR DG
Sbjct: 27  NELPNKFVNLRFNKKYGD-------HYDTASTDSR-------------KPKLELVKR-DG 65

Query: 95  --YEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCK 142
             YEE+++ NQQSFYSV + +GTP+Q +TVL+DTGSSD WV GSDNPYC 
Sbjct: 66  SDYEEVELTNQQSFYSVEVDVGTPSQRVTVLLDTGSSDFWVMGSDNPYCS 115

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 249/351 (70%), Gaps = 16/351 (4%)

Query: 256 PSQATINCDTYGTFDIEDSSTFQSNKTS--FAIRYADTSYATGEWGRDVLTFSDGLNVTG 313
           P +  ++C  YGTF +EDSST+  N ++  F I Y DT++A+G WG+D L   D +NVTG
Sbjct: 112 PRRDRVDCSEYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQD-VNVTG 170

Query: 314 LSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLY 373
           +SFAVAN+TNSTVGV+GIGLP LE T SG    ++PY Y NFP VLKNSGA   ++YSLY
Sbjct: 171 VSFAVANRTNSTVGVMGIGLPGLETTNSG----SRPYTYANFPQVLKNSGATQSALYSLY 226

Query: 374 LNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXX 433
           LN    + G++LFGAVDHS+Y G ++YT+P++N   S GY+TPI+FDITLQG+G      
Sbjct: 227 LNDLEEERGSILFGAVDHSKYTG-SMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSES 285

Query: 434 ---XXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQ 490
                     ++ ALLDSGTT+TY P ++++ +A+ + AS S   G YV+ C +  +N  
Sbjct: 286 NGDEVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMH 345

Query: 491 IVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEIS 550
           +V+DFGGFHIN+NLTN+++ ++   C+LGL P + N+AILGD FLT AYVVY+L++L+I 
Sbjct: 346 LVYDFGGFHINSNLTNYIVQASQTLCILGLFPRDSNTAILGDTFLTDAYVVYDLENLQIG 405

Query: 551 MAQANYDNSNED--IEVITST--VPNAVKAPGYSYTYSTS-KSIVSGGNIF 596
           +AQA +  S+ D  I+++T +  +P+A +AP YS T+STS  ++ +GGNIF
Sbjct: 406 LAQAKFGVSDSDAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTTGGNIF 456

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%)

Query: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNP 139
           K  +P + L KRN GYEEI + NQQSF+SV L +GTPAQ++TVLVDTGSSDLW+TG+DNP
Sbjct: 39  KWQRPQMRLAKRNTGYEEITLTNQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGADNP 98

Query: 140 YCKSNSG 146
           YC + SG
Sbjct: 99  YCLTYSG 105

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  343 bits (881), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 233/350 (66%), Gaps = 8/350 (2%)

Query: 253 SLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVT 312
           S+D  QATI+C  YGTF  + SS+F+SN T F I+Y D SYA G WGRD +T  D + V+
Sbjct: 186 SMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQD-VKVS 244

Query: 313 GLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSL 372
            +S AVAN +NST GVLGIGLP LEVT +     +  Y Y NFP +L + G I KS YSL
Sbjct: 245 DISLAVANISNSTFGVLGIGLPGLEVTNALAESPSDAYTYKNFPAMLVDQGKIRKSAYSL 304

Query: 373 YLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXX 432
           ++N  NA +G+VLFGAVDHS+Y G TL T+PLVN   S+    PI+FD+TL GLG     
Sbjct: 305 FVNDLNATHGSVLFGAVDHSKYTG-TLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLND 363

Query: 433 XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIV 492
                      ALLDSGTT T+ P  +++ +AK +NA Y D  G+Y   C +  D+ ++V
Sbjct: 364 TNTTITTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELV 423

Query: 493 FDFGGFHINANLTNFVLSS------ASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDD 546
           FDFGGFHI + L NF L++       +  C L L+PYN    ILGD FLT AYVVY+L++
Sbjct: 424 FDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLEN 483

Query: 547 LEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           LEISMAQAN D  +EDIE I STVP+AVKAPGYS T++++  I +GGNIF
Sbjct: 484 LEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIF 533

 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 21/122 (17%)

Query: 31  DGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIK 90
           + K +   S F+KL F+K   D + +                R   I      P V  +K
Sbjct: 24  EAKYSQDESKFVKLSFDKLRGDLVEN---------------ARAGQI------PRVKRVK 62

Query: 91  RNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           R+DG    +I NQ +FYSV + +G+PAQ +T+L+DTGSSD+WV GS+NPYC+ +SGKS +
Sbjct: 63  RDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKH 122

Query: 151 LL 152
           +L
Sbjct: 123 VL 124

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  340 bits (872), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/360 (49%), Positives = 232/360 (64%), Gaps = 17/360 (4%)

Query: 250 QTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGL 309
           Q   + P  A I+C TYGTFD   SSTF SN T+F IRY D ++A+G WGRD + FSD L
Sbjct: 173 QLKDVTPQDAHIDCSTYGTFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHL 232

Query: 310 NVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSV 369
           N+T  SF VA+ TNST+ VLG+GLP+LEVTYSG+     PY Y NFP+ LK SG I + V
Sbjct: 233 NLTDFSFGVADLTNSTISVLGMGLPRLEVTYSGLSLDRSPYTYANFPMALKQSGLIDRMV 292

Query: 370 YSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX 429
           YSLYLNK  A  G+VLFGAVDHS+Y G +L T+PL+   S SG   PI F++ LQGLG  
Sbjct: 293 YSLYLNKAGASTGSVLFGAVDHSKYHG-SLNTIPLI---SLSGSGIPIAFNVALQGLGMS 348

Query: 430 XXXXXXXX-XXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDN 488
                        + ALLDSGTT+TY P  ++  +A T+ AS+ +A G Y+++CP   D+
Sbjct: 349 SDSQGTQTFLSTPLPALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDD 408

Query: 489 TQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLE 548
            +  FDFGGF I+  L+NF+L +    CVL L   +   AILGD FLT AYVVY+L++LE
Sbjct: 409 REFNFDFGGFQISVPLSNFILEALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLE 468

Query: 549 ISMAQANYDNSNED------------IEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           ISMAQA YD+ N+             +EV+TS +P+A +APGYS T     +I   GN++
Sbjct: 469 ISMAQARYDDDNDSDIEKYNADNKVLLEVVTSNIPSANQAPGYSSTLINRSTIQPSGNMY 528

 Score =  100 bits (248), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 68/113 (60%), Gaps = 20/113 (17%)

Query: 29  NNDGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNL 88
           NND   + V    L+L   KFY DS  ++  E D D                 S P   L
Sbjct: 21  NNDAFQDKV----LRLDINKFYGDSKFNLGSEIDEDI----------------STPSARL 60

Query: 89  IKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           +KR DG+E I+I NQQ+FYSV+L +GTP Q +TVLVDTGSSDLWVTG++NPYC
Sbjct: 61  VKREDGHEIIEIQNQQAFYSVDLMLGTPPQKVTVLVDTGSSDLWVTGNNNPYC 113

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  338 bits (867), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 240/345 (69%), Gaps = 9/345 (2%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           +Q TI+C TYGTFD   SSTFQSN T F I Y D S+A G WG DV+   D L++  +S 
Sbjct: 126 TQDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVSV 185

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGV--YQSTKPYIYDNFPLVLKNSGAIHKSVYSLYL 374
           AVA+ TNS++GVLGIGL  LE TYS          Y+YDNFP+ LK SG I  + YSLYL
Sbjct: 186 AVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSGLIESTAYSLYL 245

Query: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XXXX 433
           N  ++K+GN+LFG VDHS+Y G  LYTVP+++  S++ Y TP+EFD+TL G+G       
Sbjct: 246 NDPSSKSGNILFGGVDHSKYTGQ-LYTVPMLS--STTSYKTPVEFDVTLNGIGIIDSSGN 302

Query: 434 XXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD-DNTQIV 492
                  Q   LLDSGTT +Y P  ++ ++ + + ASY   +GYY ++C   D D+T+IV
Sbjct: 303 KKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTIDCSAEDSDDTKIV 362

Query: 493 FDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
           FD GGFHIN  L++FV+  ++  C+L ++P +G   +LGD FL +AY+VY+LD+ EI+MA
Sbjct: 363 FDMGGFHINTTLSDFVIQISTSTCILSIVPQDGK-VVLGDSFLNNAYIVYDLDNYEIAMA 421

Query: 553 QANYDNSNE-DIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           QA +D++ E +I+VI++T+P+A++APGYS T+STS+SI SGG+IF
Sbjct: 422 QAAWDSTREANIDVISTTIPSAIRAPGYSSTWSTSRSISSGGDIF 466

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 68/121 (56%), Gaps = 21/121 (17%)

Query: 25  VENSNNDGKVNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKP 84
           +  ++   K N+    +L L FEK Y DS                L    S      + P
Sbjct: 17  ISQASASSKDNTSPPKYLALNFEKRYGDSF---------------LNSSSS------NGP 55

Query: 85  YVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
              LIKR+DGYE++ + NQQSFYSV + +GTP+Q +TVL+DTGSSD WVT SDNPYC + 
Sbjct: 56  SAQLIKRDDGYEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTT 115

Query: 145 S 145
           S
Sbjct: 116 S 116

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 171/343 (49%), Positives = 233/343 (67%), Gaps = 6/343 (1%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           + AT++C  +GTF+ EDS TF SN T F++ Y DTSYA G WG D +  +D +N+T +S 
Sbjct: 147 ASATLDCKEFGTFNREDSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININD-VNLTNVSI 205

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGV--YQSTKPYIYDNFPLVLKNSGAIHKSVYSLYL 374
            VAN+TNS+VG++GIGL  LE TY+GV   ++   + Y NFP++LK  G I K+VYSL+L
Sbjct: 206 GVANKTNSSVGIMGIGLSNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFL 265

Query: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXX 434
           N++ A  G++LFGAVDHS+Y G  LYTVP++N     G   P++  +TLQG+G       
Sbjct: 266 NRREAFEGSILFGAVDHSKYSGQ-LYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMT 324

Query: 435 XXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFD 494
                  + ALLDSGTTL Y P  ML +LA+ +NA +   +GYYV +C   D NT + F+
Sbjct: 325 NTTSTTPVPALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCSRVD-NTNLYFN 383

Query: 495 FGGFHINANLTNFVLS-SASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQ 553
           FGGF+I +N++ +V+S S    CVLGL P    +AILGDMF+ HAY+V++LDD EISMAQ
Sbjct: 384 FGGFNIVSNMSTYVVSRSNENSCVLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISMAQ 443

Query: 554 ANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           ANY      +E +T  VP+A+KAPGYS+T+S S+ I  GGNIF
Sbjct: 444 ANYAGGKNQLEAVTQQVPSAMKAPGYSHTFSGSQGITGGGNIF 486

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 37/44 (84%)

Query: 102 NQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNS 145
           N+Q+FYS+ L +GTP Q + VL+DTGSSDLW+ GSDNPYCK +S
Sbjct: 69  NEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKESS 112

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/345 (51%), Positives = 238/345 (68%), Gaps = 3/345 (0%)

Query: 253 SLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVT 312
           S++   AT+ C +YGTF  + SS+FQSN T+F I Y D++YA G WGRD +T  D + ++
Sbjct: 178 SVNSQYATLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQD-ITLS 236

Query: 313 GLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQST-KPYIYDNFPLVLKNSGAIHKSVYS 371
           G+S AVAN++NST GVLGIGL  LEVT  G   +    Y Y+N P  + + G IHK+ YS
Sbjct: 237 GISMAVANESNSTFGVLGIGLAALEVTNVGTLATRGNSYTYENLPAKMVSEGIIHKNAYS 296

Query: 372 LYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX 431
           L+L+  +AK G+VLFGAVDHS+Y G +LYT+PL N   S GYS PI+ ++TLQG G    
Sbjct: 297 LFLDSLDAKEGSVLFGAVDHSKYTG-SLYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTAN 355

Query: 432 XXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQI 491
                     + ALLDSGTTLTY P  ++  +A    A Y  + GYY+++C D  D  ++
Sbjct: 356 NTNSTFTTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCSDVKDTDEL 415

Query: 492 VFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
           VFDFGGFHIN+ + NF++ + S  C LGL+P + +S ILGD FLT AYVVY+LD+LEIS+
Sbjct: 416 VFDFGGFHINSKVENFLIRATSNICALGLIPQSSSSLILGDNFLTAAYVVYDLDNLEISL 475

Query: 552 AQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           AQANYD  + +IEVI+S+VP+AVK P YS T+STS  I +GGNIF
Sbjct: 476 AQANYDGGSSNIEVISSSVPSAVKGPSYSSTWSTSVPISTGGNIF 520

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 22/115 (19%)

Query: 39  SNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEI 98
           S F+K+ F+K   D+  D                         +  +  L KR DG E +
Sbjct: 32  SKFVKVSFDKLRGDTAEDAT---------------------AGAVAHGVLAKRADGSETV 70

Query: 99  QIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCK-SNSGKSTNLL 152
            I NQQ+FYSV L +G+PAQ++T+L+DTGSSD+WV GS+NPYC+  +SG S ++L
Sbjct: 71  VIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSNNPYCEGGSSGNSKHVL 125

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 238/345 (68%), Gaps = 7/345 (2%)

Query: 256 PSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLS 315
           PS+   NC  YGTF+   SST+ SN + F I+Y DT++A+G WGRDV++  +GLNVTGL+
Sbjct: 136 PSRELFNCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSI-NGLNVTGLT 194

Query: 316 FAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           FAVAN +NS+  VLGIGL QLE TY+G   S+  Y Y NFP+VLKN+G      YSL+LN
Sbjct: 195 FAVANASNSSNSVLGIGLTQLETTYNGS-NSSHSYTYANFPVVLKNAGLTESISYSLFLN 253

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
           + +A++G++LFGAVDHS+Y G+ LYT+PLVN     G+  PIEF +TLQG+G        
Sbjct: 254 ELDAESGSILFGAVDHSKYSGN-LYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKT 312

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCP-DSDDNTQIVFD 494
                ++ A+LDSGT+LT  P  +++ +A ++N  YS  +  Y+++C   +  NT +VFD
Sbjct: 313 TITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFD 372

Query: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           FGGF I   L+NF+L      C+LGL   + NS ILGD FL  AYVVY+L++L+ISMAQA
Sbjct: 373 FGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQA 432

Query: 555 NYDNSNEDIEVIT--STVPNAVKAPGYSYTY-STSKSIVSGGNIF 596
            +DNS  DI+VI   S VP+A+KAPGYS T+ +T  SI +GGNIF
Sbjct: 433 KFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477

 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 69/104 (66%), Gaps = 10/104 (9%)

Query: 38  NSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEE 97
           N+ FL L F K Y  S  DI  ++     D  L + +  ++ K+S+ Y    + +  Y+E
Sbjct: 33  NNGFLDLQFNKLYGTSF-DIAKKWQ----DINLGQHN--LNFKQSELYK---RASSDYQE 82

Query: 98  IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           ++I NQQSFYS++L IGTP Q++TV +DTGSSDLWVTGS+NPYC
Sbjct: 83  LEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 170/334 (50%), Positives = 229/334 (68%), Gaps = 5/334 (1%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
           AT++C  YGTFD   S++F+SN T+F+I Y DT++A+G WG D     D LNVT LSFAV
Sbjct: 143 ATVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGD-LNVTNLSFAV 201

Query: 319 ANQTNSTVGVLGIGLPQLEVTYSGV-YQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           ANQ+NSTVGV+GIGL  L+ TY GV   S+  Y Y+NFP+ LK+ G I ++ YSL+LN+ 
Sbjct: 202 ANQSNSTVGVMGIGLAGLQSTYVGVNSASSGAYQYENFPMALKSQGIIDRNAYSLFLNEP 261

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXX 437
           +A  G+VLFGAVDHS+Y G  LYTVP++N   + G   PIEFD+T+QG+           
Sbjct: 262 DADKGSVLFGAVDHSKYSGQ-LYTVPMLNMYRNRGIQNPIEFDVTVQGVSVTSGSTIRNL 320

Query: 438 XXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG 497
              Q  ALLDSGTTL+Y P  +  L+A  + A YS   GYY M CP  +++T++ FDFGG
Sbjct: 321 TNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPSENNDTRLNFDFGG 380

Query: 498 FHI--NANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQAN 555
           F I  N +       S+S  C LG++P   N+AI GD FL HAYVVY+L++ EISMAQA 
Sbjct: 381 FQISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAA 440

Query: 556 YDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSI 589
           ++NS+  IEVI+ ++P+AV+A GYS T+ST+++I
Sbjct: 441 FNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 52/62 (83%)

Query: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNP 139
           K +KP   L KR+DGYEEI+I N+Q+FYS+ L IGTP+Q++TVL+DTGSSDLWV+  +NP
Sbjct: 49  KGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENP 108

Query: 140 YC 141
           YC
Sbjct: 109 YC 110

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/343 (51%), Positives = 241/343 (70%), Gaps = 11/343 (3%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
            +C+TYGTFD   SST+ SN T F+I Y DTS+A G WG+D L   D L+V+GLSFAVAN
Sbjct: 123 FDCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHLDD-LDVSGLSFAVAN 181

Query: 321 QTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAK 380
            TNSTVGVLGIGLP LEVTY  +      Y YDNFP++LKNSGA H ++YSL+L+   A+
Sbjct: 182 VTNSTVGVLGIGLPGLEVTY--INAPRNRYQYDNFPMILKNSGATHSNLYSLHLDHPEAE 239

Query: 381 NGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXX 440
           +G VLFGAVDHS+Y G +LYT+PLVN   + G+S P +F++TLQG+G             
Sbjct: 240 HGTVLFGAVDHSKYTG-SLYTIPLVNTLKTHGFSDPAKFEVTLQGVGIVANNTQTTLTNT 298

Query: 441 QIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDD-NTQIVFDFGGFH 499
           +I ALLDSGTTLTY P+ ++ ++A +I A +S   GYY+++C   ++ +T +VFDFGGFH
Sbjct: 299 KIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFH 358

Query: 500 INANLTNFVLSSASGKCVLGLLPYNG-NSAILGDMFLTHAYVVYNLDDLEISMAQANYD- 557
           IN  LT+F++ +    C+L ++   G NSAILGD FL +AYVV++L++ EISMAQA ++ 
Sbjct: 359 INGKLTDFIVETFGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMAQALHNV 418

Query: 558 NSNEDIEVITST--VPNAVKAPGYSYTYSTSKSIVS--GGNIF 596
           + ++DIE++TS   V +AV A GYS T++   S +    G+IF
Sbjct: 419 DDDQDIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAGDIF 461

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/75 (62%), Positives = 57/75 (76%), Gaps = 3/75 (4%)

Query: 79  LKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDN 138
            + S  +  L KR  GYE + ++N+Q+FYSV+L IGTP+Q+ITVLVDTGSSDLWVTGSDN
Sbjct: 47  FEGSTTWSALAKRTRGYELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSDN 106

Query: 139 PYC---KSNSGKSTN 150
           PYC   KSN   STN
Sbjct: 107 PYCVSVKSNLVSSTN 121

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  320 bits (821), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 241/345 (69%), Gaps = 4/345 (1%)

Query: 253 SLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVT 312
           S+  S AT++C  +GTFD   SS++QSN T F I YAD ++A G+WG D +   D +NVT
Sbjct: 181 SVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDD-VNVT 239

Query: 313 GLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSL 372
           GLSFAV+N T+S  GVLGIGL   E TYSG   +   Y YDNFP+VL+ +G I K+ YS+
Sbjct: 240 GLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNRYQYDNFPIVLQRNGVIEKNAYSV 299

Query: 373 YLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXX 432
           +LN  +A +G++LFGAVDHS+Y G TLYTVP+VN   S GY+  I   ITLQG+G     
Sbjct: 300 FLNDLDADSGSILFGAVDHSKYTG-TLYTVPMVNALRSIGYTEQIRLSITLQGIGVTSSY 358

Query: 433 XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIV 492
                   +  ALLD+G T  YFP  +   +A +++A+YS + GYY ++C DS  +  +V
Sbjct: 359 GNETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDC-DSGSDYDLV 417

Query: 493 FDFGGFHINANLTNFVLS-SASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
           FDFGGFHI + L++++++ S+S +CVLG+LP + N   LGD FLT AYVVY+L++LEIS+
Sbjct: 418 FDFGGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDLEELEISL 477

Query: 552 AQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           AQA+Y + +E IEVI  +VP+AV APGYS T+ST+ S+ +GGNIF
Sbjct: 478 AQASYTSGDEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIF 522

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (81%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           +L KR DGY +++I NQ +FYSV+L IGTPAQ + VL+DTGSSDLWV GS NP+C
Sbjct: 61  HLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFC 115

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  314 bits (804), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 220/331 (66%), Gaps = 6/331 (1%)

Query: 256 PSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLS 315
           P +  INC  +GTF+ + SSTF++N T F I Y D ++A+G WGRDVL+F D +NVTGLS
Sbjct: 191 PPEFLINCTEFGTFNTKKSSTFKNNHTDFFISYGDNTFASGYWGRDVLSFQD-INVTGLS 249

Query: 316 FAVANQTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDNFPLVLKNSGAIHKSVYSLY 373
           F VAN TNSTVGVLGIGLP+LE TY G   S     YIY+NFP VLKNSG I+K+ YSL+
Sbjct: 250 FGVANVTNSTVGVLGIGLPELESTYFGTVNSVNESSYIYNNFPQVLKNSGIINKTAYSLF 309

Query: 374 LNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXX 433
           LNK ++  G++L GAVD S++  D LYTVP++N + S GY+ P  F + +Q +       
Sbjct: 310 LNKSDSTQGSLLLGAVDTSKF-ADKLYTVPMLNINPSKGYTDPSAFLVLMQKMTRYKYGQ 368

Query: 434 XXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCP--DSDDNTQI 491
                  +I  LLDSGTT+ Y P+ ++  + +   A Y + L  Y + CP  +  + T  
Sbjct: 369 GHLVPSSRIPVLLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSF 428

Query: 492 VFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
            FDFGGF I A+L++F++ + +G+C+ G++P + N  ILGD FLTHAYVVY+L+D EISM
Sbjct: 429 SFDFGGFQIKASLSDFIVPTDNGQCIFGMIPQDMNVGILGDSFLTHAYVVYDLEDYEISM 488

Query: 552 AQANYDNSNEDIEVITSTVPNAVKAPGYSYT 582
           AQA YD    +   I STVP+AV+A  YS T
Sbjct: 489 AQAVYDGGEPNYIPIVSTVPSAVRAKYYSAT 519

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 62/112 (55%), Gaps = 19/112 (16%)

Query: 34  VNSVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKR--DSIIDLKESKPYVNLIKR 91
           +  +   FL+L F++ Y +S  D  +  D       L+KR  DS                
Sbjct: 39  IQPIKPKFLELKFDRHYGESYEDSTLGKDGAV---HLEKRTFDS--------------AY 81

Query: 92  NDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           N  YE++ + NQ +FYSV L IGTPAQ +TV+VDTGSSDLW+T + NP+C +
Sbjct: 82  NGSYEDVILTNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETSNPFCST 133

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  308 bits (788), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 161/358 (44%), Positives = 228/358 (63%), Gaps = 19/358 (5%)

Query: 253 SLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVT 312
           +L   Q TI+C+ YGTFD   SS+F++N +S  IRY D SYA G +G+D +   + L++ 
Sbjct: 123 TLPSPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEM-NSLSIP 181

Query: 313 GLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQS--TKPYIYDNFPLVLKNSGAIHKSVY 370
            +S  VA+Q N T GVLGIGL  LE T +G   +  +K Y Y+NFP VLK+ G I  + Y
Sbjct: 182 NVSLGVAHQANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAY 241

Query: 371 SLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLG--- 427
           SL+LN   A  G +LFG VDHS+Y G  LYTVP++N   +     PI+F +TLQG+G   
Sbjct: 242 SLFLNSPGASQGGILFGGVDHSKYTGP-LYTVPIIN---TGAPGNPIQFQVTLQGVGISL 297

Query: 428 ---------XXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYY 478
                                 +   LLDSGTTL   P+ + + +AK + A+Y+    YY
Sbjct: 298 DKSNGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYY 357

Query: 479 VMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHA 538
            + CP  +DNT+++ DFGGF +NA +TN +  S +G+C+LG+ P + +S  LGD+FL  A
Sbjct: 358 QLKCPSQNDNTRLILDFGGFQVNAKITNHITRSQNGECLLGITPSDTDSGTLGDVFLVDA 417

Query: 539 YVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           YVVY+LD+ EIS+AQA++ +S + IE I+S+VP+A KAPGYS T++ S+SI +GGNIF
Sbjct: 418 YVVYDLDNYEISLAQADFSDSAQSIEPISSSVPSATKAPGYSNTWTGSESIKTGGNIF 475

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 40/53 (75%)

Query: 98  IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           +   N+  FYSV L +GTPAQ ++VL+DTGSSDLWV G+DN +C++++   +N
Sbjct: 61  VNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSN 113

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  308 bits (789), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 231/337 (68%), Gaps = 8/337 (2%)

Query: 251 TMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLN 310
           T +   S ATI+C  YGTF+++ S TF+SN ++F + Y D S+A G WG D + + DGLN
Sbjct: 119 TANFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHV-YLDGLN 177

Query: 311 VTGLSFAVANQTNSTVGVLGIGLPQLEVTYS-GVYQSTKPYIYDNFPLVLKNSGAIHKSV 369
           V+ +SFAVAN++NSTVGV G+GLP  E T + GV  +   Y Y NFP VLK++G + K+ 
Sbjct: 178 VSDVSFAVANESNSTVGVFGVGLPGEEATVTPGV--NGNHYQYKNFPQVLKDNGVVQKNA 235

Query: 370 YSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX 429
           YSLYLN  ++ +GN+LFGAVDHS+Y G+ LYT+P+VN  +  G + P EFD+T+QG+   
Sbjct: 236 YSLYLNSPDSNSGNILFGAVDHSKYSGN-LYTLPIVNTYADQGVA-PREFDVTVQGITVG 293

Query: 430 XXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNT 489
                      + +ALLDSGTTL Y P  + + LAK++   +S + GYY++  P  +D+T
Sbjct: 294 NSSSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDT 353

Query: 490 QIVFDFGGFHINANLTNFVLSSASGK--CVLGLLPYNGNSAILGDMFLTHAYVVYNLDDL 547
           +I FDFGGFHI   L+N++L  +  +   +LG+L   G+ AI GD+FL  AYVVY+L+D 
Sbjct: 354 KITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYVVYDLEDY 413

Query: 548 EISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYS 584
           EIS+AQAN+++ + DIE I+ +VP A +APGYS TY+
Sbjct: 414 EISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYT 450

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%)

Query: 89  IKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           +  ++G+    I NQQ+FYSV L++GTPAQ++ VL+DTGSSDLW+TGS NPYC
Sbjct: 42  VGNSNGHANFDIKNQQNFYSVELKVGTPAQNVLVLLDTGSSDLWITGSGNPYC 94

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  301 bits (770), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/349 (46%), Positives = 224/349 (64%), Gaps = 10/349 (2%)

Query: 249 YQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDG 308
           +++  + P++  ++C  +GTF+  DSST+ +N T F I Y+D S A G WG+DVL+   G
Sbjct: 152 FESSVIYPAEGLVDCGFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIG-G 210

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
           L+++G+ FAVAN TNS++GVLGIGLP  E TY      T  Y+YDN P+VLK SG I  +
Sbjct: 211 LDISGVPFAVANYTNSSLGVLGIGLPGSETTYL-----TNSYMYDNLPMVLKKSGVIDSA 265

Query: 369 VYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGX 428
            YSL L   N     +LFGAVDHS+Y G +LYT+P++N   S GY +P+EFD+T+ GLG 
Sbjct: 266 AYSLLLAAYNNYTSGLLFGAVDHSKYSG-SLYTIPMINIYESRGYESPVEFDVTIYGLGI 324

Query: 429 XXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDN 488
                       +  ALLDSG+T  +FP  +LNL A+ +NA+YS+  G Y +  P S  N
Sbjct: 325 SSTDSNTTIATMKTPALLDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLYTI--PYSPAN 382

Query: 489 TQIVFDFGGFHINANLTNFV-LSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDL 547
              VFDFGGFHIN  +     +S    + +L ++ +N N  +LG+ FL  AYVV++ ++ 
Sbjct: 383 ISFVFDFGGFHINLPIRELCSVSYGEPEYILNIVAHNENRIVLGEAFLARAYVVFDFENY 442

Query: 548 EISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           EISM Q++YD + EDIE I STVP AVK   YS ++S+  SI SGG+IF
Sbjct: 443 EISMGQSSYDYAEEDIEAIISTVPGAVKVASYSNSWSSFGSITSGGDIF 491

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 89  IKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           +++ D Y  + I + + +Y V L +GTP Q++T+LVDT SSD+WVT  DNP C
Sbjct: 56  LQKRDTYATVNI-SAEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLC 107

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 163/344 (47%), Positives = 221/344 (64%), Gaps = 9/344 (2%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           S   ++C  YG FD   SS++++N T F I Y DTS+A+GEWG D L   D LN  GL+F
Sbjct: 116 STEPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGD-LNADGLTF 174

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
           AVA  +NS+V VLGIGL  +EVT +        Y YDN P+VLK +G I K+ YSLYLN 
Sbjct: 175 AVATASNSSVAVLGIGLTGIEVTRA---SGDNGYEYDNLPIVLKRNGVIDKTAYSLYLND 231

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
            +A +G+VLFGAVDHS+Y G TL TVPLVN ++  G+  PIE  ITL GLG         
Sbjct: 232 LDATSGSVLFGAVDHSKYTG-TLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKKRGT 290

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD-DNTQIVFDF 495
               ++ ALLDSGTTL+YFP ++   +A  + A ++  L  +++ C  +  +N  ++++F
Sbjct: 291 ISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDLIYNF 350

Query: 496 GGFHINANLTNFVLSS-ASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           GG  I + L N++  +     C+LG++P + N  ILGD+FLT  Y VY+L+ LE+S+AQA
Sbjct: 351 GGVEITSPLVNYLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVYDLEALEVSIAQA 410

Query: 555 NYDNS--NEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            Y  S   E+IEVI STVP A KAPGYS T+ST   I +GGN+F
Sbjct: 411 AYGASAEKENIEVIKSTVPGATKAPGYSNTWSTYAPISTGGNMF 454

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%)

Query: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           K   P+  L KR+D Y +++I N+Q+FYSVNL IGTPAQ +TVLVDTGSSDLW+ G+D
Sbjct: 49  KGVMPFGELKKRDDEYVDVKIHNEQTFYSVNLSIGTPAQEVTVLVDTGSSDLWIIGAD 106

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 154/345 (44%), Positives = 216/345 (62%), Gaps = 10/345 (2%)

Query: 256 PSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLS 315
           P+   +NC  +G+FD   SST++ N T F IRY D++YA G WG D L      NV GL+
Sbjct: 113 PNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQA-NVDGLT 171

Query: 316 FAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           FAVA+ +NS+V VLGIGLP +E T S        Y YDN P+VLK +  I K+VYS+++N
Sbjct: 172 FAVAHASNSSVAVLGIGLPAMETTMS---SQQFGYQYDNLPMVLKRNNVIKKTVYSMFIN 228

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXX--- 432
           + NAK G+VLFGAVDHS+Y+G TL TVPLVN +     + P+E  +TL  +G        
Sbjct: 229 ELNAKTGSVLFGAVDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDED 287

Query: 433 XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASY-SDALGYYVMNCPDSDDNTQI 491
                   ++ ALLDSGTTLTYFP  + + LA+   A + S+ +GY V         T  
Sbjct: 288 KVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTAY 347

Query: 492 VFDFGGFHINANLTNF-VLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEIS 550
           ++DFGGF I + L+++ ++++  G C  G++P++ +  ILGD+FLT AYVV++L+ LE+S
Sbjct: 348 IYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVS 407

Query: 551 MAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNI 595
           MAQANY+   E IEVI   VP AV+APGY+  +     +V  G +
Sbjct: 408 MAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGS 136
            L KRND + +I+I NQQ FYSVNL IGTP Q + VL+DTGSSDLWV G+
Sbjct: 55  RLAKRND-WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  287 bits (734), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/339 (48%), Positives = 222/339 (65%), Gaps = 5/339 (1%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           I+C TYGTF + DSS+F  N T F  +YAD S ATG WG DV+ F  G  ++ +S AVA+
Sbjct: 118 IDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDFG-GQELSDISIAVAD 176

Query: 321 QTNSTVGVLGIGLPQLEVTYSGVYQSTK---PYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           QT+S+ GVLGIGL  LE TYSG   ++     Y YDNFP+ L     I  + YSLYL+  
Sbjct: 177 QTDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPA 236

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXX 437
              +G +LFG VDH++Y GD L T+PL+N   ++GY++PI+  +TL GLG          
Sbjct: 237 TGSSGTILFGGVDHNKYSGD-LNTIPLINTLEANGYTSPIKLQVTLNGLGVSDGSSTSTV 295

Query: 438 XXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG 497
              QI ALLDSGTTLTY P  M +LLA+ I A+YS     YV++C + D+++ IV+DFGG
Sbjct: 296 TTTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDEDSMIVYDFGG 355

Query: 498 FHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYD 557
           F I   L   +   +  +C L +   + + A LGD+FLTHAYVVY+LD+ EISMAQ NY+
Sbjct: 356 FQIQTPLAGSLYQLSDDQCELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYN 415

Query: 558 NSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            + EDIE+I+ +VP A KA GY  T++TS+SI +GGNIF
Sbjct: 416 ATTEDIEIISDSVPGATKAAGYYNTWTTSESITAGGNIF 454

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/63 (58%), Positives = 50/63 (79%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSG 146
           NL+KR+ G +E+++IN+  FY++++ IGTP QS+TVLVDTGSSD WV  S NPYC+S S 
Sbjct: 49  NLVKRSSGTDEVELINESVFYAIDMEIGTPKQSVTVLVDTGSSDFWVPSSTNPYCESKSA 108

Query: 147 KST 149
            ST
Sbjct: 109 TST 111

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  276 bits (705), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 159/356 (44%), Positives = 224/356 (62%), Gaps = 19/356 (5%)

Query: 250 QTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGL 309
           QT ++  S+ATI+C ++GTF+   SS+F +N T F I Y D++ A G W +DVL   D L
Sbjct: 153 QTEAVPSSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGD-L 211

Query: 310 NVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSV 369
            ++ + FAVA   +    V G+G P  E T     +  +PY Y NFP++LK+ G + K V
Sbjct: 212 EISDMPFAVAVVGDVQTPVFGVGFPGTESTAGSSVK--EPYEYANFPVLLKSQGYVKKVV 269

Query: 370 YSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNG----DSSSGYSTPIEFDITLQG 425
           YSL+L+ Q++ +G+ L GAVDHS+Y G  LYT+P+ +G    D+ S  STP  F ITLQG
Sbjct: 270 YSLFLDAQDSSSGSFLLGAVDHSKYSGG-LYTLPMYSGTDGDDTLS--STPSRFIITLQG 326

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS 485
           LG             + +  LDSG+T T FP +   L+A ++ ASYS     YVM CP  
Sbjct: 327 LGISDKGENKTVATTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSK 386

Query: 486 DDNTQIVFDFGGFHINANLTNFVLSSASGK-CVLGL----LPYNGNSAILGDMFLTHAYV 540
           DD+T  V+DFGGF I++ L+N++ ++     CVL +    +PY     +LGD FL  AYV
Sbjct: 387 DDDTNFVYDFGGFTISSPLSNYMEATGDDSVCVLDIDTDDIPY----IVLGDAFLVSAYV 442

Query: 541 VYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           VY+L+D EIS+AQANYD  +E+IEV++ ++P+AVKAP YS T+ST  +  SGGNIF
Sbjct: 443 VYDLEDYEISIAQANYDGGSENIEVVSDSIPSAVKAPFYSSTWSTYVTATSGGNIF 498

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 33/55 (60%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
            L KR D YE + +   +  Y V L +GTP Q   V +DTGSSDLWV  S NPYC
Sbjct: 53  RLSKRGDDYENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYC 107

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  268 bits (684), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 150/340 (44%), Positives = 208/340 (61%), Gaps = 8/340 (2%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
            +C   GTF+  +SS+F+SN T F   YAD ++A+G WG DV+   D ++V+ +S AV N
Sbjct: 147 FDCALLGTFNNSESSSFKSNNTDFLTGYADNTFASGFWGTDVVRIGD-VDVSDVSLAVVN 205

Query: 321 QTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
            TNST  VLGIG+P LE + +G    ++   Y YDNFP+ LKN G I K  YSL+LN  +
Sbjct: 206 LTNSTSPVLGIGMPVLESSNAGRLAAETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSD 265

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXX 438
           A  G+VLFGAVDHS+YE + L+TVP+VN     G   PIEF +T+ GLG           
Sbjct: 266 ATEGSVLFGAVDHSKYE-NGLFTVPMVNTYKDQGVQHPIEFYVTMYGLGFKKDGFLNTIT 324

Query: 439 XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGF 498
                 LLDSG+T +Y P  ++++LA  +NA++S+ +  Y + CP  +D T + FD GGF
Sbjct: 325 TTNFPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGF 384

Query: 499 HINANLTNFVLSSASGKCVLGLLPYNGNSA---ILGDMFLTHAYVVYNLDDLEISMAQAN 555
            I+  L++ V      +CVL ++   G      ILGD FL+ AYVVY+L+  EIS+ QA+
Sbjct: 385 LIDVPLSDLVAKRHKNQCVL-MVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQAS 443

Query: 556 YDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNI 595
             ++ EDIEVI STVP AV+AP Y   ++    I   GNI
Sbjct: 444 TGDAAEDIEVIKSTVPGAVRAPFYDRPWTGGTVISMSGNI 483

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           +L +R D Y  + + NQQ +YSV L +GTP Q+++VL+DTGSSDLW+T  DNPYC
Sbjct: 44  SLARRADDYLSVDVENQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYC 98

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  266 bits (679), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 207/330 (62%), Gaps = 12/330 (3%)

Query: 260 TINCDTYGTFDIEDSSTF--QSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           T++C  +GTF+   SSTF  Q N T F I Y D ++A G W +D L+  DG +++ L FA
Sbjct: 142 TVDCAEFGTFNPNKSSTFRPQGNDT-FMIMYGDGTFANGLWAKDTLSL-DGHDISNLQFA 199

Query: 318 VANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           VAN ++S VGVLG+GL  LE +        +P  Y NFP+VLK +  I K  YSLY+N  
Sbjct: 200 VANMSDSDVGVLGVGLTGLESSADPF--DDEPSQYPNFPVVLKQNNVISKMAYSLYINSL 257

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXX--XXX 435
           +A+ G+VLFGAVDHS+Y G  LYT+PLVN  +       +EFD+T+QGLG          
Sbjct: 258 DAEAGSVLFGAVDHSKYTGG-LYTIPLVNALAQYFVDEILEFDVTVQGLGIESKKNCFQK 316

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                Q  AL+DSGTTL Y   D+ + +A ++ A+ SD    Y   CP  DD+TQ+VFDF
Sbjct: 317 TLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYELYTFECPAKDDDTQLVFDF 376

Query: 496 GGFHINANLTNFVLSSASGK-CVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           GGF I   L+N+VL +   K C LG++P   N  ILGD FL  AYVV++L++LE+S+ QA
Sbjct: 377 GGFQITNPLSNYVLETDDEKVCGLGVVPSYSN--ILGDEFLASAYVVFDLENLELSIGQA 434

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTYS 584
           N +   EDIE I STVP A KAPGYS T++
Sbjct: 435 NLNPGPEDIEPIISTVPGAQKAPGYSSTWT 464

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 3/60 (5%)

Query: 88  LIKRNDGYEEIQI---INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           L +R+ G  +  +    N++ FYSV L IGTP Q ITVL DTGSSDLWV+ + NP+C+++
Sbjct: 53  LHRRDSGSSDSALSVLKNEEVFYSVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFCEAD 112

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  268 bits (684), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 208/329 (63%), Gaps = 10/329 (3%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTS-FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
           TI+C  YGTF+ + S++  +N +  F + Y D SYA G W RD L   DG +++ L FAV
Sbjct: 154 TIDCAQYGTFNADRSTSLFANYSKPFFVSYNDDSYALGYWARDKLVV-DGDDISSLEFAV 212

Query: 319 ANQTNSTVGVLGIGLPQLEVTYSGVYQSTK-PYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           A  +NSTVGVLG+GL  LE T    Y+S     IY NFP+VLK +GAI K  YSLYLN  
Sbjct: 213 AEISNSTVGVLGVGLQGLESTVH--YRSPNISSIYPNFPMVLKENGAIDKIAYSLYLNSL 270

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXX 437
           +A +G+VLFG VDHS+Y G  LYT+PLVN     G  TP++FD+T+QG+G          
Sbjct: 271 DAPSGSVLFGGVDHSKYTGG-LYTLPLVNTYKDYGVKTPVQFDVTVQGIGIESEKACRQE 329

Query: 438 X--XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                +I AL+DSGTTL Y   +++N +A  +NAS+S   G ++  CP   D+TQ +FDF
Sbjct: 330 TFTTTKIAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSDGDDTQFIFDF 389

Query: 496 GGFHINANLTNFVLSS-ASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           GGF I + L+N++L +     C LGL+  N    I GD FL  AYVVY+L++LE+S+AQA
Sbjct: 390 GGFQIKSPLSNYILRTDDENICGLGLISSN-QGTIFGDEFLASAYVVYDLENLELSLAQA 448

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTY 583
           N++  + +IE I S +P A +A  Y  T+
Sbjct: 449 NWNPGSPEIEKIVSEIPRAQRASQYWNTW 477

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%)

Query: 99  QIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           +++N   FYSV L IGTP Q +TVL DTGSSDLWV+ +DNPYC
Sbjct: 74  ELVNNNVFYSVGLDIGTPPQQVTVLFDTGSSDLWVSSNDNPYC 116

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  261 bits (666), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 140/328 (42%), Positives = 206/328 (62%), Gaps = 8/328 (2%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           +++ ++C  YGTF+ ++S TF  + + F I YAD ++A G W +DV++F D   +  + F
Sbjct: 108 TKSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNF-IADMQF 166

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
           AVAN+TNSTVGVLGIG  +LE      Y+      Y NFPL LKN+G I K+ YSLYLN 
Sbjct: 167 AVANETNSTVGVLGIGFERLESVKG--YEGAPNTYYQNFPLALKNNGVIDKTAYSLYLNS 224

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX-XXXX 435
            ++ +G++LFG +D ++Y GD LYT PLVN   S   + P +F +T+QG+G         
Sbjct: 225 LDSSSGSILFGGIDSNKYTGD-LYTFPLVNIHPSV-VNKPAKFHVTVQGIGVQSSGSEQS 282

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                +  ALLDSGTTL   P++  + +A  +NA+Y+D  G Y M CP  +D+T+ +FDF
Sbjct: 283 ILMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDF 342

Query: 496 GGFHINANLTNFVLSSASGK-CVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           G   I   L NF+L+    + C  G+LP   ++ ILGDMFL+ AYVVY+L+  E+S+AQA
Sbjct: 343 GDLKIKVPLKNFILAPEDNEYCGFGVLP-TVDTMILGDMFLSAAYVVYDLESYEVSLAQA 401

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYT 582
           N+++   +I+ I  TVP A KA   +++
Sbjct: 402 NWNSDESEIQAIRHTVPGATKATAATWS 429

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (77%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           +L KRN     + + N+Q FY+ +L +GTP Q++TVL+DTGSSDLWVTGSDNPYC SN
Sbjct: 40  SLWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSN 97

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  261 bits (667), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 151/363 (41%), Positives = 213/363 (58%), Gaps = 25/363 (6%)

Query: 256 PSQA-TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGL 314
           P+ A T++C +   FD+E SS+F+SN T F   Y D SYA+G WG D +   + L++  +
Sbjct: 161 PAAAKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGN-LSIADV 219

Query: 315 SFAVANQTNSTVGVLGIGLPQLE-------------------VTYSGVYQSTKPYIYDNF 355
            FAVAN +NS+ GVLG+GLP LE                    + + +   +KP  Y NF
Sbjct: 220 FFAVANFSNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKP-TYANF 278

Query: 356 PLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYST 415
           P +LK    I K  YSL+LN  NA NG +LFGAVDHS+Y G +L T+PLVN     G + 
Sbjct: 279 PQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSKYTG-SLSTLPLVNSLYVEGIND 337

Query: 416 PIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDAL 475
             + +ITL G+G             ++ ALLDSGTT++Y P D+ +L+AK +        
Sbjct: 338 TTQLEITLDGMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQT 397

Query: 476 GYYVM-NCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMF 534
           G+  + NCP  +DNTQ+VF+FGG  I+   T F+  S    C +  +P      +LGD F
Sbjct: 398 GFIELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKSDDDNCYVTFMPQGEPGILLGDNF 457

Query: 535 LTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYST-SKSIVSGG 593
           L +AY+VY+L+D+EIS+AQAN++   E+IE I   VP+AVKAPGYS +++    S  + G
Sbjct: 458 LRNAYIVYDLEDMEISIAQANFNGGAENIEAIVKNVPSAVKAPGYSASFTEFPSSYATTG 517

Query: 594 NIF 596
           NIF
Sbjct: 518 NIF 520

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 71/121 (58%), Gaps = 21/121 (17%)

Query: 32  GKVNSVNS-NFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIK 90
           G VN+V +  +LKL FEK  AD   ++ + +   +   +L+KR S               
Sbjct: 11  GCVNAVAAEKYLKLDFEKHRADIDEELPLTH---SAARQLRKRAS--------------- 52

Query: 91  RNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
             D      ++ Q+++YS+NL +GTP Q++++L+DTGSSD+WV GS+N YCK++  KS N
Sbjct: 53  --DDSVAFPLVAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSNNGYCKNSDNKSRN 110

Query: 151 L 151
           L
Sbjct: 111 L 111

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  258 bits (660), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/337 (44%), Positives = 203/337 (60%), Gaps = 16/337 (4%)

Query: 262 NCDTYGTFDIEDSSTFQSNKT-SFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           NC+    F+ ++S TF  N+T  + I+Y D SYA+G WG D L   D L V  +SFAVAN
Sbjct: 191 NCNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGD-LQVHNVSFAVAN 249

Query: 321 QTNSTVGVLGIGLPQLEVTYSGV---YQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
            TNST  V GIG P  E +++ V   Y++  P+ Y NFP  LKN G I +  YSLYLN  
Sbjct: 250 DTNSTTPVFGIGFPGGESSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSP 309

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVN-GDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
           N+  GNVLFG VDHSQY+G  LYT+P++  G+ +S         ITLQG+          
Sbjct: 310 NSTYGNVLFGGVDHSQYQGQ-LYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHK 368

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALG----YYVMNCPDSDDNTQIV 492
                I  +LDSGTT  Y P      LAK+I + Y   LG     Y+++CP S DN  I 
Sbjct: 369 VKTKPIPVVLDSGTTAMYLPYK----LAKSIASRYHGILGPEDQGYIIDCPKSGDNDYIT 424

Query: 493 FDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
           FDFGG  I  ++ N++   +  KC+LG++P +   A+ GD+FLT AYVVY+L+  EIS+A
Sbjct: 425 FDFGGVTIKTDIRNYIFEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLA 484

Query: 553 QANYDNSNEDIEVITST-VPNAVKAPGYSYTYSTSKS 588
           QA++++S+E IE ITS+ VP A +APGYS T+    S
Sbjct: 485 QASFNSSSEQIEAITSSGVPGAKRAPGYSKTWKVVHS 521

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 26/106 (24%)

Query: 43  KLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKR---NDGYEEIQ 99
           K+GF K Y  S ++   +                      + YVNL +    +D  +E+ 
Sbjct: 33  KIGFNKVYGKSFSEATAD----------------------RKYVNLFRNKNISDDNDEVA 70

Query: 100 IINQQ-SFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           + N   ++YSVN+ +GTP Q++T+ +DTGSSDLWV       C  N
Sbjct: 71  LQNNANTYYSVNISLGTPGQNMTIQLDTGSSDLWVIKPGGLQCTDN 116

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  258 bits (658), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/335 (43%), Positives = 207/335 (61%), Gaps = 14/335 (4%)

Query: 267 GTFDIEDSSTFQSNKT--SFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNS 324
           G FD   SS+F  N T   F I Y D SYA+G W  D LT  D ++V  ++ AVA+ TNS
Sbjct: 181 GNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDDLTVGD-ISVKDMTIAVADDTNS 239

Query: 325 TVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNV 384
           +V V GI    LE +  G      P+ Y+NFP +LK+ G + ++ YSLYLN   A +GN+
Sbjct: 240 SVAVFGISYRGLESSVFGD-NLQDPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNI 298

Query: 385 LFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIE-FDITLQGLGXXXXXXXXXXXXXQIV 443
           LFG VDH++Y GD LYT+P++ G   S    P E F +T+QG+G               +
Sbjct: 299 LFGGVDHNKYSGD-LYTLPVLKGQEDS---DPWERFVVTVQGIGIKGSETQNTLTTTPFI 354

Query: 444 ALLDSGTTLTYFPKDMLNLLAKTINASYSD--ALGYYVMNCPDSDDNTQIVFDFGGFHIN 501
            LLDSGTT  Y P+ + +++A     S+ D   +  YV++CP  D+  +IVF+FGGF+I 
Sbjct: 355 GLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSDDE--KIVFNFGGFNIE 412

Query: 502 ANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNE 561
            +L+N++  + +G+C+L + P +    ILGD FL  +YVVY++D+ EIS+AQAN+D S E
Sbjct: 413 TSLSNYITDNGNGQCILNISPTSDYMGILGDSFLRDSYVVYDMDNNEISLAQANFD-STE 471

Query: 562 DIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           D+E IT  VP A KAPGYS TYS  ++  +GGNIF
Sbjct: 472 DVEAITGPVPGATKAPGYSSTYSGPQTFQTGGNIF 506

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%)

Query: 96  EEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKST 149
           +EI I NQ  +YS ++ +GTP Q +T+L+DTGSSDLW+      +C+S+S  +T
Sbjct: 60  QEIDISNQNVYYSASIYLGTPGQELTLLLDTGSSDLWIPQKGGYHCQSDSDDAT 113

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 148/345 (42%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           ++C  YG F++  SSTF++N T   + Y D S+  G WG DV++   GLN++G++FAVA 
Sbjct: 118 LDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLG-GLNISGVNFAVAE 176

Query: 321 QTNSTVGVLGIGLPQLEVTYS----GVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
            +NS+ GVLG+ LP  E TYS    G   +T  Y Y N PL LK  G I K  YS+YLN 
Sbjct: 177 ISNSSSGVLGVSLPSEESTYSINSNGTTNATN-YQYSNLPLQLKEQGIIDKVTYSIYLND 235

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
             +K G++LFGAVDHS+Y G TLYT+PLVN +     + P E DITL G+G         
Sbjct: 236 TKSKYGSILFGAVDHSKYTG-TLYTLPLVNSEYDV-VNKPYELDITLNGIGYQSMSSNMT 293

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASY-SDALGYYVMNCPDSDDNTQIVFDF 495
               ++ AL+DSGTT++ FP +++ ++AK +NA+   +  G  +  CP   DN +++F+ 
Sbjct: 294 LYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNAKLLFNL 353

Query: 496 GGFHINANLTNFVLSSASGKCVLGLLPYNGNS--AILGDMFLTHAYVVYNLDDLEISMAQ 553
           GG  I  ++  F  +   GKC L ++P    S   ILGD F+   Y V++L+  E+S+AQ
Sbjct: 354 GGALIYVDIKEFT-TKVKGKCYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEVSIAQ 412

Query: 554 ANYDNS-NEDIEVITSTVPNAVKAPGYSYTYSTSKSIVS-GGNIF 596
           AN+++S    IE I STVP+AVKAP Y  T+S   SI S  G+IF
Sbjct: 413 ANFNSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASISSVTGDIF 457

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 40/61 (65%)

Query: 88  LIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGK 147
           L KR D    + + N    Y V L +GTP Q ++V +DTGS+DLW +G+DNPYCK+N  K
Sbjct: 30  LEKRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNKKK 89

Query: 148 S 148
           +
Sbjct: 90  A 90

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  249 bits (637), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 192/341 (56%), Gaps = 4/341 (1%)

Query: 258 QATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           Q  I+C  YGTF+   SS+F++N T+F + YAD + A+  WG DV+   + L +  +SF 
Sbjct: 150 QPIIDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRV-ELLEILDMSFG 208

Query: 318 VANQTNSTVGVLGIGLPQLEVT--YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           VAN  N+T GV GIG P LE T  ++        Y Y NFP  L N G++ K  YSL+LN
Sbjct: 209 VANVFNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLN 268

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
             +A  G+VLFGAVDHS+Y  D L+TVPLVN     G   P  F++     G        
Sbjct: 269 DSHAMKGSVLFGAVDHSKYRND-LFTVPLVNDFRDKGMDHPHYFNVFNARRGCPNKRRPQ 327

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                + + +LDSG T++  P  +++ L +++NA++ + L  Y + CP   D +   FD 
Sbjct: 328 NRRHDEFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSVASFDI 387

Query: 496 GGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQAN 555
           G FHI+  L+NFV      KC+L L P +    IL D FL+ AYVV++L+  EISM QAN
Sbjct: 388 GRFHIDGPLSNFVRKYEKNKCILRLDPADNQPYILCDNFLSRAYVVHDLESYEISMGQAN 447

Query: 556 YDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
            + + E IE I S VP  V+AP Y  T+     +   GNI+
Sbjct: 448 TEYAPEQIEAIKSKVPGTVRAPSYDKTWGNGTDVSPSGNIY 488

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 2/59 (3%)

Query: 90  KRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC--KSNSG 146
           KR+  Y  + +IN++  Y+V L +GTP Q+ITV ++ GS+D W+T  DNPYC  K +SG
Sbjct: 54  KRDGDYVLVDLINEKILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIKKHSG 112

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  248 bits (634), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 145/351 (41%), Positives = 212/351 (60%), Gaps = 15/351 (4%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           S  T+NC  YG F+  +SSTF+ N + F + YAD S+ATG WG DV++F++ LN++ ++F
Sbjct: 115 SSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNE-LNISNVNF 173

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYI-----YDNFPLVLKNSGAIHKSVYS 371
           A+ +  NS+ GVLG+GLP +E TY G Y  ++  I     Y NFP+ LK +G I K  YS
Sbjct: 174 ALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQNGVIDKIAYS 233

Query: 372 LYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX 431
           LYLN   +K G+VLFGAVDH++Y G  LYT+PL N      ++ P + +IT+ GLG    
Sbjct: 234 LYLNSSKSKFGSVLFGAVDHNRYNG-PLYTLPLANS-LFQNFTDPFQLEITMNGLGLQGN 291

Query: 432 XXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDA-LGYYVMNCPDSDDNTQ 490
                    +  ALLDSGTTLT   K + +L+A  +N + +       +  CP   +N +
Sbjct: 292 DANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKCPSKKENKK 351

Query: 491 IVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNS---AILGDMFLTHAYVVYNLDDL 547
           ++F+F G  +  ++ N +++   GKC L    +   S    I GD FL   Y+VYNL+D 
Sbjct: 352 LIFNFSGAEVAVDI-NQMMNKHKGKCYLQFAVHEDTSNDAIIFGDNFLRSVYLVYNLEDK 410

Query: 548 EISMAQANYDNS-NEDIEVITSTVPNAVKAPGYSYTYSTSKSIVS-GGNIF 596
           EIS+A AN+++S  E+IE I STVP+A++AP Y  TYS   +  +  G+IF
Sbjct: 411 EISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAVTGDIF 461

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (64%)

Query: 80  KESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNP 139
           K  K   +L+KR+D Y  + + N    Y V L +GTP Q+ITV +DTGSSDLW   +DNP
Sbjct: 23  KSPKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNP 82

Query: 140 YCKSN 144
           +CK N
Sbjct: 83  FCKEN 87

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  251 bits (641), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 211/340 (62%), Gaps = 13/340 (3%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDG-LNVTGLSFAVANQ 321
           C  YGTFD   SSTFQ   ++  I Y D +   G WG D L  ++G + +      VA+ 
Sbjct: 93  CKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVADS 152

Query: 322 TNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKN 381
           ++S  GV+G+G P LE T + V  + + Y Y NFP+ LK  G    +V+++ L+  N+  
Sbjct: 153 SDSVAGVIGLGFPGLETT-NNVQANGESYTYANFPMQLKQQGVTDATVFAIALD--NSYG 209

Query: 382 GNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXX-XXX 440
           G++LFGAVD  +Y G  LYT+P+VN   S G +TPI  ++TLQG+G              
Sbjct: 210 GDILFGAVDEGKYIGG-LYTLPVVN---SRGTATPIRMEVTLQGIGVDSDGGDQETFSST 265

Query: 441 QIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHI 500
            ++AL+DSG+T+ Y P+ +   +   + A Y  +   Y ++C  + +N  ++FDFGGFHI
Sbjct: 266 PMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVENDNLIFDFGGFHI 325

Query: 501 NANLTNFVLS---SASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYD 557
           +  ++N++++   S++G+C+ G+L  +GN+ +LGD FL+ AYVV++LD  EISMAQ N +
Sbjct: 326 STPVSNYIITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHYEISMAQGNSN 385

Query: 558 NSNEDIEVITS-TVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           N + +++ +TS T+PNA KAP YS T+ST+  + SGGNIF
Sbjct: 386 NGDGNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIF 425

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 50/68 (73%), Gaps = 1/68 (1%)

Query: 77  IDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGS 136
           +  K  +    L++R DG + + +  Q  FYS++L IGTP+Q +TVL+DTGSSDLWVTG+
Sbjct: 22  LPFKRVRQSPQLVRREDG-DSVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGA 80

Query: 137 DNPYCKSN 144
           +NPYC+++
Sbjct: 81  NNPYCQTS 88

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  247 bits (630), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 208/347 (59%), Gaps = 12/347 (3%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           S  T++C  YG ++  +SSTF SN T   I Y D  +  G WG D ++  + LN++ LS 
Sbjct: 114 SDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGN-LNLSNLSI 172

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKP--YIYDNFPLVLKNSGAIHKSVYSLYL 374
            V+  TN++ G+LG+GLP  E T++     T P  Y Y NFP+ LK  G I K  YS+YL
Sbjct: 173 GVSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYL 232

Query: 375 NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXX 434
           N+  +K G++LFGAVDHS+Y+G  LYT PLVN     G S P +F+IT+ G+G       
Sbjct: 233 NETGSKYGSILFGAVDHSKYQG-PLYTFPLVNSKYKEG-SDPFQFEITMNGVGLVGKTDN 290

Query: 435 XXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM--NCPDSDDNTQIV 492
                 ++  LLDSG+T++  P+D+ +L+A+ +N +  D  G  +    CP   DN +++
Sbjct: 291 ITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGTV-DGKGNCIKLPKCPSKKDNQKLI 349

Query: 493 FDFGGFHINANLTNFVLSSASGKCVLGLLPYNG-NSAILGDMFLTHAYVVYNLDDLEISM 551
           F+F G   + N+T+F +    GKC L     +G N A+LGD F+ + Y V+NLDD E+S+
Sbjct: 350 FNFSGAEFSVNVTDF-MEKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSL 408

Query: 552 AQANYDNS-NEDIEVITSTVPNAVKAPGYSYTYSTSKSIVS-GGNIF 596
           AQANY++S   DIE I  TVP+AV AP Y  T+S   +  +  GNIF
Sbjct: 409 AQANYNSSLKPDIEEIKDTVPSAVLAPQYYNTFSADPTATAVTGNIF 455

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 96  EEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           E  Q+   +  Y V + +GTP Q + + +DTGSSDL+V    NPYCK+
Sbjct: 39  EAAQLTFDKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPYCKN 86

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  239 bits (609), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 195/330 (59%), Gaps = 10/330 (3%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           I+C  +G F+   SST+++N T+F + YADT++A+G WG D L+F +G+ V  ++F +A 
Sbjct: 119 IDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSF-NGVKVDNVTFGLAA 177

Query: 321 QTNSTVGVLGIGLPQLEVT----YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
            +NST  V GI LP  E T     +G       Y Y NFP++LK  G + K  YS+YLN 
Sbjct: 178 FSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKIAYSVYLND 237

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
             +K G++LFGAVD S+Y G TLYT+PLVN       S P +F+ITL G+G         
Sbjct: 238 TRSKYGSILFGAVDQSKYIG-TLYTLPLVNSLYKQ-VSKPFQFEITLNGIGLQTADKNYT 295

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMN-CPDSDDNTQIVFDF 495
               ++  LLD+G T +  P  +  L+A  +N +  D  G+  ++ CP+  +   +VF+F
Sbjct: 296 LYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTVVFNF 355

Query: 496 GGFHINANLTNFVLSSASGKCVLGLLPYNG-NSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           GG  I+ ++ +       GKC L +   +    A LGD+FL H YVVYNL+D EIS+A A
Sbjct: 356 GGAEISIDIRDLT-RKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIANA 414

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTYS 584
           N++ S  DI+ I STVP AVKAP Y  TYS
Sbjct: 415 NFNYSTPDIQEIVSTVPGAVKAPQYYNTYS 444

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 81  ESKPYVNLI--KRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDN 138
           E  P  NL   KR+D   ++++ N    Y+V L +GTP Q+ITV +DTGSSDLW T   N
Sbjct: 22  EKVPEQNLALNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEAN 81

Query: 139 PYCKSNSGKS 148
           PYCK+N   S
Sbjct: 82  PYCKNNRKHS 91

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  240 bits (612), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 196/343 (57%), Gaps = 13/343 (3%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           INC+ YG F+   SST+  N T+F++ Y D ++A+G WG D ++  +G+ V  ++F +A+
Sbjct: 121 INCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISL-NGVKVENVTFGLAS 179

Query: 321 QTNSTVGVLGIGLPQLEVTYSGVYQSTKPYI---YDNFPLVLKNSGAIHKSVYSLYLNKQ 377
            +NST  V GIGLP  E TY+   + T       Y NFPL LK  G I K  YS+YLN  
Sbjct: 180 FSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKVAYSIYLNST 239

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGY--STPIEFDITLQGLGXXXXXXXX 435
            +K G++LFGAVDHS+Y G  LYT+P+VN     G+    P E ++TL GLG        
Sbjct: 240 KSKQGSILFGAVDHSKYSGP-LYTLPIVN---RFGHLVENPYELEVTLSGLGLQRATSNI 295

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM-NCPDSDDNTQIVFD 494
                 + ALLD+GTT TY P  +   LA   N           +  CP    N  IVF+
Sbjct: 296 TLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKSNDTIVFN 355

Query: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           F G  I   + +FV     GKC L  +    +  +LGD F+ H Y V++LDD EIS+AQA
Sbjct: 356 FSGAQIKIKMVDFV-EKHKGKCYLPCVSQESSFFLLGDSFMRHVYTVFDLDDKEISIAQA 414

Query: 555 NYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVS-GGNIF 596
           N++++ EDIE I+STVP+AVKAP Y  +Y    + +S  G+IF
Sbjct: 415 NFNSTKEDIEEISSTVPSAVKAPQYYSSYVDFPTEISVTGDIF 457

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 81  ESKPYVN--LIKRNDGYEEIQ-IINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           E  P ++  L KR D    I  ++N    Y+V + +GTP Q++TV +DTGSSDLW   + 
Sbjct: 22  EKTPKISDELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSAS 81

Query: 138 NPYCKSN 144
           NPYCK+N
Sbjct: 82  NPYCKNN 88

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  231 bits (589), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/348 (40%), Positives = 199/348 (57%), Gaps = 17/348 (4%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           ++C  +G F+   S+TF SNKT F I Y D+SYA G W  D L + +GLN++GL+F +A 
Sbjct: 113 LDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNL-YLNGLNISGLNFGLAY 171

Query: 321 QTNSTVGVLGIGLPQLEVTY-SGVYQSTKP-YIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
            +NS+  VLG+GL  LE +Y + + Q   P + Y NFP +LK  GAI K  YSLYLN   
Sbjct: 172 FSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVTYSLYLNDTK 231

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXX 438
           +K G +LFG VDHS+Y G  LYT+PLVN           + ++TL GLG           
Sbjct: 232 SKYGQILFGGVDHSKYVGQ-LYTIPLVNSKYQKSPGVIADLEVTLNGLGIRDNTTNTNTT 290

Query: 439 --XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDAL-GYYVMNCPDSDDNTQIVFDF 495
               ++ AL DSGT+ +Y P  M  ++A  +N +  +      +  CP   D  ++VF+F
Sbjct: 291 LYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTREVVFNF 350

Query: 496 GGFHINANLTNFVLSSASGKCVLGLL---PYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
            G  I   L  F     SGKC L L+   P NG   +LGD FL   Y V++L+  E+S+A
Sbjct: 351 NGVEIAIPLKQF-YQKKSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIA 409

Query: 553 QANYDNS-NEDIEVITSTVPNAVKAPGYSYTYST---SKSIVSGGNIF 596
           +AN+++S   D+E I STVP+A+KAP Y  T+S    +  +V  GNIF
Sbjct: 410 RANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDNATQVV--GNIF 455

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 4/64 (6%)

Query: 87  NLIKRNDGYEEIQIINQQS--FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           +L+KR+   +++++IN Q    Y++ L +GTP Q+IT  +DTGSSDLW   S NPYCK+N
Sbjct: 26  DLVKRD--VQDVKLINSQKAMLYNIQLSVGTPPQNITAQLDTGSSDLWFPDSTNPYCKAN 83

Query: 145 SGKS 148
             ++
Sbjct: 84  KKQA 87

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  223 bits (568), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 198/340 (58%), Gaps = 23/340 (6%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C  +GTF    SSTF+ N+T F I YAD  Y  G +G DV++  + + ++  +F V+N T
Sbjct: 137 CSYWGTFSPNVSSTFKYNETIFNISYADNMYYAGTYGTDVVSLGN-ITLSNFTFGVSNDT 195

Query: 323 NSTVGVLGIGLPQLEVT---YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNA 379
             + G+LG+ LP +E T      +  +T P++Y+NFP+ LK+ G I K  YSL+LN+ +A
Sbjct: 196 KMSYGILGVSLPSVEETDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSA 255

Query: 380 KNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXX----- 434
           + G++LFGAVD S+Y G  LYT+P++       Y+T    D    G+             
Sbjct: 256 RFGSILFGAVDKSKYSGQ-LYTLPMLQA-----YNT---LDALYSGMFVTAQSAAIIDSK 306

Query: 435 ---XXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQI 491
                    Q   L DSGT+ +  P ++ + + ++ +  YS     Y+ +C   + NTQ+
Sbjct: 307 SGNKTVSEVQFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVN-NTQL 365

Query: 492 VFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
             DFGGF+I+AN++NFV       CVL +LP +  S +LGD FL   YVVY+L++ E+S+
Sbjct: 366 SIDFGGFNISANISNFVTPLTKDHCVLQILPSDTVS-VLGDAFLVDTYVVYDLENHEVSV 424

Query: 552 AQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVS 591
           AQA+++N  EDIE+I+ +VP A  APGYS T+  +  I+S
Sbjct: 425 AQASFNNEEEDIEIISDSVPGATPAPGYSSTWRYNGYIIS 464

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 90  KRNDGYEE--IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGK 147
           KR++ +    I + +    Y V + IGTP Q+    +DTGSSD+    +D+ YC+S + +
Sbjct: 47  KRSEAFNSTLINMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDMCANEADSSYCESFTDE 106

Query: 148 S 148
           S
Sbjct: 107 S 107

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 198/336 (58%), Gaps = 12/336 (3%)

Query: 260 TINCDTYG-TFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
           T +CD +G       SS   ++ + F ++Y D +YA+G WG D    +   NV+ ++FA+
Sbjct: 119 TFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMWGTDTFKLNHH-NVSNITFAL 177

Query: 319 ANQTNSTVGVLGIGLPQLEVT---YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           AN  N+++GVLG+G P  E T     G     + Y YDNFP+ LK +  I K  YS++LN
Sbjct: 178 ANIANASMGVLGVGFPAEETTDDPSPGSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLN 237

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX 435
             N+K G +LFG VDHS+Y+G TL+TVP+VN   +   +T    +ITL GLG        
Sbjct: 238 DTNSKKGVILFGGVDHSKYQG-TLWTVPMVNNLLTLNQTTTSRPEITLNGLGFRDDKKNV 296

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASY-SDALGYYVMNCPDSDDNTQIVFD 494
                +I  LLD+GTTL Y PK +++++AK +N +  S   G  +  CP++ DN++++F+
Sbjct: 297 TLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFN 356

Query: 495 FGGFHINANLTNFVLSSASGKCVLGLLPYNGNSA---ILGDMFLTHAYVVYNLDDLEISM 551
           F G  I  +L N V     GKC L +  +   S    +LGD+F+ H Y V+N++D+E+S 
Sbjct: 357 FAGAEIPVSLLNMV-EKRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSF 415

Query: 552 AQAN-YDNSNEDIEVITSTVPNAVKAPGYSYTYSTS 586
           A AN  D++   IE I S VP+AVKAP Y  T+++S
Sbjct: 416 AVANGNDSAPLQIEAIISDVPSAVKAPQYYNTFASS 451

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%)

Query: 106 FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNS 145
            Y+V L +GTP Q++TV +DTGSSDLW   + NPYCK N+
Sbjct: 52  MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNA 91

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  230 bits (587), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 135/346 (39%), Positives = 202/346 (58%), Gaps = 14/346 (4%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           S  + NC+ +G+F I  SSTF  N T FAI Y   +   G WG+D L    G+N TGLSF
Sbjct: 111 SDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIG-GVNATGLSF 169

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
            V + T S+ G+LGIGLP  E T  G Y     Y YDNFP+VLKN G I    YS+YL+ 
Sbjct: 170 GVVHTTTSSAGILGIGLPDTETTAVGQYGH---YKYDNFPMVLKNKGIISHQGYSIYLDS 226

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX-XXXXX 435
            ++  G  L G VD S+Y G TLY +PLVN  ++  +S+P +F +TLQGLG         
Sbjct: 227 SSSTYGEFLLGGVDTSKYTG-TLYKLPLVNWYNTY-FSSPGDFHVTLQGLGLITNSGSAV 284

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                ++  +LD+G+T+T  P  + N L  ++   YS   G YV  CP   + +++VF+F
Sbjct: 285 TLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCP--TETSKLVFNF 342

Query: 496 GGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQAN 555
           GG +    +++F+ +     C L +   + ++ ILGD FL + Y  ++L++ EI +A A+
Sbjct: 343 GGINYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAMAD 402

Query: 556 YD----NSNED-IEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596
           +D    N  ED +  + S +P+AV+AP YS T+ T +++V+GG++F
Sbjct: 403 FDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMF 448

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 22/105 (20%)

Query: 46  FEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQS 105
           F K+YADS+ ++  +Y+  T + +L KRD                     E+I + N+ +
Sbjct: 34  FRKYYADSLEEL--DYNTSTSETKLVKRDG--------------------EDIVLTNRNT 71

Query: 106 FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           FYS  + +GTPAQ++ V+VDTGSSDLWV G DN  C   S  S N
Sbjct: 72  FYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLTCPLASDGSFN 116

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 198/326 (60%), Gaps = 12/326 (3%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C  +GTFD  +SSTF++N T F   Y D +Y  G +G DV++F + + +   +F V+N T
Sbjct: 139 CSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSF-ENITLNDFTFGVSNDT 197

Query: 323 -NSTVGVLGIGLPQLEVTYSGVYQ---STKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
             +  G+LGI LP  E T    Y    +  P+IYDNFP+ LKN G I+K  YSL+LN  +
Sbjct: 198 IGNPSGILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKINKIAYSLFLNGPD 257

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXX 438
           A  G++LFGAVD S+Y G  LYT+P++   ++ G S P    IT Q +            
Sbjct: 258 AHFGSILFGAVDKSKYTGQ-LYTLPMLQAFNTLG-SNP-GMIITAQSVAILDSESGNKTV 314

Query: 439 X-XQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG 497
              Q   +LDSGTT +Y P ++   + K+ +  YS     Y+ +C   +D T +  DFGG
Sbjct: 315 SDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKVND-TLLSVDFGG 373

Query: 498 FHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYD 557
           F+I+AN++NFV +SA  +CVL +   + ++ +LGD FL  AYVVY+L++ EIS+AQA+++
Sbjct: 374 FNISANISNFV-TSAKDRCVLNV-KQSESTYMLGDAFLVDAYVVYDLENYEISIAQASFN 431

Query: 558 NSNEDIEVITSTVPNAVKAPGYSYTY 583
           N  EDIEVI+ TVP A  APGY  T+
Sbjct: 432 NQEEDIEVISDTVPGATPAPGYFSTW 457

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 2/81 (2%)

Query: 68  YRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTG 127
           + +QK   II++  ++    + KRN+      +IN    Y V + IGTP Q++ + +DTG
Sbjct: 30  FPVQKLADIINIC-TQDVSTVFKRNE-VLNTTVINGIGVYVVKMEIGTPPQTLYLQLDTG 87

Query: 128 SSDLWVTGSDNPYCKSNSGKS 148
           SSD+ V  +D  YCKS S  S
Sbjct: 88  SSDMIVNNADIAYCKSMSDGS 108

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  215 bits (547), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/315 (39%), Positives = 186/315 (59%), Gaps = 17/315 (5%)

Query: 277 FQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQL 336
           F+ N+T F I Y D SY  G +G D+++  D + ++  +F V+N T    G+LGI LP  
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGD-ITLSNFTFGVSNDTTINGGILGISLPSA 59

Query: 337 EVTYSG---VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQ 393
           E+T SG   +  +T P+ YDNFP+ LKN G I K  YSL+LN+ NA+ G++LFGAVD S+
Sbjct: 60  EITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSK 119

Query: 394 YEGDTLYTVPLVNG----DSSSGYSTPIEFDITLQGLGXX-XXXXXXXXXXXQIVALLDS 448
           Y G  LYT+P++      D+  G        +T Q +               Q   L DS
Sbjct: 120 YTGQ-LYTLPMLQAYNTLDALGG-----GMLVTAQSVAILDSISGNKTVSEVQFPVLFDS 173

Query: 449 GTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV 508
           GT+ +  P ++ + + ++ +  YS     Y+ +C    +NTQ+  DFGGF+I+AN++NFV
Sbjct: 174 GTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKV-NNTQLSIDFGGFNISANISNFV 232

Query: 509 LSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITS 568
                  CVL +LP +   ++LGD FL   YVVY+L+  E+S+AQA+++N  EDIE+I+ 
Sbjct: 233 TPLTKDHCVLQILPSD-TVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISD 291

Query: 569 TVPNAVKAPGYSYTY 583
           +VP A  APGYS T+
Sbjct: 292 SVPGATPAPGYSSTW 306

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/325 (38%), Positives = 195/325 (60%), Gaps = 10/325 (3%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C  +GTF    SSTF+ N+T F + Y D SY  G +G DV++  + + ++  +F V+N T
Sbjct: 141 CSYWGTFSPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGN-ITLSNFTFGVSNDT 199

Query: 323 NSTVGVLGIGLPQLEVT---YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNA 379
            +  G+LG+ LP  EVT      +  +T P+IY+NFP+ LK+ G I K  YSL+LN+ +A
Sbjct: 200 TNNGGILGVSLPSAEVTDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSA 259

Query: 380 KNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX-XXXXXXXXX 438
           + G++LFGAVD S+Y G  LYT+P++   ++   +    F +T Q +             
Sbjct: 260 RFGSILFGAVDKSEYSGQ-LYTLPMLQAYNTLDATDAGMF-VTAQSVAILDSKSGNKTVS 317

Query: 439 XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGF 498
             Q   L DSGT+ +  P  + + + ++ +  YS     Y+ +C   + NT + FDFGGF
Sbjct: 318 EVQFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVN-NTLLSFDFGGF 376

Query: 499 HINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDN 558
           +I+AN++NFV + A   C+L +LP +    +LGD FL   YVVY+L++ E+S+AQA++DN
Sbjct: 377 NISANISNFV-TPAKDHCILQILP-SDTIFVLGDAFLVDTYVVYDLENHEVSVAQASFDN 434

Query: 559 SNEDIEVITSTVPNAVKAPGYSYTY 583
             EDI +I+ +VP A  APGYS T+
Sbjct: 435 KEEDIGIISDSVPGATPAPGYSSTW 459

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 90  KRNDGYEE--IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           KR++ +    I + +    Y V + IGTP Q+  + +DTGSSD+ +  +D  YC+S
Sbjct: 51  KRSEAFNSTLINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCES 106

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  217 bits (553), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 195/347 (56%), Gaps = 14/347 (4%)

Query: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           ++ T +C  + TF+   S+TF+SN T F I Y D SY  G WG D +  + G  +  ++F
Sbjct: 116 AERTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALA-GQTLENVTF 174

Query: 317 AVANQTNSTVGVLGIGLPQLEVTYS------GVYQSTKPYIYDNFPLVLKNSGAIHKSVY 370
           AVA  TN++ G+LGIGLP+LE + +          S K   Y NFP  LK +  I+K VY
Sbjct: 175 AVAELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVKKNPYMNFPESLKLNKLINKVVY 234

Query: 371 SLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX 430
           S+YLN+ N K G++LFGAVDH++Y+G+ L TVPLV  +   G   P E  +TL G+    
Sbjct: 235 SIYLNRTNDKFGSILFGAVDHNRYDGN-LTTVPLVFSNRDFGTPRPNELMVTLNGMSFEA 293

Query: 431 X---XXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALG-YYVMNCPDSD 486
                        +  ALLD+G+T T+ P D+ N LA++ N +Y        +  C    
Sbjct: 294 TDGNVTQILNATSKFPALLDTGSTDTHLPVDVYNALAESTNGTYDQTQNKIRIPKCLSKK 353

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDD 546
           D T + F  GG +I       V     GKC + + P   + AILGD  + +AY+V++L+D
Sbjct: 354 DKTILNFSLGGVNIGVPYKEMV-KKIKGKCYINVAPTGSDFAILGDDVIRYAYMVFDLED 412

Query: 547 LEISMAQANY-DNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSG 592
            EIS+AQA++ D   EDIEV+ ST+P A +A  YS TYS + ++ S 
Sbjct: 413 REISLAQASFNDTLPEDIEVVVSTIPGATRASAYSETYSPTFAVPSA 459

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 87  NLIKR-NDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNS 145
           +L KR +D Y  +Q+ N+Q FY V + IG+  Q++T+LVDTGSSD WV G+ NPYCKSN 
Sbjct: 27  SLAKRADDDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNR 86

Query: 146 GK 147
           GK
Sbjct: 87  GK 88

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  212 bits (539), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 196/333 (58%), Gaps = 7/333 (2%)

Query: 265 TYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNS 324
           +YG F  +DS++ + N T F+ +YAD + A GEW  D +   D   V+ ++FAV N T+S
Sbjct: 108 SYGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGD-TTVSNVTFAVVNDTDS 166

Query: 325 TVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNV 384
             GVLG+GL  LE TY+    S  PY YDNFP+ L   G I  + YSLYLNK +A +GNV
Sbjct: 167 NFGVLGLGLTGLEATYTNALSS--PYQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNV 224

Query: 385 LFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVA 444
           LFGAVDH++Y G TL+T+P VN   S GY++ IEF +TL G+              +   
Sbjct: 225 LFGAVDHAKYTG-TLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQTTLTTSKFPV 283

Query: 445 LLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANL 504
           L+DSG T +Y P ++L  +A  I A+YS+    YV+ CP  DD+T I ++FGGF+I+  L
Sbjct: 284 LVDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSEDDDTVISYNFGGFNIDTPL 343

Query: 505 TNFV--LSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNED 562
           +  V  L   S  C+L + P       LGD FL + Y         +S+AQA Y +  E 
Sbjct: 344 SGSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLAQAQYTDEEE- 402

Query: 563 IEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNI 595
           IE+I+S++P A+KA GYS  +S S    + GN+
Sbjct: 403 IEIISSSIPGAIKAAGYSDIWSASAKNSTSGNV 435

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 46/61 (75%)

Query: 78  DLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           D   SK  ++ IKR++ YE++++ N+  FYS++L IG+  Q++TVLVDTGSSDLWV G D
Sbjct: 45  DTAVSKRSMSHIKRSENYEQVRLKNEACFYSMDLAIGSNHQNVTVLVDTGSSDLWVPGPD 104

Query: 138 N 138
           +
Sbjct: 105 S 105

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  209 bits (532), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 184/310 (59%), Gaps = 17/310 (5%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTS-FAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFA 317
           +TI+C ++ TF+   SS+F++  TS F   Y+D ++A G W  + LT  +G++V+ L F 
Sbjct: 115 STIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWATEKLTM-NGVDVSSLQFG 173

Query: 318 VANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
           + N   + V GVLGIG P+ E      Y +     Y NFP VLKN G I    YS++LNK
Sbjct: 174 LGNCVTTPVSGVLGIGFPRRESVKG--YDNAPNEFYPNFPQVLKNQGIIDVVAYSMFLNK 231

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVN--GDSSSGYSTPIEFDITLQGLGXX--XXX 432
             +  G++LFGA+D S+Y GD L T P++N   D +     P    + LQGLG       
Sbjct: 232 LESDTGSILFGAIDTSKYTGD-LVTFPMLNIYPDVT---DKPATLMVILQGLGAQDNANC 287

Query: 433 XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDD--NTQ 490
                   +I  LLDSGTTL   PK++ +++A  +NA++S+  G Y+M CP  +   NT 
Sbjct: 288 KAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTD 347

Query: 491 IVFDFGGFHINANLTNFVLSSAS--GKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLE 548
            +FDFGG  I   L+NF+LS+ S  G C   +LP + N+ +LGD+FL+ AYVV++LD+ +
Sbjct: 348 YIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNTMVLGDIFLSSAYVVFDLDNYQ 407

Query: 549 ISMAQANYDN 558
           IS+A AN DN
Sbjct: 408 ISLAAANLDN 417

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 3/57 (5%)

Query: 90  KRNDGYEEIQIINQ---QSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           KRN G   ++I  Q   Q++Y+  L IGTP Q++TVL D+GSSDLWV  + NPYC+S
Sbjct: 42  KRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYCES 98

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  196 bits (499), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/307 (38%), Positives = 179/307 (58%), Gaps = 10/307 (3%)

Query: 280 NKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVT 339
           N T F   Y D +Y  G +G DV++  + + +   SF VAN T +  G+LGI LP  E T
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGN-ITLESFSFGVANNTENQGGILGISLPAGENT 59

Query: 340 YS--GVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGD 397
           +S  G Y +T P+ Y+NFP+ LK+ G I K  YSL+LN+  A  G++LFGAVD S+Y G 
Sbjct: 60  HSLGGAYNTT-PFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQ 118

Query: 398 TLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX-XXXXXXXXXQIVALLDSGTTLTYFP 456
            LYT+P++    +    +P  F +T Q +               +   L DSGTT +  P
Sbjct: 119 -LYTLPMLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLP 176

Query: 457 KDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKC 516
            ++ + + K+ +  YS     Y  +C    D T +  DFGGF+I+AN++NFV  +    C
Sbjct: 177 TEVAHAIGKSFDGKYSSGDQGYTFDCSKVKD-TLLSIDFGGFNISANISNFVTRTKD-HC 234

Query: 517 VLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKA 576
           +L +   + +  +LGD FL  AYVV++L+  E+S+AQA++D+  E+IEVI+  VP A++A
Sbjct: 235 LLNIEAAD-SGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRA 293

Query: 577 PGYSYTY 583
           PGYS T+
Sbjct: 294 PGYSSTW 300

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  201 bits (511), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 190/340 (55%), Gaps = 23/340 (6%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C     F++  S++  SN T F  ++ D ++A+G W +D +     + +   +F VA +T
Sbjct: 166 CYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVG-SIIIEKFNFGVAQET 224

Query: 323 NSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNG 382
           N+T+G LG+GL   E+T  G Y     Y Y+NFP  LKNSG I + +YS+Y  K + ++G
Sbjct: 225 NATIGSLGLGLEGNEITNEGDY----TYTYENFPTKLKNSGMIKRVIYSIYAGKIDTEDG 280

Query: 383 NVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQI 442
           ++LFGAV+HS+Y GDTLYT+PLVN +++S  S P+EF +TLQ L              + 
Sbjct: 281 SLLFGAVEHSRYVGDTLYTLPLVNVNNAS--SDPVEFHVTLQNLVVSVNKTNTTIMSDRY 338

Query: 443 VALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINA 502
            ALL++G  +TY P  + +   K      S++  YY M   D        +DFGGF I +
Sbjct: 339 AALLNTGAIVTYLPTHLFSDFIK--KTGLSESQKYYGMYVTDCSSEISFSYDFGGFKIES 396

Query: 503 NLTNFVL-----SSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQAN-- 555
           +L +++           KC + +  ++    +LG  F + AYVV++L+ LE+S+AQA   
Sbjct: 397 SLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQAAHV 456

Query: 556 YDN-------SNEDIEVITSTVPNAVKAPGYSYTYSTSKS 588
           YDN        N D+E++  ++P+A KA  YS T++  ++
Sbjct: 457 YDNFTYSNIEDNPDVEIVIDSIPSATKAASYSNTWTFDRA 496

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 61/121 (50%), Gaps = 9/121 (7%)

Query: 37  VNSNFLKLGFEKFYADSINDIVIEYD-----NDTDDYRLQKRDSIIDLKESKPYV--NLI 89
           +  +FL L  ++F   +++++++  +     N  + +  Q +  +++L+  +  V    I
Sbjct: 24  LKQDFLLLVLQEFSKMNLHNVILALNLLFSLNKCNAFPRQSKSGLLELELKRMPVEEKFI 83

Query: 90  KRNDGYEEIQIINQ--QSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGK 147
           KR+    E+ + N+      +V + IG   Q++  + DTG SD WV G ++ YC   +G 
Sbjct: 84  KRDGSARELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYCDIENGT 143

Query: 148 S 148
           +
Sbjct: 144 T 144

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  194 bits (493), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 192/338 (56%), Gaps = 16/338 (4%)

Query: 249 YQTMSLDPSQAT--INCDTYGTFDIEDSSTFQS-NKTSFAIRYADTSYATGEWGRDVLTF 305
           YQ  + + S+ T  ++C +  T++   SST+Q  +   F I YAD +++ G WG++ ++ 
Sbjct: 88  YQNATYNGSKITPSVDCSSMSTYNENSSSTYQDLDNGRFYIIYADETFSDGSWGKETVSV 147

Query: 306 SDGLNVTGLSFAVANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGA 364
            +G+++  + F +A    + V GVLGIG P+ E      Y+      Y NFP +LK+   
Sbjct: 148 -NGIDIPDIQFGLAKYATTPVSGVLGIGFPRRESVKG--YEGAPDKYYPNFPQLLKSEQI 204

Query: 365 IHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQ 424
           I    YSL+LN  ++  G+++FGA+D S++ GD L T P+VN +  +    P    +T+Q
Sbjct: 205 IDVVAYSLFLNSPDSGMGSIVFGAIDESKFYGD-LLTFPMVN-EYPTIVDAPATLAMTIQ 262

Query: 425 GLGXXXXX--XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC 482
           GLG               +   LLDSGT+L   PK + + +A  +NASYS   G Y++NC
Sbjct: 263 GLGAQNKSGCERETFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNC 322

Query: 483 PDSDDNTQIVFDFGGFHINANLTNFVLSS--ASGKCVLGLLPYNGNSAILGDMFLTHAYV 540
           PDS D+ +  FDFG   IN  LT+ +LS     G C   + P N +S +LGD+FL+ AYV
Sbjct: 323 PDSADDIEYTFDFGDLQINVPLTSLILSPEVEGGYCGFAVQPTN-DSMVLGDVFLSSAYV 381

Query: 541 VYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPG 578
           V++LD+ +IS+AQAN++ S +  +VI   +P     PG
Sbjct: 382 VFDLDNYKISLAQANWNASEDSKQVI--NIPTDGSIPG 417

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 92  NDGYEEIQI---INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKS 148
           NDG   +++     +Q +Y+  L IGTP+Q +TVL DTGS+D WV  S NP+C   S  S
Sbjct: 27  NDGSGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSNPS 86

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  193 bits (490), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 186/331 (56%), Gaps = 12/331 (3%)

Query: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320
           ++CD  G FD   S +  +   +F+ +Y D SY+ G W  D ++ +D   V  L FAVAN
Sbjct: 116 LDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQ-QVPDLQFAVAN 174

Query: 321 QTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAK 380
            +++  GVLG+GLP+LE      Y       YDNFP  LK++  I++ +YSLY +  + +
Sbjct: 175 ISSAPSGVLGVGLPRLEAVRG--YDGAPNANYDNFPQTLKSNRLINRVLYSLYFDSGDLE 232

Query: 381 NGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXX--XXXX 438
           +G VLFG +D  +Y+G  LYT+PLVN         P  FDITLQGLG             
Sbjct: 233 SGTVLFGGIDEKKYDG-VLYTLPLVN--IYEQIDEPAAFDITLQGLGIRSESNCKDTVIA 289

Query: 439 XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGF 498
             +  ALLDSG+T+   P++ L  +A+ + A++S++ G YV++CP S+D+    FDFG  
Sbjct: 290 HKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTFYFDFGEL 349

Query: 499 HINANLTNFVLSSASGKCVLGL-LPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYD 557
            +   + + +    SG+   GL +  +G   ILGD+ L  AYVVY+LD+LEIS+AQ    
Sbjct: 350 KLKVPIHDLLYLPESGQNYCGLAIIASGEEWILGDLVLKSAYVVYDLDNLEISIAQVK-T 408

Query: 558 NSNEDIEVITST--VPNAVKAPGYSYTYSTS 586
            S   I+ +++T  +P   K+    ++ S S
Sbjct: 409 TSGSRIQTVSATGSLPQTRKSNSTPWSLSGS 439

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (56%), Gaps = 11/92 (11%)

Query: 54  INDIVIEYDNDTDDYRLQKRDSIIDLKESKPY-VNLIKRNDGYEEIQIINQQSFYSVNLR 112
           IN   IE+D+D+          +I L+  KP   +L KR+  +E  ++  Q  FY+V L 
Sbjct: 16  INCRQIEFDHDS---------KVIQLQLLKPADRSLQKRSKSFES-KLNPQDYFYTVELG 65

Query: 113 IGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           +GTP+Q I  + DTGSSDLWV    NP+C  N
Sbjct: 66  VGTPSQKINCIFDTGSSDLWVPAKSNPFCLGN 97

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  187 bits (475), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 186/345 (53%), Gaps = 19/345 (5%)

Query: 260 TINCDTYGTFDIEDSSTFQS-NKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
           TI+C      D+  SS F+  N   F I Y D S+  G W  D ++ + G +++GL F V
Sbjct: 103 TIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVS-AAGAHISGLQFGV 161

Query: 319 ANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           A   +  + G+LG+G P+ E      Y       YDNFP +LK  G I    YS+YLN  
Sbjct: 162 AQYASEEIPGILGLGFPRRESVRG--YPGAPNKFYDNFPQMLKKDGIIDVVAYSMYLNDP 219

Query: 378 NAKNG-NVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
           N   G +VLFG VD S+Y GD LYT P+ N    +  S P    +TLQG G         
Sbjct: 220 NGSGGGSVLFGGVDPSKYSGD-LYTFPMAN-QYPNIVSKPATLAVTLQGFGAQKKSEGRQ 277

Query: 437 XX--XXQIVALLDSGTTLTYFPKDMLNLLAKTIN--ASYSDALGYYVMNCPDSDDNTQIV 492
                     LLDSGT+L   P+++++ +A  IN  A +S+  G YVM+CP  DD+T+ V
Sbjct: 278 ETFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEFV 337

Query: 493 FDFGGFHINANLTNFVL-SSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
           FDFG   I   ++  +L  S    C LG+LP +G +  LGD+FL++AY+V++LD+ ++SM
Sbjct: 338 FDFGDLQIAVPVSTLILPPSGESYCGLGVLPKDG-TWTLGDVFLSYAYLVFDLDNYKVSM 396

Query: 552 AQANYDNSNE---DIEVIT-STVPNAVKAPGYSYTYSTSKSIVSG 592
           A+A +    +    I++ T  T+P A  A    ++ S+  S VSG
Sbjct: 397 AKAKFSGDGDQSPQIKIQTDGTIPGAKSASAKPWS-SSEPSTVSG 440

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 2/47 (4%)

Query: 106 FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN--SGKSTN 150
           FYS  L IG+PAQ + ++VD+GS+D WV  S NP+C SN  SG S N
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKN 92

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  186 bits (471), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/303 (38%), Positives = 172/303 (56%), Gaps = 12/303 (3%)

Query: 261 INCDTYGTFDIEDSSTFQS-NKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           I+C   GTFD   SS+F+  +   F I+Y+D S+A G W ++ L   +G++++ L F VA
Sbjct: 122 IDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRL-NGIDISTLQFGVA 180

Query: 320 NQTNSTVG-VLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
           +     VG VLGIG P+ E      Y       Y NFP VLKN G I  + YS++LN+ +
Sbjct: 181 DYATVPVGGVLGIGFPRRESVKG--YDDAPNEFYPNFPQVLKNEGVIGVAAYSMFLNEVS 238

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX--XXXXXXX 436
           +  G++LFGAVD ++Y G +LYT P+VN +  +    P    +TLQ LG           
Sbjct: 239 SDAGSILFGAVDPTKYTG-SLYTFPMVN-EYPNVVDKPATLAMTLQALGAKSDSSCKYKT 296

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLA-KTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
               +   LLDSGTTL   P ++   +A      +Y+++ G +  +CP  DD+T+ +FDF
Sbjct: 297 FTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDF 356

Query: 496 GGFHINANLTNFVLSSAS-GKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           G   I   L + V+SS+  G C  GL P +  S  LG +FL+ AYVVY+LD+ +IS+AQA
Sbjct: 357 GDLKITLPLASLVISSSGDGHCGFGLTPAS-YSMTLGAIFLSSAYVVYDLDNYQISIAQA 415

Query: 555 NYD 557
            +D
Sbjct: 416 KWD 418

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 87  NLIKRNDGYEEIQIINQQS----FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCK 142
           NL KR     +   I+ Q     +YS  L IGT  Q + VL D+GSSD+WV+ S NPYC 
Sbjct: 44  NLSKRKLQRRKSTEIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYCL 103

Query: 143 SNSG 146
            + G
Sbjct: 104 ESEG 107

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  184 bits (466), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 176/323 (54%), Gaps = 19/323 (5%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C +  T++ + SSTF      F I Y +T ++ G W +D L   +  +V+GL F V+N +
Sbjct: 110 CSSSRTYNFQRSSTFTPTGYKFFIDYVNT-FSRGIWAKDRLVIGNA-DVSGLQFGVSNIS 167

Query: 323 NSTV-GVLGIGLPQLEVT--YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNA 379
           N+T+ G+LG+G  +LE    YSG    T    Y N P++LK SG I K  YS++LN  N+
Sbjct: 168 NTTINGILGVGYERLESVKGYSGAPNRT----YPNLPMLLKESGKIDKVAYSVFLNHLNS 223

Query: 380 KNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX--XXXXXXX 437
               V FG VD  +Y GD LY  PLVN   S     P +F ITLQ L             
Sbjct: 224 NVSTVTFGGVDSEKYTGD-LYKFPLVNIYKS--IPRPSKFHITLQALEVHGNYSSLNKTV 280

Query: 438 XXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG 497
               + AL D+GT     P ++   +A TI+A++ +    Y+  CP  +D+T++VFDFG 
Sbjct: 281 SNTPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLFACPAEEDDTKLVFDFGD 340

Query: 498 FHINANLTNFVLSSA---SGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
             I A L NF++ +A   + +C + ++P +G +  LG  FL   YVVYNL+D E+++AQA
Sbjct: 341 IQIEAPLANFIVPAAELGTEQCGVAIIPEDG-TFTLGIPFLRSTYVVYNLEDYEVALAQA 399

Query: 555 NYD-NSNEDIEVITSTVPNAVKA 576
           N+  +    I  I S +P A +A
Sbjct: 400 NWKWDGKSKITPIISNIPGATQA 422

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 92  NDGYE--EIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSN 144
           NDG +   + +IN    Y   + +GTP Q + VL DTGS+DLW   SDN YC ++
Sbjct: 35  NDGEKCFSMDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAAS 89

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  184 bits (466), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 176/306 (57%), Gaps = 12/306 (3%)

Query: 260 TINCDTYGTFDIEDSSTFQS-NKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
           +++C +  T+   +SST+Q+ +   F I YAD ++A G WG + ++  DG+ +  + F +
Sbjct: 101 SVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSI-DGIVIPNIQFGL 159

Query: 319 ANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377
           A    + V GVLGIG P+ E      Y+      Y NFP +LK+   I    YSL+LN  
Sbjct: 160 AKYATTPVSGVLGIGFPRRESVKG--YEGAPNKYYPNFPQILKSEQIIDVVAYSLFLNSP 217

Query: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXX-- 435
            +  G+++FGA+D S++ GD L+T P+VN +  +   TP    +T+QGLG          
Sbjct: 218 ESGTGSIIFGAIDESKFSGD-LFTFPMVN-EYPNIVDTPATLAMTIQGLGAQNKNSCEYE 275

Query: 436 XXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDF 495
                +   LLDSGT+L   PK + + +A  +NA+YS   G Y+++CP   D  +  FDF
Sbjct: 276 TFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFADEIEYTFDF 335

Query: 496 GGFHINANLTNFVLS--SASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQ 553
           G   I+  LT+ +LS  +  G C   + P N +S +LGD+FL+ AYVV++LD+ +IS+AQ
Sbjct: 336 GDLKISVPLTSLILSPEAEGGYCGFAVQPTN-DSMVLGDVFLSSAYVVFDLDNYKISLAQ 394

Query: 554 ANYDNS 559
           AN+D S
Sbjct: 395 ANWDVS 400

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 3/53 (5%)

Query: 92  NDGYEEIQIINQQS---FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           NDG   ++   Q+    +Y+  L IGTP+Q +TVL DTGS+D W+  S NP+C
Sbjct: 27  NDGTGRLEFSLQRKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFC 79

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  182 bits (463), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 177/308 (57%), Gaps = 12/308 (3%)

Query: 258 QATINCDTYGTFDIEDSSTFQS-NKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           + +I+C +  T++   SST+Q      F I YAD ++A G WG + ++  +G+++  + F
Sbjct: 99  KPSIDCRSMSTYNEHRSSTYQYLENGRFYITYADGTFADGSWGTETVSI-NGIDIPNIQF 157

Query: 317 AVANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
            VA    + V GVLGIG P+ E      Y+      Y NFP +LK+   I    YSL+LN
Sbjct: 158 GVAKYATTPVSGVLGIGFPRRESVKG--YEGAPNEYYPNFPQILKSEKIIDVVAYSLFLN 215

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGX--XXXXX 433
             ++  G+++FGA+D S++ GD L+T P+VN +  +    P    +T+QGLG        
Sbjct: 216 SPDSGTGSIVFGAIDESKFSGD-LFTFPMVN-EYPTIVDAPATLAMTIQGLGAQNKSSCE 273

Query: 434 XXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVF 493
                  +   LLDSGT+L   PK + + +A  +NASYS+  G Y+++CP S  + +  F
Sbjct: 274 HETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNF 333

Query: 494 DFGGFHINANLTNFVLS--SASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISM 551
           DFG   I+  L++ +LS  +    C   + P N +S +LGD+FL+ AYVV++LD+ +IS+
Sbjct: 334 DFGDLQISVPLSSLILSPETEGSYCGFAVQPTN-DSMVLGDVFLSSAYVVFDLDNYKISL 392

Query: 552 AQANYDNS 559
           AQAN++ S
Sbjct: 393 AQANWNAS 400

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 3/61 (4%)

Query: 92  NDGYEEIQIINQQS---FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKS 148
           NDG   ++ + Q     +Y+  L IGTP+QS+TVL DTGS+D WV  S NP+C  NS  S
Sbjct: 27  NDGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTS 86

Query: 149 T 149
           +
Sbjct: 87  S 87

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  176 bits (445), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 172/311 (55%), Gaps = 14/311 (4%)

Query: 249 YQTMSLDPSQATINCDTYGTFDIEDSSTFQSNK-TSFAIRYADTSYATGEWGRDVLTFSD 307
           Y   S  P +  I+C     +D++ S TF   K  +F I YADT+Y +G W  D++T  +
Sbjct: 88  YNKGSGKPPKCLIDCSGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPE 147

Query: 308 GLNVTGLSFAVANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIH 366
           G ++  L F +A  TN+T  GVLGIG P +E + +G Y+      Y NFPL LKN+G  +
Sbjct: 148 G-HLKDLQFGMAFATNATFSGVLGIGFPAME-SVNG-YEFAPGKFYPNFPLALKNAGFTN 204

Query: 367 KSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426
            + YS+  N + +K G++LFG++D S++ G  LYT P++N +       P    +TL G+
Sbjct: 205 IAAYSIEYNDE-SKKGSILFGSIDTSRFIGP-LYTFPMIN-EFPGIADEPSTLSLTLDGI 261

Query: 427 GXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD 486
           G             ++ ALLD+G+TL   P  +   +A  +NA++SD  G +V+ CP  D
Sbjct: 262 GIDGSCEQWVISNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDD 321

Query: 487 --DNTQIVFDFGGFHINANLTNFVL---SSASGKCVLGLLPYNGNSAILGDMFLTHAYVV 541
               T + F FG  H+   L +F+L     ++G C LG+    G   ILGD FLTH Y V
Sbjct: 322 FLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLCGLGITSSKGR-VILGDSFLTHVYTV 380

Query: 542 YNLDDLEISMA 552
           ++LD+  IS+A
Sbjct: 381 FDLDNYMISLA 391

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 106 FYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC-KSNSGKSTNLL 152
           +Y   L  GTP QSI +++DTGSSDLWVT   NP C    SGK    L
Sbjct: 52  YYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCL 99

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  175 bits (443), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 181/331 (54%), Gaps = 18/331 (5%)

Query: 260 TINCDTYGTFDIEDSSTFQS---NKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316
           TI+C  +  ++ E SST+Q    + + F ++Y D S+  G W ++ +   D  N+T L  
Sbjct: 113 TIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQI-DNYNITSLQL 171

Query: 317 AVANQTNSTVG-VLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN 375
           AVAN   + VG +LGI  P+ E +  G   +   Y Y NFP VLKN   I   +YS+YLN
Sbjct: 172 AVANYATTPVGGLLGISFPRRE-SVKGYDGALNEY-YPNFPQVLKNENIIDIVLYSMYLN 229

Query: 376 KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXX---X 432
             N ++G++LFGA+D S++EGD + T P+VN    +    P    +T+QG+         
Sbjct: 230 DLN-QDGSLLFGAIDTSKFEGD-MITYPMVNV-YPNVVDKPATLALTIQGVAAQNTNDCT 286

Query: 433 XXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD--DNTQ 490
                   +   LLDSGTTL   PK++ + +A  +NA+YS+    Y++NCP  +  ++ +
Sbjct: 287 QNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVLNDIE 346

Query: 491 IVFDFGGFHINANLTNFVLSS--ASGKCVLGLLP-YNGNSAILGDMFLTHAYVVYNLDDL 547
            +FDFGG  +   L  F+L S   SG C  G+LP    +  +LGD+FL+  Y V++LD  
Sbjct: 347 YIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHY 406

Query: 548 EISMAQANYDNSNEDIEVITSTVPNAVKAPG 578
           +IS+A  N + ++E  E     +P+    PG
Sbjct: 407 QISLANINKNANSESNEDSIINIPSNGAIPG 437

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 51/74 (68%), Gaps = 4/74 (5%)

Query: 82  SKPYVNLI-KRND--GYEEIQIIN-QQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           S+P  N I KRND  G+  +++ + QQ++Y+  L++GTP Q+ITVL+D+GSSD W+  S 
Sbjct: 27  SRPLSNRINKRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSK 86

Query: 138 NPYCKSNSGKSTNL 151
           NP+C  N   ST +
Sbjct: 87  NPFCMENYCNSTEI 100

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  169 bits (429), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/360 (32%), Positives = 179/360 (49%), Gaps = 19/360 (5%)

Query: 230 WNPFGWXXXXXXXXXXXXXYQTMSLDPSQATINCDTYGTFDIEDSSTFQS-NKTSFAIRY 288
           +NPF               Y   ++ P    ++C    T++   S++FQ  N   F I Y
Sbjct: 87  YNPFCLSSSNITANGLKTLYDGKAIIPK---VDCSQIKTYNANRSTSFQELNNGRFYIIY 143

Query: 289 ADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVG-VLGIGLPQLEVTYSGVYQST 347
            D ++A G WG +   F  G+ +  + F +A+   + +G VLGIG  + E      Y + 
Sbjct: 144 GDKTFADGIWGTETFEFG-GVKIPNVQFGLADYATTPIGGVLGIGFQRRESVKG--YTNA 200

Query: 348 KPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNG 407
               Y NFP VLKN G I    YSL L     ++ +++FGA+D + Y GD + T P++N 
Sbjct: 201 PEVFYPNFPQVLKNEGIIDTVAYSLSL----GQSSHIMFGAIDRNSYIGD-MVTFPMINM 255

Query: 408 DSSSGYSTPIEFDITLQGLGX--XXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAK 465
             ++  S P    IT+QGLG               +  ALLDSG+TL   P ++ + +A 
Sbjct: 256 FPNA-VSKPATLSITIQGLGAQNKQECKFQTFSTTKYPALLDSGSTLISAPVEIADKMAA 314

Query: 466 TINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGL-LPYN 524
            I A +S++ G Y + CP+   N   +FDFG       L+N +L S  G  V G  L  +
Sbjct: 315 FIGAQWSESDGIYTLECPNDTTNIDYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGLQRS 374

Query: 525 GNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITS--TVPNAVKAPGYSYT 582
            N  +LGD+FL    VV++LD  +IS+A++N  +S EDI  I S   +P A+ A   ++T
Sbjct: 375 DNEIVLGDVFLCSTLVVFDLDHYQISLAKSNQKSSAEDIVNIPSDGKIPGAIIAKAEAWT 434

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSG 146
            L KRN    ++Q    +SFY+  L+IG P Q ITV+ D+GS+D WV    NP+C S+S 
Sbjct: 38  QLAKRNHLKFDLQF-EDESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSSN 96

Query: 147 KSTNLL 152
            + N L
Sbjct: 97  ITANGL 102

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  166 bits (420), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 114/330 (34%), Positives = 170/330 (51%), Gaps = 24/330 (7%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           +I+C    TF  E S+T +     F I YADT +  G W  D L    G +V+G+ F V 
Sbjct: 98  SIDCRGIKTFCNESSTTLRILPNPFYIDYADT-FVDGSWATDRLVIG-GHDVSGMKFGVG 155

Query: 320 NQTNSTV-GVLGIGLPQLEVT--YSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
             +N+ + GVLG+G   LE    Y+G   +T    Y N P  LK  G++ K  YS+ L K
Sbjct: 156 RTSNTELSGVLGVGHANLESVRGYAGAPNAT----YPNLPRQLKLDGSVQKLAYSVSLQK 211

Query: 377 QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
            + ++G +LFGA+D S+Y G  L+T P++N D     ++P  F I LQG+          
Sbjct: 212 TSERDGEILFGAIDTSKYVGK-LHTFPILNIDPH--LNSPSNFYIALQGIDIQGGRSSTG 268

Query: 437 XXX--XQIVALLDSGT---TLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQI 491
                    ALLD+GT    ++   +D    +   +NA+Y      +V+ CP  DD  Q 
Sbjct: 269 RPLINSSFHALLDTGTGGMVVSSLAED----IGAALNATYDTEQCVFVIQCPTEDDTRQF 324

Query: 492 VFDFGGFHINANLTNFVLSSA---SGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLE 548
            F+FG   I   ++NFV+ ++   +G+C L ++P    +  LG  FL   Y V+NL+D E
Sbjct: 325 NFNFGELQIAVPISNFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNE 384

Query: 549 ISMAQANYDNSNEDIEVITSTVPNAVKAPG 578
           ISMA+AN +    DI  I + VP A++  G
Sbjct: 385 ISMARANTNPQEPDIRPIPAGVPAAIRDSG 414

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 93  DGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           DG+  + + +    Y + + +GTP Q +  ++DTGS+DLW+   +NP+C
Sbjct: 32  DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFC 80

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  159 bits (401), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 116/334 (34%), Positives = 172/334 (51%), Gaps = 28/334 (8%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGL-NVTGLSFAVANQ 321
           C     F  EDSS+F  N   F ++Y D SYA G W +D  TFS G  +   ++ A+ ++
Sbjct: 142 CKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQD--TFSFGYPSFYNVNIALVSE 199

Query: 322 TNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKN 381
           TN TVG LG+GL   + T  G      P++Y++    LK  G I K  YS+Y ++ N   
Sbjct: 200 TNLTVGSLGLGLRANQATNQG----DDPFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTG 255

Query: 382 GNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQ 441
           G + FG + H  Y+G+ LYT+PLVN D       P  F ITLQ L              +
Sbjct: 256 GGIFFGGLYHDLYKGNVLYTLPLVNVDPE--LDEPARFHITLQNLTTSINGTNFSVLSEK 313

Query: 442 IVALLDSGTTLTYFPKDMLNLLAKTIN----ASYSDALGYYVMNCPDSDDNTQIVFDFGG 497
             ALL +G+  TY P+++ +     ++    A + D    YV+ C   D N   ++DFGG
Sbjct: 314 YPALLSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDL---YVIPC---DTNATFIYDFGG 367

Query: 498 FHINANLTNFVLSSASGK-----CVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
           F I   L+ +     S +     C + + P+N +   LG+ F    YV++NL+DLEISMA
Sbjct: 368 FEIETPLSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEISMA 427

Query: 553 QAN---YDNSNEDIEVITSTVPNAVKAPGYSYTY 583
            A+   Y ++  D E I S++P+A +A  YS T+
Sbjct: 428 PASGIEYLDA-FDYEYIESSIPSASRAASYSNTW 460

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 28/36 (77%)

Query: 111 LRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSG 146
           + +GTP+Q+I  L+DT SSD+W+  S++ +C+S +G
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCESENG 117

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  146 bits (369), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/228 (37%), Positives = 133/228 (58%), Gaps = 6/228 (2%)

Query: 357 LVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTP 416
           + LK+ G I K  YSL+LN+  A  G++LFGAVD S+Y G  LYT+P++    +    +P
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQ-LYTLPMLQAYDTLDSVSP 59

Query: 417 IEFDITLQGLGXXXX-XXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDAL 475
             F +T Q +               +   L DSGTT +  P ++ + + K+ +  YS   
Sbjct: 60  GMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGD 118

Query: 476 GYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFL 535
             Y  +C    D T +  DFGGF+I+AN++NFV +     C+L +   + +  +LGD FL
Sbjct: 119 QGYTFDCSKVKD-TLLSIDFGGFNISANISNFV-TRTKDHCLLNIEAAD-SGFVLGDAFL 175

Query: 536 THAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTY 583
             AYVV++L+  E+S+AQA++D+  E+IEVI+  VP A++APGYS T+
Sbjct: 176 VDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 223

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 119/213 (55%), Gaps = 7/213 (3%)

Query: 347 TKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVN 406
           T PY+YDNFP+ LK  G I K  YSL+LN+ NA+ G++LFGAVD S+Y G  LYT+P++ 
Sbjct: 18  TTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYSGQ-LYTLPMLK 76

Query: 407 G----DSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNL 462
                DSS+G     +    L                 Q   L DSGT+ +  P ++ + 
Sbjct: 77  AYNTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLFDSGTSTSALPTEIADA 136

Query: 463 LAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLP 522
           + ++ +  YS     Y+ +C    +NT +  DFGGF+I+AN++N V       C+L  + 
Sbjct: 137 IGRSFDGKYSSDNQGYIFDCSKV-NNTLLSIDFGGFNISANISNSVTPITKDHCLLN-IE 194

Query: 523 YNGNSAILGDMFLTHAYVVYNLDDLEISMAQAN 555
            + +  +LGD FL   YVV++L+  E+S+AQA+
Sbjct: 195 ADDSGYVLGDAFLIDTYVVFDLESHEVSVAQAS 227

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score =  109 bits (272), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 92/150 (61%), Gaps = 5/150 (3%)

Query: 421 ITLQGLGXXXXXXXXXXX--XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYY 478
           +T+QGLG               +   LLDSGT+L   PK + + +A  +NASYS   G Y
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIY 60

Query: 479 VMNCPDSDDNTQIVFDFGGFHINANLTNFVLS--SASGKCVLGLLPYNGNSAILGDMFLT 536
           +++CP+S  + +  FDFG   IN  LT+ +LS  +  G C   + P N +S +LGD+FL+
Sbjct: 61  ILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTN-DSMVLGDVFLS 119

Query: 537 HAYVVYNLDDLEISMAQANYDNSNEDIEVI 566
            AYVV++LD+ +IS+AQAN++ SN+  +++
Sbjct: 120 SAYVVFDLDNYKISLAQANWNASNDSKQLV 149

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 93/155 (60%), Gaps = 5/155 (3%)

Query: 416 PIEFDITLQGLGX--XXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSD 473
           P    +T+QGLG               +   LLDSGT+L   PK + + +A  +NASYS 
Sbjct: 206 PATLAMTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSA 265

Query: 474 ALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLS--SASGKCVLGLLPYNGNSAILG 531
             G Y+++CP+S  + +  FDFG   IN  LT+ +LS  +  G C   + P N +S +LG
Sbjct: 266 DEGIYILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTN-DSMVLG 324

Query: 532 DMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVI 566
           D+FL+ AYVV++LD+ +IS+AQAN++ SN+  +++
Sbjct: 325 DVFLSSAYVVFDLDNYKISLAQANWNASNDSKQLV 359

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  107 bits (266), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 98/330 (29%), Positives = 157/330 (47%), Gaps = 33/330 (10%)

Query: 261 INCDTYGTFDIEDSSTFQS--NKTSFAIRYADTSYATGEWGRDVLT----FSDGLNVTGL 314
           I+C  +  F+  +S TF +    + F I Y D SY  G+WG D ++    +SD    TGL
Sbjct: 70  IDCTGFTFFNKSNSKTFSNIYKNSIFQIGYQDASYTFGKWGVDSISINSSYSDSNEDTGL 129

Query: 315 -------SFAVANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIH 366
                   FA+A  +N  V  VLG+G P+ E   +G   +T  + Y N P ++K  G   
Sbjct: 130 YANIPNAQFAIATNSNVPVQAVLGLGFPRREAV-NGYKLATNKF-YPNLPQLIKQHGYSD 187

Query: 367 KSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426
               ++YL      N  ++FGA D ++Y GD L+  P+VN    +    P  F ITL  +
Sbjct: 188 NVTIAMYLGSNETYNS-IMFGAYDKTRYIGD-LHNFPMVN-QYPNVTDKPATFAITLDSM 244

Query: 427 ----GXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC 482
                             +   +LDSGT+L   P   ++ +A  +NA++ +    Y++  
Sbjct: 245 YISMDNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLL-- 302

Query: 483 PDSDDNTQ-----IVFDFGGFHINANLTNFVLSSASGKCVLGLLP-YNGNSA-ILGDMFL 535
           P   D T      I F F  F++  N+  F+L       V  +LP  N N+  +LGD+FL
Sbjct: 303 PSETDLTLYKDMIINFKFMDFNVPINMLEFILP-YDDSYVFAILPTKNVNTGFVLGDIFL 361

Query: 536 THAYVVYNLDDLEISMAQANYDNSNEDIEV 565
            H Y ++NLD+  IS+  +N + ++ + E+
Sbjct: 362 PHVYTIFNLDNYTISLGLSNQNITSNEREI 391

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query: 105 SFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           S+Y  N+ IG P Q+I VLVDTGSSDLWV   +NP C
Sbjct: 29  SYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNC 65

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 117/225 (52%), Gaps = 7/225 (3%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           +INC  +GT+  + SST         I+Y D S+A GEW  D LT     ++  + F ++
Sbjct: 111 SINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGP-YDLQSVQFGIS 169

Query: 320 NQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378
           N  ++ + GVLG+G  + E +  G Y  +   +Y N P  LK+    + + +SL+LN  N
Sbjct: 170 NNASTIISGVLGLGFLRTE-SIDG-YDGSPNKLYYNLPAYLKDQEITNTNAFSLFLNNSN 227

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL-GXXXXXXXXXX 437
             +G VLFG +D+S++ GD L T PLVN       + P  F ITLQ L G          
Sbjct: 228 DASGTVLFGGIDYSKFSGD-LVTFPLVN-IYPKLINEPCTFTITLQQLYGKINGGKSIGL 285

Query: 438 XXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC 482
              ++ ALLDSG++L   P ++ + +A  +N++       + +NC
Sbjct: 286 IKEKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMTSLHNINC 330

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 92  NDGYEEIQI-INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           N  Y E+ I  +   FYS  L  G P Q++TVLVDTGSSDLWV+  +N YC  + GK+TN
Sbjct: 49  NHNYLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCYED-GKNTN 107

Query: 151 L 151
           +
Sbjct: 108 I 108

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 134/311 (43%), Gaps = 44/311 (14%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
            ++ C  +  ++ ++SST+++N ++FAI+Y   S   G   +DV+   D L +T   FA 
Sbjct: 131 GSLACYLHSKYNHDESSTYKANGSAFAIQYGSGSL-EGYISQDVMEIGD-LKITKQDFAE 188

Query: 319 ANQTNSTV-------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYS 371
           A              G+LG+    + V          P +Y+       N G + +  ++
Sbjct: 189 ATSEPGISFAFGKFDGILGLAYDTIAV------NRVVPPVYNAI-----NQGLLDEPKFA 237

Query: 372 LYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGX 428
            YL   +K     G  +FG +D +++EGD  + +P+        Y     +++ L+GLG 
Sbjct: 238 FYLGDASKSKDNGGEAVFGGIDETKFEGDITW-LPV----RRKAY-----WEVKLEGLGL 287

Query: 429 XXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDN 488
                          A +D+GT+L   P  +  ++   I A      G Y + C      
Sbjct: 288 GEEYTELENHG----AAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQYTIECDKRASL 342

Query: 489 TQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVVYN 543
             + F F G++   +  ++ L   SG C+  + P +     G  AI+GD FL   Y VY+
Sbjct: 343 PDMTFTFDGYNFTISPYDYTL-EVSGSCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYD 401

Query: 544 LDDLEISMAQA 554
           L +  + +A A
Sbjct: 402 LGNDAVGLAPA 412

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 69  RLQKRDSIIDLKESKPYVNL----IKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLV 124
           + ++ +  ++     P+  +    + +N G+E        + Y  +++IGTP QS  V++
Sbjct: 57  QYERANPEVEFSREHPFYKISSEIVSKNGGHEVPLSNYMNAQYFADIKIGTPPQSFKVVL 116

Query: 125 DTGSSDLWV 133
           DTGSS+LWV
Sbjct: 117 DTGSSNLWV 125

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 131/314 (41%), Gaps = 50/314 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +  + SS++++N TSFAI+Y   S   G   +D L+          F++ 
Sbjct: 130 GSLACFLHSKYSHDASSSYKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEA 188

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+G   + V          P +Y        N G + + 
Sbjct: 189 TSEPGLAFAFGKFD----GILGLGYDTISV------DKVVPPVYKAI-----NDGLLDEP 233

Query: 369 VYSLYLNKQN---AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YLN  +      G V FG +D S+Y+GD  + +P+              +++   G
Sbjct: 234 RFAFYLNNADDSEESTGEVTFGGIDSSKYKGDITW-LPV---------RRKAYWEVKFDG 283

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS 485
           +G                A +D+GT+L   P  +  +L   I A      G Y ++C   
Sbjct: 284 IGLGDEYAELQGTG----AAIDTGTSLIALPSGLAEVLNSEIGAK-KGWTGQYTVDCESR 338

Query: 486 DDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYV 540
           D    + F F G +      ++ L   SG C+    P +     G  AI+GD FL   Y 
Sbjct: 339 DQLPDLTFTFNGKNFTITAYDYTLE-VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYS 397

Query: 541 VYNLDDLEISMAQA 554
           +Y+L +  + +AQA
Sbjct: 398 IYDLGNNAVGLAQA 411

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 2/33 (6%)

Query: 101 INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWV 133
           +N Q F  ++L  GTP QS  V++DTGSS+LWV
Sbjct: 94  LNAQYFTEISL--GTPPQSFKVILDTGSSNLWV 124

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 130/310 (41%), Gaps = 43/310 (13%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
           +++ C  +  +D + SS+++ N T FAIRY   S   G   +D L   D L++T   FA 
Sbjct: 137 SSLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGS-LEGYISQDTLNLGD-LSITKQDFAE 194

Query: 319 ANQTNSTV-------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYS 371
           A              G+LG+G   + V          P  Y+ +       G + +  ++
Sbjct: 195 ATSEPGLQFAFGKFDGILGLGYDTISV------DGVVPPFYNAW-----KQGLLDEPKFA 243

Query: 372 LYLNK--QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXX 429
            YL +  ++   G   FG VD S+YEG+  + +P+              +++   G+G  
Sbjct: 244 FYLGRDGESQDGGVATFGGVDDSKYEGEITW-LPI---------RRKAYWEVKFDGIGLG 293

Query: 430 XXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNT 489
                         A +D+GT+L   P  +  ++   I A  S   G Y + C       
Sbjct: 294 EEYAELENHG----AAIDTGTSLIALPSGLAEIINAEIGAKKS-WTGQYTVECEARSSLP 348

Query: 490 QIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVVYNL 544
            + F  GG +      +++L   SG+C+  + P +     G  AI+GD FL   Y +Y+L
Sbjct: 349 NMTFTLGGHNFELTAYDYIL-EVSGQCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDL 407

Query: 545 DDLEISMAQA 554
            +  + +A A
Sbjct: 408 GNNAVGLADA 417

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y   + +GTP Q+  V++DTGSS+LWV  ++
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWVPSTE 135

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 136/314 (43%), Gaps = 50/314 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D E SS++++N T FAI+Y  T    G   +D L+          F++ 
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 181

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+G   + V          P  Y+     L     + + 
Sbjct: 182 TSEPGLTFAFGKFD----GILGLGYDTISV------DKVVPPFYNAIQQDL-----LDEK 226

Query: 369 VYSLYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YL   +K     G   FG +D S+++GD  + +P+        Y     +++  +G
Sbjct: 227 RFAFYLGDTSKDTENGGEATFGGIDESKFKGDITW-LPV----RRKAY-----WEVKFEG 276

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS 485
           +G                A +D+GT+L   P  +  ++   I A      G Y ++C   
Sbjct: 277 IGLGDEYAELESHG----AAIDTGTSLITLPSGLAEMINAEIGAK-KGWTGQYTLDCNTR 331

Query: 486 DDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYV 540
           D+   ++F+F G++      ++ L   SG C+  + P +     G  AI+GD FL   Y 
Sbjct: 332 DNLPDLIFNFNGYNFTIGPYDYTL-EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYS 390

Query: 541 VYNLDDLEISMAQA 554
           +Y+L +  + +A+A
Sbjct: 391 IYDLGNNAVGLAKA 404

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWV 133
           Y  ++ +GTP Q+  V++DTGSS+LWV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 133/318 (41%), Gaps = 59/318 (18%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           ++ C  +  +D ++S+T++ N T F I+Y   S   G   RD L   D L +    FA A
Sbjct: 137 SLACYLHSKYDHDESTTYEKNGTKFTIQYGSGS-MDGYISRDTLIIGDDLVIPEQDFAEA 195

Query: 320 NQTNSTV-------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSL 372
                         G+LG+    + V          P  Y+         G + ++ ++ 
Sbjct: 196 TSEPGLAFAFGKFDGILGLAYDTIAV------NKVVPPFYNAI-----KQGILDENKFAF 244

Query: 373 YL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFD--------I 421
           YL   NK N   G   FG  D S++ GD  + +P+        Y   ++FD         
Sbjct: 245 YLGDTNKDNKSGGEATFGGYDKSKFTGDITW-LPV----RRKAYWE-VKFDSIALGDEVA 298

Query: 422 TLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMN 481
           +L G G                A +D+GT+L   P  +  ++   I A  S + G Y ++
Sbjct: 299 SLDGYG----------------AAIDTGTSLITLPSGLAEVINTQIGAKKSWS-GQYTID 341

Query: 482 CPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLT 536
           C   D    + F+F G++   +  ++ L   SG C+  + P +     G  AI+GD FL 
Sbjct: 342 CDTRDALPDMTFNFNGYNFTVSPYDYTLE-MSGSCISAITPMDFPEPVGPLAIIGDAFLR 400

Query: 537 HAYVVYNLDDLEISMAQA 554
             Y +Y+LD+  + +A++
Sbjct: 401 KYYSIYDLDNNAVGLAKS 418

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y  ++ +GTP Q+  V++DTGSS+LWV   D
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWVPSKD 134

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 138/317 (43%), Gaps = 56/317 (17%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D E SS++++N T FAI+Y  T    G   +D L+          F++ 
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 181

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+G   + V          P  Y+     L     + + 
Sbjct: 182 TSEPGLTFAFGKFD----GILGLGYDTISV------DKVVPPFYNAIQQDL-----LDEK 226

Query: 369 VYSLYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YL   +K +   G   FG +D S+++GD  + +P+        Y     +++  +G
Sbjct: 227 KFAFYLGDTSKDSENGGEATFGGIDESKFKGDITW-LPV----RRKAY-----WEVKFEG 276

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGY---YVMNC 482
           +G                A +D+GT+L   P      LA+ INA      G+   Y ++C
Sbjct: 277 IGLGDEYAELEGHG----AAIDTGTSLITLPSG----LAEMINAELGAKKGWTGQYTLDC 328

Query: 483 PDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTH 537
              D    ++F+F G++      ++ L   SG C+  + P +     G  AI+GD FL  
Sbjct: 329 NTRDSLPDLIFNFNGYNFTIGPYDYTL-EVSGSCISAITPMDFPEPVGPLAIVGDAFLRK 387

Query: 538 AYVVYNLDDLEISMAQA 554
            Y +Y+L +  + +A+A
Sbjct: 388 YYSIYDLGNDAVGLAKA 404

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 48  KFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRN----DGYEEIQIINQ 103
           K Y   ++D + E   D     L ++  +   +++ P V   + +    +G  ++ + N 
Sbjct: 28  KIYKHKLSDEMKEVTFDQHLAHLGQK-YLTQFEKANPEVVFSREHPFFTEGGHDVPLTNY 86

Query: 104 -QSFYSVNLRIGTPAQSITVLVDTGSSDLWV 133
             + Y  ++ +GTP Q+  V++DTGSS+LWV
Sbjct: 87  LNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 138/317 (43%), Gaps = 56/317 (17%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D E SS++++N T FAI+Y  T    G   +D L+          F++ 
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 181

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+G   + V          P  Y+     L     + + 
Sbjct: 182 TSEPGLTFAFGKFD----GILGLGYDTISV------DKVVPPFYNAIQQDL-----LDEK 226

Query: 369 VYSLYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YL   +K +   G   FG +D S+++GD  + +P+        Y     +++  +G
Sbjct: 227 KFAFYLGDTSKDSENGGEATFGGIDESKFKGDITW-LPV----RRKAY-----WEVKFEG 276

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGY---YVMNC 482
           +G                A +D+GT+L   P      LA+ INA      G+   Y ++C
Sbjct: 277 IGLGDEYAELESHG----AAIDTGTSLITLPSG----LAEMINAELGAKKGWTGQYTLDC 328

Query: 483 PDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTH 537
              D    ++F+F G++      ++ L   SG C+  + P +     G  AI+GD FL  
Sbjct: 329 NTRDSLPDLIFNFNGYNYTIGPYDYTL-EVSGSCISAITPMDFPEPVGPLAIIGDAFLRK 387

Query: 538 AYVVYNLDDLEISMAQA 554
            Y +Y+L +  + +A+A
Sbjct: 388 YYSIYDLGNNAVGLAKA 404

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 52/103 (50%), Gaps = 6/103 (5%)

Query: 36  SVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRN--- 92
           S+N    K+   K Y   ++D + E   D     L ++  +   +++ P V   + +   
Sbjct: 16  SINPAAAKVHKAKIYKHKLSDEMKEVTFDQHLAHLGQK-YLTQFEKANPEVVFSREHPFF 74

Query: 93  -DGYEEIQIINQ-QSFYSVNLRIGTPAQSITVLVDTGSSDLWV 133
            +G  ++ + N   + Y  ++ +GTP Q+  V++DTGSS+LWV
Sbjct: 75  TEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 133/314 (42%), Gaps = 50/314 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D   SS++++N T F+I+Y   S   G   +D L+          F++ 
Sbjct: 133 GSLACFLHEKYDHSASSSYKANGTDFSIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEA 191

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+    + V          P  Y+     L     + ++
Sbjct: 192 TSEPGLAFAFGKFD----GILGLAYDTISV------DKVVPPFYNALEQDL-----LDEA 236

Query: 369 VYSLYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YL   NK     G  +FG VD S+Y GD  + +P+        Y     +++ L+G
Sbjct: 237 KFAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVTW-LPV----RRKAY-----WEVKLEG 286

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS 485
           LG                A +D+GT+L   P  +  ++   I A      G Y + C   
Sbjct: 287 LGLGDEYAELESHG----AAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQYTLECNTR 341

Query: 486 DDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYV 540
           D    + F+F G++      ++ L   SG C+  + P +     G  AI+GD FL   Y 
Sbjct: 342 DQLPDLTFNFNGYNFTIGPYDYTL-EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYS 400

Query: 541 VYNLDDLEISMAQA 554
           +Y+L+   + +A+A
Sbjct: 401 IYDLEHNAVGLAKA 414

 Score = 37.4 bits (85), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y  ++ +GTP Q   V++DTGSS+LWV  S+
Sbjct: 101 YYTDITLGTPPQQFKVILDTGSSNLWVPSSE 131

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 133/314 (42%), Gaps = 50/314 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +  + SS++++N T+FAI+Y   S   G   +D L+          F++ 
Sbjct: 135 GSLACFLHSKYSHDASSSYKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEA 193

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+G   + V          P +Y        N G + + 
Sbjct: 194 TSEPGLAFAFGKFD----GILGLGYDTIAV------DKVVPPVYKAI-----NDGLLDEP 238

Query: 369 VYSLYLNKQN---AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YLN  +      G V FG +D S+Y+G+  + +P+              +++   G
Sbjct: 239 RFAFYLNNADDSEESTGEVTFGGIDSSKYKGNITW-LPV---------RRKAYWEVKFDG 288

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS 485
           +G                A +D+GT+L   P  +  +L   I A    + G Y ++C   
Sbjct: 289 IGLGDEYAELEGTG----AAIDTGTSLIALPSGLAEVLNAEIGAKKGWS-GQYTVDCESR 343

Query: 486 DDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYV 540
           D    + F F G +   +  ++ L   SG C+    P +     G  AI+GD FL   Y 
Sbjct: 344 DQLPDLTFTFNGKNFTISAYDYTLE-VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYS 402

Query: 541 VYNLDDLEISMAQA 554
           VY+L +  + +AQA
Sbjct: 403 VYDLGNNAVGLAQA 416

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 2/33 (6%)

Query: 101 INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWV 133
           +N Q F  + L  GTP QS  V++DTGSS+LWV
Sbjct: 99  LNAQYFTEITL--GTPPQSFKVILDTGSSNLWV 129

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 135/314 (42%), Gaps = 50/314 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D E SS+++ N T FAI+Y  T    G   +D L+          F++ 
Sbjct: 124 GSLACFLHSKYDHEASSSYKPNGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 182

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+G   + V          P  Y+     L     + + 
Sbjct: 183 TSEPGLTFAFGKFD----GILGLGYDTISV------DKVVPPFYNAIQQDL-----LDEK 227

Query: 369 VYSLYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQG 425
            ++ YL   +K +   G   FG +D S+++GD  + +P+        Y     +++  +G
Sbjct: 228 KFAFYLGDTSKDSENGGEATFGGIDKSKFKGDVTW-LPV----RRKAY-----WEVKFEG 277

Query: 426 LGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDS 485
           +G                A +D+GT+L   P  +  ++   I A    + G Y ++C   
Sbjct: 278 IGLGHEFAELEGHG----AAIDTGTSLITLPSGLAEMINAEIGAKKGWS-GQYALDCNTR 332

Query: 486 DDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYV 540
           D    + F+F G++      ++ L   SG C+  + P +     G  AI+GD FL   Y 
Sbjct: 333 DGLPDLTFNFNGYNFTIGPYDYTL-EVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYS 391

Query: 541 VYNLDDLEISMAQA 554
           +Y+L +  + +A+A
Sbjct: 392 IYDLGNDAVGLAEA 405

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 36  SVNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRN--- 92
           SVN    K+   K Y   + D + E   D     L ++  +   +++ P +   + +   
Sbjct: 17  SVNPAAAKVHKAKIYKHKLTDEMKEVTFDQHLAHLGQK-YLTQFEKANPEIAFSREHPFF 75

Query: 93  -DGYEEIQIINQ-QSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
            +G  ++ + N   + Y  ++ +G P Q+  V++DTGSS+LWV  ++
Sbjct: 76  TEGGHDVPLTNYLNAQYYTDISLGNPPQNFKVILDTGSSNLWVPSTE 122

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 134/313 (42%), Gaps = 49/313 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D + SS++++N +SFAI+Y   S   G   +D L+          F++ 
Sbjct: 123 GSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEA 181

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+    + V          P +Y+       ++G + + 
Sbjct: 182 TSEPGLAFAFGKFD----GILGLAYDSISV------DKVVPPVYNAI-----HNGLLDEP 226

Query: 369 VYSLYLNK--QNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426
            +S YL    ++   G   FG +D S+YEG+  + +P+              +++   G+
Sbjct: 227 KFSFYLGNADKSTDGGEATFGGIDSSKYEGNITW-LPV---------RRKAYWEVKFDGI 276

Query: 427 GXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD 486
           G                A +D+GT+L   P  +  +L   I A    + G Y + C   D
Sbjct: 277 GLGDEYAILDGHG----AAIDTGTSLIALPSGLAEILNAEIGAKKGWS-GQYSVECDTRD 331

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVV 541
               +  +FGG++      ++ L   SG C+    P +     G  AI+GD FL   Y V
Sbjct: 332 SLPDLTLNFGGYNFTITPYDYTL-EVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKHYSV 390

Query: 542 YNLDDLEISMAQA 554
           Y+L +  + +A+A
Sbjct: 391 YDLGNDAVGLAKA 403

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 80  KESKPYVNLIKRNDGYEE-------IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLW 132
           +++ P     K +  Y E          +N Q  Y   + +GTP Q+  V++DTGSS+LW
Sbjct: 59  QKAYPEAEFAKEHQFYAEAGHDVPLTNYLNAQ--YYTEISLGTPPQNFKVILDTGSSNLW 116

Query: 133 VTGSD 137
           V  ++
Sbjct: 117 VPSAE 121

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 70.9 bits (172), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 57/96 (59%), Gaps = 4/96 (4%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C  +GTF   +SSTF+ N T F   Y D +Y  G +G DV++  + + +   SF VAN T
Sbjct: 30  CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGN-ITLESFSFGVANNT 88

Query: 323 NSTVGVLGIGLPQLEVTYS--GVYQSTKPYIYDNFP 356
            +  G+LGI LP  E T+S  G Y +T P+ Y+NFP
Sbjct: 89  ENQGGILGISLPAGENTHSLGGAYNTT-PFEYENFP 123

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 136/313 (43%), Gaps = 50/313 (15%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDGL 309
           ++ C  +  +D + SS++++N T FAI+Y   S   G   +D L           F++  
Sbjct: 125 SLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPKQDFAEAT 183

Query: 310 NVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSV 369
           +  GL+FA         G+LG+    + V          P  Y+         G + +  
Sbjct: 184 SEPGLTFAFGKFD----GILGLAYDTISV------DKVVPPFYNAI-----EQGLLDEKK 228

Query: 370 YSLYLN--KQNAKNG-NVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426
           ++ YL   K++ KNG  +  G +D S+++GD  + +P+        Y     +++  +G+
Sbjct: 229 FAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEW-LPV----RRKAY-----WEVKFEGI 278

Query: 427 GXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD 486
                            A +D+GT+L   P  +  ++   I A      G Y ++C   D
Sbjct: 279 ALGDQYAALENHG----AAIDTGTSLITLPSGLAEIINTEIGAK-KGWTGQYTLDCDTRD 333

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVV 541
               + F+F G +   +  ++ L   SG C+  ++P +     G  AI+GD FL   Y +
Sbjct: 334 GLPDLTFNFNGKNFTISPFDYTLE-VSGSCISAIMPMDFPEPMGPMAIVGDAFLRKYYSI 392

Query: 542 YNLDDLEISMAQA 554
           Y+LD+  + +A+A
Sbjct: 393 YDLDNHAVGLAEA 405

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y  ++ +GTP Q+  V++DTGSS+LWV  S+
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWVPSSE 122

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 134/313 (42%), Gaps = 49/313 (15%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D E SST+++N + FAI+Y   S   G   RD+LT          F++ 
Sbjct: 128 GSLACFLHTKYDHEASSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEA 186

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+    + V          P +Y+     +KN   +   
Sbjct: 187 TSEPGLAFAFGKFD----GILGLAYDSISV------NRIVPPVYN----AIKNK-LLDDP 231

Query: 369 VYSLYL--NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426
           V++ YL  + ++   G   FG +D  +Y G+  + +P+        Y     +++  +G+
Sbjct: 232 VFAFYLGDSDKSEDGGEASFGGIDEEKYTGEITW-LPV----RRKAY-----WEVKFEGI 281

Query: 427 GXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD 486
           G                A +D+GT+L   P  +  +L   I A    + G Y ++C   D
Sbjct: 282 GLGEEYATLEGHG----AAIDTGTSLIALPSGLAEILNAEIGAKKGWS-GQYSVDCESRD 336

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVV 541
               +  +F G++      ++ L   SG C+    P +     G  AI+GD FL   Y +
Sbjct: 337 SLPDLTLNFNGYNFTITAYDYTL-EVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSI 395

Query: 542 YNLDDLEISMAQA 554
           Y++    + +A+A
Sbjct: 396 YDIGHDAVGLAKA 408

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 101 INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           +N Q F  + L  G+P QS  V++DTGSS+LWV  ++
Sbjct: 92  LNAQYFTEITL--GSPPQSFKVILDTGSSNLWVPSAE 126

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 138/304 (45%), Gaps = 42/304 (13%)

Query: 309 LNVTGLSFAVANQTNSTV-GVLGIGLPQLEVTYSGVYQSTKPYIYDN---FPLVLKNSGA 364
           L +   SF +AN+T S V G LG+  P + V  S    S     +D+   F   LKN+G 
Sbjct: 148 LTINSTSFILANETGSLVHGALGLSGP-ISVPASDSVSSLN---FDDSYYFLTHLKNAGV 203

Query: 365 IHKSVYSLYLNKQN----------AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYS 414
           I  S YSL++N  +          A  G +L G+VD   Y+GD +    +   D SSGY 
Sbjct: 204 IETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKDESSGYL 263

Query: 415 T---PIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASY 471
           +   PI     +                      + S    +Y P  ++  ++   NA Y
Sbjct: 264 STGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTNAVY 323

Query: 472 SDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV-----------LSSASGK--CVL 518
            ++L  +++ C   D  + ++F+FG  +I+    +F+           L   +GK  C L
Sbjct: 324 VESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACYL 383

Query: 519 GLLP-YNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDI-------EVITSTV 570
            + P Y  + ++LG  F+ +AY+V+++D+  I++AQA  D + E         ++ +ST+
Sbjct: 384 KMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASDEAVEKAANNSPAKKIESSTI 443

Query: 571 PNAV 574
           P A+
Sbjct: 444 PYAL 447

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 131/311 (42%), Gaps = 44/311 (14%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAV 318
            ++ C  +  +D + SS+++ N T FAIRY  T    G   +D L   D LN+    FA 
Sbjct: 126 GSLACYLHSKYDHDKSSSYKPNGTDFAIRYG-TGSLEGYISQDTLNIGD-LNIPKQDFAE 183

Query: 319 ANQTNSTV-------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYS 371
           A              G+LG+    + V          P  Y+     L     + +  ++
Sbjct: 184 ATSEPGLTFAFGKFDGILGLAYDSISVN------KVVPPFYNAIEQEL-----LDEKKFA 232

Query: 372 LYL---NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGX 428
            YL   NK++   G +  G +D ++++GD  + +P+        Y     +++  +G+G 
Sbjct: 233 FYLGDANKKSEDGGEITIGGIDKTKFKGDIDW-LPV----RRKAY-----WEVKFEGIGL 282

Query: 429 XXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDN 488
                          A +D+GT+L   P  +  ++   I A      G Y + C    + 
Sbjct: 283 GDQFAELENHG----AAIDTGTSLIALPSGLAEIINTEIGAK-KGWTGQYTVECDARPNL 337

Query: 489 TQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVVYN 543
             + F+F G +      ++ L   SG C+  ++P +     G  AI+GD FL   Y +Y+
Sbjct: 338 PDLTFNFNGKNFTIGPYDYTLE-VSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYD 396

Query: 544 LDDLEISMAQA 554
           L++  + +A+A
Sbjct: 397 LENNAVGLAEA 407

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWV 133
           Y  ++ +GTP QS  V++DTGSS+LWV
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV 120

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 129/318 (40%), Gaps = 59/318 (18%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
            + C  +  +D + SST++ N T   + Y   S   G    D    SD L + G  F   
Sbjct: 126 AMACRLHKRYDHDRSSTYKENGTLTGVTYGSGS-IMGYVSEDTFRISD-LEIPGQQFTET 183

Query: 320 NQTNSTV-------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSL 372
                +V       G+LG+  P L       Y  T P+        L     + + V+ +
Sbjct: 184 TDEPGSVFVFAAFDGILGLAYPSLG------YGVTPPF------QQLMEKKLVKEPVFGM 231

Query: 373 YLN--KQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFD--------IT 422
           YL+  K    NG ++ G  D ++++G+  + +P+        Y   + FD        I 
Sbjct: 232 YLDDMKTGEGNGQLVLGGYDETKFKGEIAW-LPV----RRQAYWE-VVFDSVTVGDDNIP 285

Query: 423 LQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC 482
           L+  G                A +DSGT+L  FP ++ N     ++    D  G   ++C
Sbjct: 286 LENYG----------------AAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDC 329

Query: 483 PDSDDNTQIVFDFGGFHINANLTNFVLS--SASGKCVLGLLPYN----GNSAILGDMFLT 536
            +      + F FGG   + +  ++++S    S +C+  ++  +    G  AI+GD+FL 
Sbjct: 330 ANKQTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLR 389

Query: 537 HAYVVYNLDDLEISMAQA 554
             Y +Y+  +  + +A A
Sbjct: 390 RYYSIYDFGNNAVGLATA 407

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 90  KRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGK 147
           K NDG+         + Y+ ++ IGTP Q   V+VDTGSS LWV G +   C++ + +
Sbjct: 76  KNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKE---CRAMACR 130

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 130/309 (42%), Gaps = 43/309 (13%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319
           ++ C  +  +D  DSST++ N T+F+I+Y   S   G   +DVL   D L + G  FA A
Sbjct: 122 SLACYLHAKYDHSDSSTYKKNGTTFSIQYGSGS-MEGYISQDVLQIGD-LVIPGQDFAEA 179

Query: 320 NQTNSTV-------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSL 372
                         G+LG+    + V          P  Y+       N   + + ++S 
Sbjct: 180 TSEPGLAFAFGKFDGILGLAYDTIAV------NRVVPPFYNAI-----NKKLVDEPIFSF 228

Query: 373 YL--NKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXX 430
           YL  + ++   G V FG  D S + GD  + +P+        Y   ++FD    G     
Sbjct: 229 YLGDDTKSEDGGQVTFGGYDSSLFTGDITW-LPV----RRKAYWE-VKFDAIALG----- 277

Query: 431 XXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQ 490
                        A +D+GT+L   P  +  ++   I A  S + G ++++C   D    
Sbjct: 278 ---NEVADLVNHGAAIDTGTSLITLPSGLAEVINSQIGAKKSWS-GQWIVDCKTRDTLPD 333

Query: 491 IVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVVYNLD 545
           + F F G++      ++ L   SG C+  + P +     G  AI+GD FL   Y +Y++ 
Sbjct: 334 MTFTFDGYNFTITPYDYTLE-VSGSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVG 392

Query: 546 DLEISMAQA 554
           +  + +A A
Sbjct: 393 NNAVGLAAA 401

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y  ++ +GTPAQS  V++DTGSS+LWV   D
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWVPSVD 119

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 141/321 (43%), Gaps = 65/321 (20%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
           +++ C  +  +D   SST++SN + F I+Y   S   G   +D LT          F++ 
Sbjct: 118 SSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGS-LKGYISQDTLTIGDLIIPQQDFAEA 176

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
               GL+FA         G+LG+    + V          P +Y+       + G + K 
Sbjct: 177 TAEPGLAFAFGKFD----GILGLAYDSISV------NKAVPPLYNAI-----HRGLLDKP 221

Query: 369 VYSLYL-NKQNAKNG-NVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFD------ 420
           +++ YL +++++KNG    FG  D S++EG+  + +P+        Y   ++FD      
Sbjct: 222 MFAFYLGDEKSSKNGGEATFGGYDPSRFEGEIKW-LPV----RRKAYWE-VQFDGIKLGD 275

Query: 421 --ITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYY 478
             + L+G G                A +D+GT+L   P  + + L   I A  S   G Y
Sbjct: 276 KFMKLEGHG----------------AAIDTGTSLITLPSQIADFLNNEIGAKKSWN-GQY 318

Query: 479 VMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDM 533
            ++C   +   ++  +F   +   +  ++ L   SG C+  + P +     G  +I+GD 
Sbjct: 319 TIDCKKRESLPKLTLNFYNHNFTIDPFDYTLE-ISGSCISAITPMDFPQPVGPLSIIGDA 377

Query: 534 FLTHAYVVYNLDDLEISMAQA 554
           FL   Y +Y+L++  + +A++
Sbjct: 378 FLRRFYSIYDLENNAVGLAKS 398

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 21/97 (21%)

Query: 54  INDIVIEYDNDTDDYR-LQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSF------ 106
           ++ + +E  +D++D + ++  D I  L   + Y+N  ++   + E+ I  +  F      
Sbjct: 20  LHKVSLEKRDDSEDIKGIRLSDYISHL--GRKYLNQFEK--AFPEVHISKKDQFTIESHD 75

Query: 107 ----------YSVNLRIGTPAQSITVLVDTGSSDLWV 133
                     Y  ++ IGTP Q   V++DTGSS+LWV
Sbjct: 76  VPLDNYLNAQYYTDVSIGTPPQKFKVILDTGSSNLWV 112

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 122/302 (40%), Gaps = 49/302 (16%)

Query: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDGL 309
           ++ C  +  +D   SST+  N T FAIRY   +   G    D +T          F++  
Sbjct: 132 SLACFLHNKYDHRVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEAT 190

Query: 310 NVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSV 369
           +  GL+FA         G+ G+    + V          P  Y+       N G +    
Sbjct: 191 SEPGLAFAFGKFD----GIFGLAFDTISV------NRAVPPFYNAV-----NRGLLDAPQ 235

Query: 370 YSLYLNKQNAKN--GNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLG 427
           ++ YL  +  +   G V FG  D +++ G+  + +P+        Y     +++   G+ 
Sbjct: 236 FAFYLGDKRLRKEGGEVTFGGYDETRFTGNITW-LPV----RREAY-----WEVDFNGIS 285

Query: 428 XXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDD 487
                           A +D+GT+L   P  +  +L   I A   +  G YV++C     
Sbjct: 286 FGSQYAPLTATG----AAIDTGTSLITLPSGLAEILNAQIGAR-KNWSGQYVLDCSRRST 340

Query: 488 NTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTHAYVVY 542
              I F+ GG + +    ++ L  ASG C+  ++P +     G  AI+GD FL   Y VY
Sbjct: 341 LPDITFNLGGSNFSIGPYDYTLE-ASGTCISAIVPMDFPEPVGPLAIIGDAFLRRWYSVY 399

Query: 543 NL 544
           +L
Sbjct: 400 DL 401

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y  ++ IG+P Q+  V++DTGSS+LWV   D
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWVPSVD 129

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 84/192 (43%), Gaps = 21/192 (10%)

Query: 382 GNVLFGAVDHSQYEGDTLY--TVPLVN---GDSSSGYSTPIEFDITLQGLGXXXXXXXXX 436
           G V+FGAVD S Y GD +   T+P  N   G++S GY       + +Q            
Sbjct: 241 GKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGYPIIPLTKVNVQSKSGETKNMTSD 300

Query: 437 XXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFG 496
                +  L+DS     Y P +++  +A   NA Y ++L  +++ C        I+F+FG
Sbjct: 301 SFLEPV--LIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLACDVGRLGASIIFEFG 358

Query: 497 GFHINANLTNFV-------------LSSASGKCVLGLLPYNGNSA-ILGDMFLTHAYVVY 542
              IN  L N +              S+    C L LLP   +   +LG  F+ + Y+  
Sbjct: 359 NLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKNVYMAA 418

Query: 543 NLDDLEISMAQA 554
            L+  ++++AQA
Sbjct: 419 ELESNQVALAQA 430

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 70/313 (22%), Positives = 128/313 (40%), Gaps = 60/313 (19%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C T   +    SSTF++   +  ++Y     A      D L F+ G  +    F  A   
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGD-AKARVSYDTLYFA-GAKIENQGFGEAEAI 176

Query: 323 NSTV------GVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNK 376
                     G++GIG P +           KP I       L +SG +   ++ +Y++ 
Sbjct: 177 GDDFSGARFDGIIGIGYPSIGY-------GIKPPIN-----TLIDSGGLKDPMFGIYISN 224

Query: 377 QNAKN---GNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIE------FDITLQGLG 427
              +N   G ++ G  +  +++GD  + +P++     + + T +       F + +QGL 
Sbjct: 225 AQNRNSPVGEIVLGGYNTQKFKGDIKW-LPVLR---KAFWETDLSAFKVGNFALDVQGL- 279

Query: 428 XXXXXXXXXXXXXQIVALLDSGTTLTYFPKDML-NLLAKTINASYSDALGYYVMNCPDSD 486
                           A+ D+G++    P+D   + +++   AS+ D   Y  ++C   +
Sbjct: 280 ---------------TAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY--VDCSTVN 322

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNS-----AILGDMFLTHAYVV 541
               +  DFGG  +  +  ++V+      C+L +   +GNS      ILGD FL   Y +
Sbjct: 323 SGPDLTLDFGGVALKLSARDYVMQLGRNTCILAV---SGNSRVTGEVILGDTFLRRYYTI 379

Query: 542 YNLDDLEISMAQA 554
           YN  D  I +A A
Sbjct: 380 YNFGDNTIGVASA 392

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%), Gaps = 3/44 (6%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSGKSTN 150
           YSV++ +GTPAQ+  V +DTGSS LW+  SD   C S   ++ N
Sbjct: 83  YSVDITLGTPAQNFRVALDTGSSLLWIP-SDR--CTSQICRTRN 123

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 122/274 (44%), Gaps = 32/274 (11%)

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPL-VLKNSGAIHK 367
           L++   SF  A  +N   G LG+G   L    SG  + +  +    F L +LKN+  I  
Sbjct: 157 LSIPEFSFFRAEHSNIVDGSLGLGARIL----SGTAEDSSGFDSSFFFLDMLKNANFIKS 212

Query: 368 SVYSLYLNKQNAK----------NGNVLFGAVDHSQYEGD--TLYTVPLVNGDSSSGY-S 414
           + YS++L   N+            G +L GAVD + + G+      +P  +  + + + S
Sbjct: 213 TSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLPFRDSKTETTFNS 272

Query: 415 TPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDA 474
            PI     +  +                  LLD   T++Y P +++  +A   NA Y  +
Sbjct: 273 LPIVPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYTISYLPIELILQIAMQTNAVYVKS 332

Query: 475 LGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV-------------LSSASGKCVLGLL 521
           L  ++++C  ++ + +I F FG   I+  L++FV             L +++  C L + 
Sbjct: 333 LDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIASTQLGASNMTCQLNVY 392

Query: 522 P-YNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           P Y+   +ILG  FL   Y+  +L+   ++MAQA
Sbjct: 393 PNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA 426

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 131/300 (43%), Gaps = 54/300 (18%)

Query: 273 DSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDG-LNVTGLSFAVANQ---TNSTVGV 328
           +SST++S+     +  + T    G    DVL   D  L   G + A ++      S  GV
Sbjct: 4   NSSTYKSSGEEVELA-SGTGSMQGYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQGV 62

Query: 329 LGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAK--NGNVLF 386
            G+G  +L            P IY+     +   G +   ++ ++L K  A    G ++F
Sbjct: 63  FGLGHREL------AKGGQVPPIYN-----MMERGQLKDPMFGIFLPKNLAHINEGEIIF 111

Query: 387 GAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEF------DITLQGLGXXXXXXXXXXXXX 440
           G  D +++ G +L  +P+    +  G+   +EF      + T+QG G             
Sbjct: 112 GGYDSTKFAG-SLEWLPI----TKKGF-WEVEFNSISTGESTVQGEG------------- 152

Query: 441 QIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG--F 498
            + A+LD+G++LT  P ++ +     + A+     G  V +C   +   +IVF+ GG  F
Sbjct: 153 -LGAILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGRV-SCSARETAPEIVFELGGKKF 210

Query: 499 HINANLTNFVLSSASGKCVLGLLPY----NGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
            I  N   +++ + S +C++ + P       N  ILG  FL   Y VY+L    + +A+A
Sbjct: 211 AITGN--EYIMPAGS-ECMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 137/321 (42%), Gaps = 43/321 (13%)

Query: 306 SDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLV--LKNSG 363
           SD L +  +SF   + + + +G LG+G       +S V+        D F L+  + N  
Sbjct: 157 SDYLALRNISFVTTSSSTTDLGSLGLG----GSIHSSVFDIDSENFQDTFFLLKTMANLN 212

Query: 364 AIHKSVYSLYLN---------KQNAKNGNV----LFGAVDHSQYEGD-----TLYTVPLV 405
            I    YSL+L            +A NG+V    + GAVD S YEG+     T+  +   
Sbjct: 213 LIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTISYIEPS 272

Query: 406 NGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAK 465
           +  S+ GY  PI     +                    ALLDS    ++ P + +  +A 
Sbjct: 273 HNLSTFGY--PILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQIAI 330

Query: 466 TINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSS-----------ASG 514
            I A Y ++L  +V+ C  +     I F F G  I   L++ + SS           A G
Sbjct: 331 QIGAIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNSTMHFAEG 390

Query: 515 KCVLGLLPYNGNSA---ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVP 571
           +    L+ Y+ N+    +LG  F+ +AY+  +LD  ++++AQA   N+  D   I + +P
Sbjct: 391 ESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQA--KNTTGDSTSIVTVIP 448

Query: 572 NAVKAPGYSYTYSTSKSIVSG 592
            A+   G +    T + I SG
Sbjct: 449 -ALTGGGSTTAVRTVRKISSG 468

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 11/96 (11%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C  +GTF+   SSTF+ N+T F + Y       G +G DV++  + + ++  +F V+N T
Sbjct: 165 CSYWGTFNPNISSTFKYNETIFDLTY-------GTYGTDVVSLGN-ITLSNYTFGVSNDT 216

Query: 323 NSTVGVLGIGLPQLEVTYSG---VYQSTKPYIYDNF 355
             + G+LGI LP  E+T  G   +  +  P+ YDNF
Sbjct: 217 TMSYGILGISLPSEEITDRGQDALSSNKTPFAYDNF 252

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 90  KRNDGYEE--IQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143
           KR++ +    I +      Y V ++IGTP Q+  + +DTGSSD+ V  +D+ +CKS
Sbjct: 75  KRSEAFNSTIINMFASAGIYVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKS 130

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 128/317 (40%), Gaps = 53/317 (16%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLT----------FSDG 308
            ++ C  +  +D   SS+++ N T FAI+Y   S   G   +D L+          F++ 
Sbjct: 123 GSLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEA 181

Query: 309 LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIHKS 368
            +  GL+FA         G+LG+    + V          P  Y+       +   + + 
Sbjct: 182 TSEPGLAFAFGKFD----GILGLAYNTISV------DKVVPPFYNAI-----DQDLLDEP 226

Query: 369 VYSLYLNKQNAK------NGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDIT 422
            ++ YL   +         G   FG +D S+++G+  + +P+              +++ 
Sbjct: 227 RFAFYLGDSSDSEDSSVSGGVATFGGIDKSKFKGEISW-LPV---------RRKAYWEVK 276

Query: 423 LQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC 482
            +G+G                A +D+GT+L   P  +  ++   I A    + G Y ++C
Sbjct: 277 FEGIGLGDEFAILDGHG----AAIDTGTSLITLPSGLAEIINSEIGAKKGWS-GQYTVDC 331

Query: 483 PDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYN-----GNSAILGDMFLTH 537
                   + F+F G +      ++ L   SG C+  + P +     G  AI+GD FL  
Sbjct: 332 ETRSSLPDLTFNFSGKNYTIGPYDYTLE-VSGSCISAITPMDFPEPVGPLAIVGDTFLRR 390

Query: 538 AYVVYNLDDLEISMAQA 554
            Y VY+L +  + +A+A
Sbjct: 391 FYSVYDLGNNAVGLAKA 407

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 12/110 (10%)

Query: 31  DGKVNSVNSNFLKLGFE---KFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVN 87
           D KV+S   +  KL  E    FY   ++ +          Y  Q   +  ++  S+ +  
Sbjct: 21  DAKVHSAKIHKQKLSEEYLSTFYEQHLSHL-------GQKYLTQYEKAYPEISFSRKHPF 73

Query: 88  LIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
             + N        +N Q  Y  ++ +GTPAQ+  V++DTGSS+LWV   D
Sbjct: 74  FAEDNHDVPLTNYLNAQ--YYTDISLGTPAQNFKVILDTGSSNLWVPSVD 121

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 91/213 (42%), Gaps = 28/213 (13%)

Query: 365 IHKSVYSLYLNKQNAKN-GNVLFGAVDHSQYEGDTLY--TVPLVN---GDSSSGYSTPIE 418
           I    YS  L+    +N G ++FG VD S Y GD +   T+P  N   G +S GY  PI 
Sbjct: 223 IESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGY--PIV 280

Query: 419 FDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYY 478
             + +                     LLD+     Y P D++  +A   NA Y ++L  +
Sbjct: 281 PLVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNRW 340

Query: 479 VMNCPDSDDNTQIVFDFGGFHINANLTNFV-------------LSSASGKCVLGLLPYNG 525
           ++ C        I+FDFG   I+  L++ +              S+A   C L  LP   
Sbjct: 341 LLACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLP--- 397

Query: 526 NS----AILGDMFLTHAYVVYNLDDLEISMAQA 554
           NS    +ILG  F+ + Y+   L   ++++AQA
Sbjct: 398 NSDLGFSILGGPFIKNVYLAAELQSNQVALAQA 430

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 120/300 (40%), Gaps = 30/300 (10%)

Query: 263 CDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQT 322
           C  +  FD + SS++  N + F++ Y   S   G    D L   D L +    FA A   
Sbjct: 137 CLNHARFDHDRSSSYAKNDSRFSVSYGKGS-MEGFVSYDTLKIGD-LTIKNQGFAEATVE 194

Query: 323 NSTVGVLGIGLPQLEVTYSGV-YQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLN---KQN 378
             +  V G     L + Y G+      P  Y+       + G + + V++ YL+   K +
Sbjct: 195 PGSAFVYGQFDGILGLAYDGLAVNHIVPPFYEAV-----HQGLLDEPVFAFYLSDEKKGD 249

Query: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXX 438
           +  G V+FG  D +++ G+  + +P++            E ++    LG           
Sbjct: 250 SLAGEVVFGGYDETKFTGEISW-LPVIR-------KAYWEVELNSITLGSQKFQLQNYG- 300

Query: 439 XXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGF 498
                  LD+GT+   FP ++         A+     G+ +  C  S     + F+  G 
Sbjct: 301 -----GALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPCSGSG-FPDLTFELAGR 354

Query: 499 HINANLTNFVLSSASGKCVLGLLPYN----GNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
               + +++V+      C + + P +    G   I+GD+FL   Y +Y+L    + +A++
Sbjct: 355 SFTISSSDYVVQWDDTTCAVAITPLDLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGLAKS 414

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 100 IINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWV 133
            +N Q +  + L  GTP QS  V++DTGSS+LWV
Sbjct: 96  FVNNQYYSEIGL--GTPPQSFKVVMDTGSSNLWV 127

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 118/290 (40%), Gaps = 38/290 (13%)

Query: 299 GRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPL- 357
           G   L  S  L ++  SF   N T S+ GVLG+G    ++   G    +  +    F L 
Sbjct: 279 GSGALYNSHSLTLSNSSFFEINDTTSSKGVLGLGG---KINDKGTDIDSSQFDSSFFLLE 335

Query: 358 VLKNSGAIHKSVYSLYLNKQN------AKN-------GNVLFGAVDHSQYEGDTLYTVPL 404
            L+++G I    YSL+L           +N       G ++ G VD   Y G       L
Sbjct: 336 SLRDNGIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKFNNL 395

Query: 405 VNGDS-----SSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDM 459
           +  DS     S GY  P+    T+  +                  LLDS  + ++ P + 
Sbjct: 396 IFLDSRTDMLSRGY--PVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLPAET 453

Query: 460 LNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLG 519
           +  +A  +NA Y   +  +V++C  +D    I F+FG   I+    +F++S+ + +    
Sbjct: 454 IVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETNST 513

Query: 520 LLPYNGNSA--------------ILGDMFLTHAYVVYNLDDLEISMAQAN 555
           +    G+ A              ILG  FL + Y+  + DD  I++AQA 
Sbjct: 514 MKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQAR 563

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 124/285 (43%), Gaps = 42/285 (14%)

Query: 294 ATGEWGRDVLTFSDGLNVTGLSFAVANQTNS-TVGVLGIGLPQLEVTYSGVYQSTKPYIY 352
           +T  W  D    SD L++T +SF   + + S T G LG+G     +T  G   ++  +  
Sbjct: 151 STVHWDLD----SDTLSMTNVSFINVDYSGSITQGALGLGG---RITAPGEDINSDGFDG 203

Query: 353 DNFPL-VLKNSGAIHKSVYSLYLNKQNAKN------------GNVLFGAVDHSQYEGDTL 399
             F L  L  +  I  S YSL+L +   +             G ++ GAVD S Y GD +
Sbjct: 204 SFFFLEQLVANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFV 263

Query: 400 Y--TVPLVN---GDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTY 454
              T+P  +   G +S GY       ++++                 +  LLD+    ++
Sbjct: 264 RFDTIPFHDVDTGATSFGYPIVPLTKVSVKASSGQTLNVTSPDFAEPV--LLDTRYLYSF 321

Query: 455 FPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV------ 508
            P  ++  +A   NA Y ++L  ++++C   D N  ++F+F G  I+  + +F+      
Sbjct: 322 LPLKLIIQIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIKDFLSNSYDS 381

Query: 509 -------LSSASGKCVLGLLP-YNGNSAILGDMFLTHAYVVYNLD 545
                   S+ +  C L + P Y    ++LG  F+ +AY+  +L+
Sbjct: 382 VSNSTLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141
           N+ KR+D      +IN    Y V + IGTP Q+  + +DTGSSD++V  +D+PYC
Sbjct: 48  NVFKRDDVLNST-LINAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYC 101

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 128/340 (37%), Gaps = 95/340 (27%)

Query: 259 ATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTS---------YATGEWGRDVLTFSDGL 309
            ++ C  +  +D   SST+  +    +I Y   S            G+       F +  
Sbjct: 123 GSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYISEDNLQIGDLTIQNQKFGETT 182

Query: 310 NVTGLSFAVANQTNSTVGVLGIG---LPQLEVTYSGVYQSTKPYIYDNFPLVLKNSGAIH 366
           +  GL+FA         G+LG+    + Q ++T    Y + + ++ D             
Sbjct: 183 SEPGLAFAFGKFD----GILGLAYDTIAQDDIT-PPFYSAIQQHLLD------------- 224

Query: 367 KSVYSLYLNKQN--------AKNGNVL-FGAVDHSQYEGDTL---------YTVPL---V 405
           +S +S YL   N        A +G V   G VD S+++GD +         + VPL    
Sbjct: 225 ESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLIPLHVRRQAYWEVPLNAIK 284

Query: 406 NGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAK 465
            GD S+G          L+  G                A +D+GT+L   P DM  ++  
Sbjct: 285 LGDQSTG---------KLENTG----------------AAIDTGTSLITLPSDMAEIINA 319

Query: 466 TINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLS------SASGKCVLG 519
            I A      G Y + C        + F   G        +FVLS        SG C+  
Sbjct: 320 QIGAK-KGWTGQYTLECSTRAKLPDLTFTLDGH-------DFVLSPFEYTLEVSGSCISV 371

Query: 520 LLPYN-----GNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
           + P +     G  AILGD FL   Y V++LD   +S+A+A
Sbjct: 372 ITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVVSLAEA 411

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 107 YSVNLRIGTPAQSITVLVDTGSSDLWVTGSD 137
           Y  ++ +GTP Q   V++DTGSS+LWV   D
Sbjct: 91  YFADISLGTPPQKFKVILDTGSSNLWVPSVD 121

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 82/317 (25%), Positives = 135/317 (42%), Gaps = 44/317 (13%)

Query: 300 RDVLTFSDG-LNVTGLSFAVANQTN-STVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPL 357
           RD + F+ G L+++ +SF     +N  T G+LG+     +VT  G    +  Y   ++ L
Sbjct: 161 RDNVQFNSGSLSISNVSFFDIQSSNFKTSGLLGL---SGKVTNPGNAIDSSQYTEQSYFL 217

Query: 358 -VLKNSGAIHKSVYSLYLNKQNAK----------NGNVLFGAVDHSQYEG-----DTLYT 401
            +LK++  I  S YSL+L    +            G +L G VD S + G     D +  
Sbjct: 218 SLLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPY 277

Query: 402 VPLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLN 461
           V  V+   S GY  PI     +  +                 ALLDS ++++Y P   + 
Sbjct: 278 VDPVSNAVSVGY--PIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTII 335

Query: 462 LLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV------------- 508
            +A  I A+Y ++L  +++ C  +D    + F      I   L + +             
Sbjct: 336 QIAVQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSMF 395

Query: 509 LSSASGKCVLGLLPYNGNSA--ILGDMFLTHAYVVYNLDDLEISMAQANYDN----SNED 562
            SS    C L L   N N+   ILG+ F+ + Y+  +L+D  I++AQA        + E 
Sbjct: 396 FSSGQEACFLTLYA-NTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDDAVTEET 454

Query: 563 IEVITSTVPNAVKAPGY 579
            E   ST+   +K+ GY
Sbjct: 455 NETTASTIIKKIKS-GY 470

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 102/255 (40%), Gaps = 63/255 (24%)

Query: 358 VLKNSGAIHKSVYSLYLNKQNA----------KNGNVLFGAVDHSQYEGD--TLYTVPLV 405
            LK +  I+ S YSL+L  Q            + G ++FGAVD +  EG+      +P +
Sbjct: 203 ALKEARLINSSSYSLWLGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYI 262

Query: 406 N---GDSSSGYST----PI--------EFDITLQGLGXXXXXXXXXXXXXQIVALLDSGT 450
           +   G  + GY      PI          ++T  G                   LLD   
Sbjct: 263 HPQTGKVAYGYPVVPMGPIYITSSSGRSLNVTTDGFSAP--------------VLLDPSF 308

Query: 451 TLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLS 510
            L+Y P   +  +A  I A Y ++L  ++++C  +     + F FG   I   L++ + S
Sbjct: 309 ALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCDVASSGATVDFSFGDLTIKVPLSDLLAS 368

Query: 511 -------------SASGKCVLGLLP-----YNGNSAILGDMFLTHAYVVYNLDDLEISMA 552
                        +    CVL L P     YN    +LG  F+ +AY+  +L+   ++M 
Sbjct: 369 THDQSTNTTLHFNTGQEACVLQLYPNTFTGYN----VLGQAFMKNAYLAVDLEGKGVAMG 424

Query: 553 QANYDNSNEDIEVIT 567
           QA    S E  E+IT
Sbjct: 425 QAANFKSGERKEIIT 439

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 127/287 (44%), Gaps = 37/287 (12%)

Query: 300 RDVLTFSDG-LNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPL- 357
           R+ + F+ G L+++ +SF   N  +S  G  G+     ++T SG    +  +  ++F L 
Sbjct: 162 RNSVQFNSGSLSISNVSFF--NIESSNFGTSGLLGLGGKITDSGTDYDSSQFTENSFFLS 219

Query: 358 VLKNSGAIHKSVYSLYL-----NKQNAKN-----GNVLFGAVDHSQYEG-----DTLYTV 402
           +L ++  I    YSL+L       Q+ K      G +L G VD S + G     D +  V
Sbjct: 220 LLTDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLIPYV 279

Query: 403 PLVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNL 462
             V+   S+GY  PI     +  +                 ALLDS ++++Y P   +  
Sbjct: 280 DPVSNVVSTGY--PIVPLGPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYLPTSTIIQ 337

Query: 463 LAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV-------------L 509
           +A  I A+Y ++L  +++ C  +D    + F F    I   L++ +              
Sbjct: 338 IAVQIAATYVESLDRWLVECSMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTTTNSSMFF 397

Query: 510 SSASGKCVLGLLPYNGNSA--ILGDMFLTHAYVVYNLDDLEISMAQA 554
           SS    C L L   N N+   ILG+ F+ + Y+  +L+D  I++AQA
Sbjct: 398 SSGQEACFLTLYA-NTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQA 443

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 2/78 (2%)

Query: 68  YRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTG 127
           + +QK   II++  ++    + KRN+      +IN    Y V + IGTP Q++ + +DTG
Sbjct: 30  FPVQKFADIINIG-TQDVSTVFKRNEVLNT-TVINGIGVYVVKMEIGTPPQTVYLQLDTG 87

Query: 128 SSDLWVTGSDNPYCKSNS 145
           SSD+ V  +D  YCKS S
Sbjct: 88  SSDMIVNNADIAYCKSMS 105

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 136/333 (40%), Gaps = 62/333 (18%)

Query: 267 GTF---DIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA-NQT 322
           GTF   D+  S+  Q  K + +++  D  Y T        T  D + +  LSF  A +  
Sbjct: 125 GTFYKDDLTCSNLVQPLKLNESLKSPDGLYTTN-------TTDDSITLVALSFINAIDYQ 177

Query: 323 NSTVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPLV--LKNSGAIHKSVYSLYLNKQNAK 380
             T+G LG+       T S +  ++  ++ D+F  +  L NS  I    YSL+L      
Sbjct: 178 GLTIGSLGLA----SSTTSDLSGASLDFVDDSFSFLTYLSNSEVIDTPSYSLWLGGDTLP 233

Query: 381 --------------NGNVLFGAVDHSQYEGDT----LYTVPLVNGDSSSGYSTPI--EFD 420
                          GN++ GAVD   YEG      +    L N   +  Y  PI     
Sbjct: 234 YTNMTSINSTTIDYCGNLVLGAVDQRYYEGRLVQFDMLPALLNNVTEAVTYGLPIIPMGP 293

Query: 421 ITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM 480
           I ++                 +  LLDS  T    P + +  +A  +NA+Y +  G +++
Sbjct: 294 IYIENSSGTQLNLTTTNFLEPV--LLDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIV 351

Query: 481 NCPDSDDNTQIVFDFGGFHINANLTNF---VLSSASGK-----------CVLGLLP---- 522
            C  ++ N  + F+F G  I  +L +F   V++S +G+           C L + P    
Sbjct: 352 ECSLAEMNVNLNFNFQGLTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPNTDI 411

Query: 523 -YNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
            +N    ILG  FL + Y+  + +   +++A+A
Sbjct: 412 GFN----ILGGPFLKNIYLAIDNEGRSVAIAKA 440

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 134/310 (43%), Gaps = 43/310 (13%)

Query: 306 SDGLNVTGLSFAVANQTN-STVGVLGIGLPQLEVTYSGVYQSTKPYIYDNFPL-VLKNSG 363
           S  L+++ +SF     +N  T G+LG+     ++T  G    +  Y   ++ L +LK+  
Sbjct: 168 SGSLSISNVSFFSVESSNFKTSGLLGL---SGKITNPGSAADSSHYTEQSYFLSLLKDVN 224

Query: 364 AIHKSVYSLYL-----NKQNAKN-----GNVLFGAVDHSQYEG-----DTLYTVPLVNGD 408
            I    YSL+L       Q  ++     G +L G VD S + G     D +  V  V+  
Sbjct: 225 LIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLIPYVDPVSSA 284

Query: 409 SSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLLAKTIN 468
            S+GY  PI     +  +                 ALLDS ++++Y P + +  +A  I 
Sbjct: 285 VSTGY--PIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTNTIIQIAVQIA 342

Query: 469 ASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV-------------LSSASGK 515
           A+Y ++L  +++ C  ++    + F      I   L + +              SS    
Sbjct: 343 ATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLLSSTYDTSTNSSMFFSSGQEA 402

Query: 516 CVLGLLPYNGNSA--ILGDMFLTHAYVVYNLDDLEISMAQANY---DNSNEDI-EVITST 569
           C L L   N N+   ILG+ F+ + Y+  +L+D  I++AQA     D  N+D  E   ST
Sbjct: 403 CFLTLYA-NTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQAKKIEDDAVNDDANETNAST 461

Query: 570 VPNAVKAPGY 579
           V   +K+ GY
Sbjct: 462 VIKKIKS-GY 470

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 123/293 (41%), Gaps = 49/293 (16%)

Query: 300 RDVLTFSDG-LNVTGLSFAVANQTN-STVGVLGIGLPQLEVTYSGVYQSTKPYI-YDNFP 356
           +D + F  G L+++ +SF     +N  + G+LG+     +VT  G    +  Y  Y  F 
Sbjct: 151 QDNIQFESGSLSISNVSFFNIESSNFKSSGLLGL---SGKVTNPGTDIDSSQYTEYSYFL 207

Query: 357 LVLKNSGAIHKSVYSLYLNKQNAK----------NGNVLFGAVDHSQYEGDTLYTVPLVN 406
            +LK++  I    YSL+L    +            G +L G VD S + G TL    L+ 
Sbjct: 208 SLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTG-TLGQFDLIP 266

Query: 407 GDSSSGYSTPIEFDITLQ----GLGXXXXXXXXXXXXXQIV------ALLDSGTTLTYFP 456
                 Y+ P+   IT+      LG                      ALLDS ++++Y P
Sbjct: 267 ------YADPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDSTSSVSYLP 320

Query: 457 KDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANL------------ 504
              +  +A  I A+Y ++L  +++ C  +D    + F      I   L            
Sbjct: 321 TSTIIQIAVQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLLSSTYDTST 380

Query: 505 -TNFVLSSASGKCVLGLLPYNGNSA--ILGDMFLTHAYVVYNLDDLEISMAQA 554
            ++ + SS    C L L   N N+   ILG+ F+ + Y+  +L+D  I++AQA
Sbjct: 381 NSSMLFSSGQEACFLTLYA-NTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 432

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 445 LLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANL 504
           LLDS  + TY P D +  +A  I A++ ++L  +++ C  +  +  + F FG   I   L
Sbjct: 301 LLDSRYSTTYLPIDAIVQIAVQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPL 360

Query: 505 TNFVL-------------SSASGKCVLGLLPYNGNSA-ILGDMFLTHAYVVYNLDDLEIS 550
            +F++             S+    C L ++  +     +LG  FL + Y+  +++D  I+
Sbjct: 361 EDFLVTTYDPKSNTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIA 420

Query: 551 MAQANYDN 558
           +AQA   N
Sbjct: 421 IAQAKMVN 428

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 88/224 (39%), Gaps = 29/224 (12%)

Query: 359 LKNSGAIHKSVYSLYLNKQNAKN----------GNVLFGAVDHSQYEG-----DTLYTVP 403
           ++++G I    YSL+    N             G ++ GAVD   Y G     D + +V 
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 404 LVNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLL 463
           + +G  + G   PI     +Q LG                 LL+S    ++ PK ++  +
Sbjct: 256 IASGQHTRG-GYPIVPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQI 314

Query: 464 AKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV----LSSASG----- 514
           A+  NA ++ +    ++ C    +     F FG   +   L++F+    L + +      
Sbjct: 315 ARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPD 374

Query: 515 ---KCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDLEISMAQA 554
               C L L+P  G   ++LG   L   Y+  + +   + MA A
Sbjct: 375 TNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALA 418

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 92/235 (39%), Gaps = 44/235 (18%)

Query: 358 VLKNSGAIHKSVYSLYLNKQNAK---------------NGNVLFGAVDHSQ-----YEGD 397
           +L  SG I    YSL+L     +               NG +L G+VD S      Y+ D
Sbjct: 215 MLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFD 274

Query: 398 TL-YTVPLVNGDSSSGYSTPIE--FDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTY 454
            L Y  P    +S S    P+   + ++  G G                 LL+S     Y
Sbjct: 275 VLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEP-----VLLNSNFRSNY 329

Query: 455 FPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV------ 508
            P + +  +A  + A+Y ++L  +++ C  +++N    F F   +I A L +F+      
Sbjct: 330 LPLNSIIQIAIQVGATYVESLDRWLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDS 389

Query: 509 -------LSSASGKCVLGLLP--YNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
                   S  S  C L L P  Y G +A LG  FL   Y+    +   + MAQA
Sbjct: 390 TTNTSMHFSDNSEACFLKLYPNTYVGFNA-LGRPFLKSVYLAVEQEGRIVGMAQA 443

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 22/128 (17%)

Query: 445 LLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANL 504
            LDS  T TY P +M+  +A  I A Y ++L  +++ C  ++ +  + F F    I   L
Sbjct: 311 FLDSTYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPCNIANQHATLDFTFQDVSIRVPL 370

Query: 505 TNFV-------------LSSASGKCVLGLLP-----YNGNSAILGDMFLTHAYVVYNLDD 546
           T+ +              S+    C L +       YN    ILG  FL H Y+  +LD 
Sbjct: 371 TDLLGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYN----ILGRPFLKHVYMAVDLDG 426

Query: 547 LEISMAQA 554
             I++AQA
Sbjct: 427 NNIAIAQA 434

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 357 LVLKNSGAIHKSV-YSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPL 404
           +  +  G I K + YSL+LN  N   G++LFGAVD S+Y  + L T P+
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKY-AEELCTHPM 48

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 95/241 (39%), Gaps = 45/241 (18%)

Query: 353 DNFPLV--LKNSGAIHKSVYSLYL--------------NKQNAKNGNVLFGAVDHSQYEG 396
           D F L+  L NSG I  + YS++                ++ +  G ++FG VD S  +G
Sbjct: 221 DPFSLLNALLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDG 280

Query: 397 --DTLYTVPL---VNGDSSSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTT 451
              +   +P     +G ++SGY  PI     +  +                  LLDS  T
Sbjct: 281 TFQSFTMIPYEDTSDGLTTSGY--PILPMGPIYIIANSGRTLNLTTLDFLEPVLLDSRIT 338

Query: 452 LTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSS 511
            +  P   +  +A  + A Y ++L  +V+ C  +D N    F FG   I   L +F++ S
Sbjct: 339 NSRLPASFIIQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIRVPLEDFLVPS 398

Query: 512 A-------------SGKCVLGLLP-----YNGNSAILGDMFLTHAYVVYNLDDLEISMAQ 553
                            C L + P     +N    ILG  FL +A +  +    +I++ +
Sbjct: 399 GLTGDNKTIHFSQNEDACYLAMYPNTDIGFN----ILGTPFLKNAVIAVDHSSSQIAIGK 454

Query: 554 A 554
           A
Sbjct: 455 A 455

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 133/315 (42%), Gaps = 46/315 (14%)

Query: 307 DGLNVTGLSFAVANQTNSTV-GVLGIG---LPQLEVTYSGVYQSTKPYIYDNFPLVLKNS 362
           D L V  +SF  +    S   GVLG+G       E   SG Y S+  +I++ F    K +
Sbjct: 187 DHLWVKNVSFLDSTTATSLYSGVLGLGGSITSSNEYENSGNYDSSY-FIFNKF----KEA 241

Query: 363 GAIHKSVYSLYL-------------NKQNAKNGNVLFGAVDHSQYEGDTLY---TVPLVN 406
                + YSL+L              ++    G +L G +D + Y G +LY    +P V+
Sbjct: 242 NITQSNSYSLWLVEDESSLTTTSTKFEEEGTFGKLLLGVIDPALYRG-SLYQFDMIPYVD 300

Query: 407 GDS---SSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKDMLNLL 463
            +S   S GY       I ++                 +  LLDS     Y P++ +  +
Sbjct: 301 PESLVSSQGYPILPMGVIYVKSESGARLNVTSKDFLEPV--LLDSSQQGNYLPENAIIQI 358

Query: 464 AKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSS-----------A 512
           A  I A+Y +++  ++++C  +     ++F F G  I+  L N + ++           +
Sbjct: 359 AIQIGATYIESMDRWLVSCDMASYGASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYYS 418

Query: 513 SGKCVLGLLPY-NGNSA--ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITST 569
            G+    L  Y N N    +LG  F  + Y+  +L+   +++AQA   + ++   +  +T
Sbjct: 419 DGETACALTIYDNANMGYNLLGSAFFRNTYIAVDLEGNTVAIAQAKPSDEDDSSNLSATT 478

Query: 570 VP-NAVKAPGYSYTY 583
           +P  A+K+    Y Y
Sbjct: 479 LPAAAIKSHFIPYAY 493

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 85/354 (24%), Positives = 141/354 (39%), Gaps = 69/354 (19%)

Query: 255 DPSQA--TINCDTYGTFDIEDSSTFQSNKTSFAIRYA-------DTSYATGEWGRDVLTF 305
           DPS +  +I   +   FD E      +N +++  R++         SY+ G     V   
Sbjct: 99  DPSSSNTSIPYRSGHVFDFEFIDALFANGSAYTDRFSFPNILGSTESYSYGNHSGLVEVD 158

Query: 306 SDGLNVTGLSF-AVANQTNSTVGVLGIGLPQLEVTYSGVYQSTKPYI----YD-NFPLV- 358
              LN++ +SF +  N    ++G LG+G         G  +S    +    YD +F L+ 
Sbjct: 159 HGHLNISSMSFFSTYNSGGLSIGSLGLG---------GNVESRNSDLDSGQYDGSFFLLE 209

Query: 359 -LKNSGAIHKSVYSLYLNKQNAK--------------NGNVLFGAVDHSQYEGD--TLYT 401
            LK +G I    YSL+L   N                 G ++ GAV+ +  +G   +   
Sbjct: 210 ELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKFVSFNM 269

Query: 402 VPLVNGDS---SSGYSTPIEFDITLQGLGXXXXXXXXXXXXXQIVALLDSGTTLTYFPKD 458
           +P  N D+   S+GY  PI     +  +                  LLDS  T +  P +
Sbjct: 270 LPYQNPDTLEMSNGY--PILPMGPINIISKSGASLNMTSNNYLQPVLLDSRYTNSRLPIE 327

Query: 459 MLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFV---------- 508
            +  +A  I+ASY + L  +V++C    ++  + F FG   I   L  F+          
Sbjct: 328 AIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPLRIKVPLKQFLKKAIDPDTGN 387

Query: 509 ---LSSASGKCVLGLLP-----YNGNSAILGDMFLTHAYVVYNLDDLEISMAQA 554
              LS+    C+L L P     YN    ILG  F+   Y+  + +   I++ Q+
Sbjct: 388 ARTLSNGDQACILSLYPNHDIGYN----ILGAPFMKSIYLAVDNEGGTIALGQS 437

>KAFR0I01350 Chr9 (279516..280226) [711 bp, 236 aa] {ON} Anc_4.40
           YLR312W-A
          Length = 236

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVL-GLLPYNGNSAILGDMFLTHAYVVYNLD 545
           D  +  F F  FHI  N  N +L   + K    G +PYN    +LG  FL     +Y L+
Sbjct: 72  DKIRERFHFDKFHIKLN-ANIILQCLTHKSFAHGKVPYNEKLNLLGSQFLKFRSSIYTLN 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,039,274
Number of extensions: 2772819
Number of successful extensions: 7396
Number of sequences better than 10.0: 156
Number of HSP's gapped: 7157
Number of HSP's successfully gapped: 271
Length of query: 667
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 551
Effective length of database: 40,180,143
Effective search space: 22139258793
Effective search space used: 22139258793
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)