Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G022202.532ON27827812821e-180
KAFR0A018502.532ON2562922874e-30
NCAS0D026402.532ON2602082711e-27
NDAI0I022702.532ON2772312685e-27
SAKL0A09460g2.532ON2402732509e-25
Smik_13.2482.532ON2551962455e-24
CAGL0K02981g2.532ON2782862413e-23
TPHA0C041802.532ON2642802361e-22
ZYRO0B01980g2.532ON1881522302e-22
YMR069W (NAT4)2.532ON2851522334e-22
Kpol_1018.342.532ON2922912249e-21
Skud_13.2252.532ON2541392202e-20
KNAG0C058202.532ON2712862203e-20
KLTH0D06820g2.532ON2602082072e-18
TDEL0A030602.532ON2441671922e-16
Suva_13.2442.532ON2571421684e-13
Kwal_26.80162.532ON2402791463e-10
Ecym_72562.532ON2432411279e-08
Agos_YGOB_Anc_2.5322.532ON187111959e-04
KLLA0E18569g2.532ON215113950.001
Kpol_1020.183.64ON61142667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G02220
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   498   e-180
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   115   4e-30
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   108   1e-27
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   107   5e-27
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   100   9e-25
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    99   5e-24
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...    97   3e-23
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    96   1e-22
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    93   2e-22
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    94   4e-22
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    91   9e-21
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    89   2e-20
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    89   3e-20
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    84   2e-18
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    79   2e-16
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    69   4e-13
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    61   3e-10
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    54   9e-08
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    41   9e-04
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    41   0.001
Kpol_1020.18 s1020 complement(38564..40399) [1836 bp, 611 aa] {O...    30   7.3  

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  498 bits (1282), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 250/278 (89%), Positives = 250/278 (89%)

Query: 1   MDVRRLVQLVDNAFPKSISTKQGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKD 60
           MDVRRLVQLVDNAFPKSISTKQGITLERKIYIIG                   IYWYFKD
Sbjct: 1   MDVRRLVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKD 60

Query: 61  RKNPTVENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWD 120
           RKNPTVENIIKTQIFQLIDENLG         IYENDLDWSINKREEMFTSNMIYITYWD
Sbjct: 61  RKNPTVENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWD 120

Query: 121 CKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLI 180
           CKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLI
Sbjct: 121 CKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLI 180

Query: 181 KPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDE 240
           KPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDE
Sbjct: 181 KPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDE 240

Query: 241 KLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
           KLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV
Sbjct: 241 KLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  115 bits (287), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 142/292 (48%), Gaps = 64/292 (21%)

Query: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKDRKNPT 65
            +++V + FPK + TK G  L+RKI                       +Y   +D +N  
Sbjct: 10  FLKIVSDEFPKELRTK-GQNLKRKI-----------------------LYIASEDEENKE 45

Query: 66  VENIIKTQ-----------------IFQLIDENLGXXXXXXXXXIYENDLDWSINKREEM 108
            +++I  Q                   +++D NLG         IY+N+  W  NK  EM
Sbjct: 46  SDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEM 105

Query: 109 FTSNMIYITYW--DCKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGI 166
            +  +IY++YW  + ++ + ALFLS +  EE +++++  +  V+YLYEI + ++Y+   +
Sbjct: 106 KSPGLIYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQL 165

Query: 167 GERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDE 226
           G RLIK       I  +KI R     IG++LTVFS+N  A  FY  +I M++T+GSP+DE
Sbjct: 166 GTRLIKGLSNVCQIAQVKI-RPAFPLIGIQLTVFSDNKRAIKFY-ERIGMKFTYGSPKDE 223

Query: 227 IINVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
           +  +  R TR+               S+N K      K +RKP YY+L  PV
Sbjct: 224 VDKIESRKTRT---------------SVNRKT----LKVVRKPIYYLLYLPV 256

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  108 bits (271), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 105/208 (50%), Gaps = 18/208 (8%)

Query: 73  QIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSI 132
           Q   ++D NLG         IYEN   W +NK EEM +  ++Y++YWD + +   LFLS 
Sbjct: 67  QFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSF 126

Query: 133 LSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKL--IKPLKIERQDN 190
           +  EE    E++    V+YLYEI I    + + +G RL+ ++L +    ++    E  + 
Sbjct: 127 MLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEY 186

Query: 191 NFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEHCEDNK 250
             IG+ELTVFS+N +A  FY   I M+ T  SPRD + ++ +R TR   + +        
Sbjct: 187 PLIGIELTVFSDNENAIKFY-KSIGMELTPDSPRDRVAHLERRRTRGMAQNIS------- 238

Query: 251 LPSLNDKKKQLYRKSIRKPEYYILVFPV 278
                     + R  ++KP YY+   P+
Sbjct: 239 --------TSVGRTIVQKPIYYLFYLPL 258

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  107 bits (268), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 113/231 (48%), Gaps = 27/231 (11%)

Query: 62  KNPTVENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDC 121
            +P   + +  +   ++D NLG         IYEND  W  NK EEM +  +IY++YWD 
Sbjct: 58  SDPQQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDE 117

Query: 122 KQNSVALFLSILSCEETYIL----------ENNDQ-GEVLYLYEIHITKEYQRQGIGERL 170
           K     LFLS +  E    +          E+NDQ   V+YLYEI I  + + QGIG +L
Sbjct: 118 KYQEPLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKL 177

Query: 171 IKDYL---IEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEI 227
           +  +L      L+     +      +G+ELTVFS+N  A NFY   I M+ T  SP DE+
Sbjct: 178 LSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFY-KSIGMKLTPDSPTDEV 236

Query: 228 INVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
             + KR TR+   ++            N   +++ ++ I+KP YY+   P+
Sbjct: 237 YQIEKRQTRNL-RRIN-----------NAGTREVTKQIIKKPVYYLYYLPI 275

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  100 bits (250), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 125/273 (45%), Gaps = 41/273 (15%)

Query: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKDRKNPT 65
           L+  V ++FP SI+ K G    RK+ +I                    +  +  DR++  
Sbjct: 9   LLPYVLDSFPTSITLKDGSLATRKVLVI--------DEPSSGIAPSGQVCTWSGDRQS-- 58

Query: 66  VENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDCKQNS 125
             N +  Q  +++D NLG         +Y N   W+ NK EEM T  ++Y+ Y+  +  S
Sbjct: 59  -SNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF--QGVS 115

Query: 126 VALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKI 185
             +FLS L  +E   L   D  +V+YLYEI +  E Q Q +G ++++ YL   +     +
Sbjct: 116 PLMFLSFLLTDEPDFLP--DPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTV---HSL 170

Query: 186 ERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEH 245
            R D    G+ELTVFS+N+ A + Y++ I M    GSP DEI    +R   S  +     
Sbjct: 171 SRLDPLLKGIELTVFSDNDAALHLYYS-IGMALAPGSPTDEIATSQRRTRHSTTD----- 224

Query: 246 CEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
                             +++ +P+YY++  PV
Sbjct: 225 -----------------LQTVSRPDYYLMFLPV 240

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 99.0 bits (245), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 98/196 (50%), Gaps = 24/196 (12%)

Query: 55  YWYFKDRKNPTVENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMI 114
           Y   K R N  +++ +     QLIDE+LG         +Y N   W  NK  EM + N++
Sbjct: 60  YRLHKSRGNHILDSCV-----QLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLV 114

Query: 115 YITYWDCKQNSVALFLSILSCEETYILENNDQGE----VLYLYEIHITKEYQRQGIGERL 170
           Y++YWD    ++A F S +  EET ++E +   E    V+YLYE+H+   ++  GIG RL
Sbjct: 115 YVSYWD--NGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRL 172

Query: 171 IKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFY----FNKIQMQYTFGSPRDE 226
           ++  L E + + ++   ++  F G+ LTVFS+N  A+  Y    F +       G+P   
Sbjct: 173 LERALCEGVARHVRCLYEE--FFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGAP--- 227

Query: 227 IINVMKRITRSFDEKL 242
                 R TR   E++
Sbjct: 228 ----TTRPTRHGGERV 239

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 131/286 (45%), Gaps = 44/286 (15%)

Query: 10  VDNAFPKSISTK-------QGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKDRK 62
           V + FPK I+TK       + + L+RK+ +I                     +   K+ K
Sbjct: 19  VLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKH--IKESK 76

Query: 63  NPTVENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYW--- 119
           N      I + + +L+D+NLG         +Y N   W  NK EEM T  MIY++YW   
Sbjct: 77  N------ILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKV 130

Query: 120 DCKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKL 179
           D +     LFLS +  EE  +  N+    V++LYEI I+KE ++QG+G+  + + L +  
Sbjct: 131 DDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCA 190

Query: 180 IKPLKIERQDNN-------FIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMK 232
            + L     DN+       F G+ELTVF++N  A N Y  K+ M +T  SP+D + +   
Sbjct: 191 KRLL-----DNDSLNLEFPFAGIELTVFADNLPAINLY-QKLGMTHTPESPKDVLYDQNT 244

Query: 233 RITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
           R       K+             + K +  R  I+KP YY+   P+
Sbjct: 245 RRRTRNSRKI-------------NNKNESPRILIKKPLYYMYWKPI 277

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 95.5 bits (236), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 132/280 (47%), Gaps = 21/280 (7%)

Query: 2   DVRRLVQLVDNAFPKSISTKQGIT-LERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKD 60
           D+ + V++VD+ +P  I   + +T L +KI ++                       Y   
Sbjct: 3   DIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGR------YLTY 56

Query: 61  RKNPTVENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITY-W 119
            +N     I  ++I  ++D NLG         +Y N   W  NK +EM T  +IY+ Y  
Sbjct: 57  SQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHL 116

Query: 120 DCKQNSVALFLSILSCEETYILENNDQ-GEVLYLYEIHITKEYQRQGIGERLIKDYLIEK 178
           + ++ +V+L+LS    +E+  L + D    V+YLYEI +T E +  G+G +LI  YL + 
Sbjct: 117 EDEKKTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDC 176

Query: 179 LIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSF 238
           L+     E    + IG+ELTVFS+N +A  FY   I M+ T  SP D+ IN   RI    
Sbjct: 177 LVDVH--ENIHKDIIGIELTVFSDNTNAIRFY-ETIGMKLTPDSPNDKTINYGHRIKTRS 233

Query: 239 DEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
                +    +K  SL+          ++KP+YY+   P+
Sbjct: 234 QNSSKKGSSSDKPTSLS---------VVKKPDYYLYYLPL 264

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 93.2 bits (230), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 83/152 (54%), Gaps = 11/152 (7%)

Query: 75  FQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSILS 134
            QLI+ NLG         IY+N+  W  NK +EM + N+ +++YW+ + N +  F SI+ 
Sbjct: 25  LQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNELVCFCSIMP 84

Query: 135 CEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIG 194
           CEE+ +    +   ++YLYEIH+  E++ Q  G+ ++ + L EKL     +        G
Sbjct: 85  CEESIV--EGEMSNIIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPKAHLS-------G 134

Query: 195 LELTVFSENNDAQNFYFNKIQMQYTFGSPRDE 226
           +ELTVFS N  A NFY N      ++ SP D+
Sbjct: 135 IELTVFSSNERAINFYRNN-GFTLSYDSPSDK 165

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 94.4 bits (233), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 79/152 (51%), Gaps = 9/152 (5%)

Query: 76  QLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSILSC 135
           QLID++LG         +Y N   W  NK  EM ++ ++Y+ YWD     +  F S +  
Sbjct: 106 QLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD--NGVLGAFTSFMLT 163

Query: 136 EETYILENNDQGE----VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNN 191
           EET ++E +   E    V+YLYE+H+   ++  GIG RL++  L + + +     R  +N
Sbjct: 164 EETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVAR--HTRRMCDN 221

Query: 192 FIGLELTVFSENNDAQNFYFNKIQMQYTFGSP 223
           F G+ LTVFS+N  A+  Y   +      GSP
Sbjct: 222 FFGVALTVFSDNTRARRLY-EALGFYRAPGSP 252

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 90.9 bits (224), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 138/291 (47%), Gaps = 34/291 (11%)

Query: 5   RLVQLVDNAFPKSI--------STKQGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYW 56
            LV + +N FP+++        ++ Q   L R++  I                    +  
Sbjct: 6   HLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNN--------VLS 57

Query: 57  YFKDRKNPTVENIIKTQIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYI 116
           Y+KD       +++  ++  ++D NLG         IY N+  W  NK  EM +  ++Y+
Sbjct: 58  YYKDN---VKCDVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYV 114

Query: 117 TYWDCKQNSVALFLSILSCEETYIL--ENNDQGE-------VLYLYEIHITKEYQRQGIG 167
            Y D       LF+S +  ++  ++   +ND  E       V+YLYEI + +  + Q +G
Sbjct: 115 IYNDDITKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLG 174

Query: 168 ERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEI 227
             LI +YL +K I+ L  + Q  N I LELTVFS N +A NFY  KI M YT  SPRD+I
Sbjct: 175 TILITNYL-KKTIEILNKDYQK-NIIALELTVFSNNINAINFY-KKIGMLYTPDSPRDKI 231

Query: 228 INVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
           I   KR TRS    L      N  PS      +  +K I+KP+YY+L  P+
Sbjct: 232 ILPQKRRTRSTTIALESK---NNEPSSRLTTSKPIKKIIKKPDYYLLFLPI 279

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 89.4 bits (220), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 76  QLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSILSC 135
           QL+DE+LG         +Y N + W  NK  EM ++ ++Y++YW     ++  F S +  
Sbjct: 75  QLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG--NGALGAFASFMLT 132

Query: 136 EETYILENNDQGE----VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNN 191
           EET ++E +   E    V+YLYEIH+   ++  G+G RL++  L E + + ++  R D  
Sbjct: 133 EETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEGVARRVRRVRCD-- 190

Query: 192 FIGLELTVFSENNDAQNFY 210
           F G+ LTVF +N  A+  Y
Sbjct: 191 FFGVALTVFGDNTRARRLY 209

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 124/286 (43%), Gaps = 32/286 (11%)

Query: 2   DVRRLVQLVDNAFPKSISTK---QGITLERKI-YIIGXXXXXXXXXXXXXXXXXXXIYWY 57
           D+   +Q VD  FP  I        ++L+R+I YI G                       
Sbjct: 5   DLTLFLQTVDRQFPTVIGCDLNGTAVSLKRRIHYIEGVGDDDDESHNKIMSYPGGLPPLP 64

Query: 58  FKDRKNPTV--ENIIKT--QIF-QLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSN 112
                NPT   +N  +   +IF +++D NLG         IY N   W  NK  EM ++ 
Sbjct: 65  PTTDDNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQ 124

Query: 113 MIYITYWDCKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIK 172
           ++Y++YW      V L+ S +  EE  I        V+YLYEI + +  +RQ +G+ ++ 
Sbjct: 125 LVYVSYWVSDSEPV-LYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVS 183

Query: 173 DYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMK 232
            YL E  ++  ++         + LTVFS+N  A  FY  ++   YT  SPRDE+    +
Sbjct: 184 -YLTECALESPEVA-------AVALTVFSDNEKALKFY-ERLNFTYTIDSPRDEVTEKPR 234

Query: 233 RITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278
           R T +               +L+  +    + +I+KP YY+L   V
Sbjct: 235 RRTAA-------------RTALDPARDSDVKVTIKKPTYYLLYLEV 267

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 89/208 (42%), Gaps = 31/208 (14%)

Query: 73  QIFQLIDENLGXXXXXXXXXIY-ENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLS 131
           Q+  L+  NLG         IY      W   KR EM T  ++Y+ Y D     + +F+S
Sbjct: 80  QLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPL-VFMS 138

Query: 132 ILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNN 191
           +L  +E   L       VLYL+EIH++   + QG+G  L++D L   L     + R   +
Sbjct: 139 LLLTDEPE-LGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLA---SLSRASPS 194

Query: 192 FIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITR-SFDEKLGEHCEDNK 250
            +G ELTVFSEN  A   Y   + M     SP+D    V +R    ++D  L        
Sbjct: 195 VLGAELTVFSENQRALRLYL-ALGMHVAAWSPQDRRAQVRRRTRAIAYDSSL-------- 245

Query: 251 LPSLNDKKKQLYRKSIRKPEYYILVFPV 278
                          + +P YYIL +P 
Sbjct: 246 ---------------VTRPAYYILFWPA 258

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 82/167 (49%), Gaps = 17/167 (10%)

Query: 73  QIFQLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYWDC-------KQN- 124
           Q+ +++DENLG         +Y N   W +NK  EM T  ++Y+ Y          ++N 
Sbjct: 63  QLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNA 122

Query: 125 --SVALFLSILSCEETYILENN--DQGEVLYLYEIHITKEYQRQGIGERLIKDYLIE--- 177
             S  LFLS +  EE  ++ ++  +   VLYLYE+ +    +R G+  RL+ D+L +   
Sbjct: 123 PFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQCGR 182

Query: 178 KLIKPLKIER-QDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSP 223
           +L    +  R     F GLELTVF++N  A   Y   + MQ    SP
Sbjct: 183 QLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLY-ESLGMQLAADSP 228

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 11/142 (7%)

Query: 76  QLIDENLGXXXXXXXXXIYENDLDWSINKREEMFTSNMIYITYW--DCK-QNSVALFLSI 132
           QL+DE+LG         +Y N L W  NK  EM ++ ++Y+ YW  D + + ++  F S 
Sbjct: 75  QLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAFASF 134

Query: 133 LSCEETYILENNDQGE----VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQ 188
           +  EET ++E +   E    V+YLYE+H    ++ +G+G RL+   L E +    ++ R 
Sbjct: 135 MLTEETGLVEGDTAHEQSVPVIYLYEVH--XXHRGRGLGRRLLAKALCEGVAA--RVRRT 190

Query: 189 DNNFIGLELTVFSENNDAQNFY 210
            ++  G+ LTVF +N  A+  Y
Sbjct: 191 CDDLFGVALTVFGDNTRARRLY 212

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 113/279 (40%), Gaps = 57/279 (20%)

Query: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKDRKNPT 65
           LV  V ++FP +++   G  ++R +Y +                         + R    
Sbjct: 9   LVPHVTDSFPTTLTLASGQRIQRAVYGVPMDT--------------------VRSRAE-I 47

Query: 66  VENIIKTQIFQLIDENLGXXXXXXXXXIYENDL-DWSINKREEMFTSNMIYITYWDC--- 121
            +  +  Q+  L+D NLG         +Y +    W   KR+EM T  ++Y+ Y      
Sbjct: 48  PDPCLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEE 107

Query: 122 --KQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKL 179
             K+     FLS+L  +E  +        V+YL EIH+    +  G+G  L++    E +
Sbjct: 108 TGKEGLPLAFLSLLLTDEPEL--GPAPAAVVYLMEIHVADIIRGLGLGGTLLR----EGV 161

Query: 180 IKPLKIERQDNNFI-GLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSF 238
              ++  R+ + FI G ELTVF++N  A   Y  ++ MQ    SP+D  I V +R     
Sbjct: 162 AGTVRGARRAHPFIQGTELTVFTDNEGALRLYL-RLGMQIAAWSPQDTCIEVHRRT---- 216

Query: 239 DEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFP 277
                             +  +   + + +P YY+L +P
Sbjct: 217 ------------------RATRYESRKVTRPTYYLLFWP 237

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 89/241 (36%), Gaps = 68/241 (28%)

Query: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGXXXXXXXXXXXXXXXXXXXIYWYFKDRKNPT 65
           L   +++AFP+ ++ + G TL R I I                           DR +  
Sbjct: 8   LALYINDAFPEQLACRNGCTLSRDIIIT--------------------------DRLSVA 41

Query: 66  VENIIKTQIFQLIDENLGXXXXXXXXXIYEN---DLDWSINKREEMFTSNMIYITYWDCK 122
                  Q+  +I+  LG         +Y        W  +KR E+      ++ Y   K
Sbjct: 42  ARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYR--K 99

Query: 123 QN---SVALFLSILSCEETYILENNDQ------------------------------GEV 149
           +N   ++A F+S+L C+E +    N                                 +V
Sbjct: 100 ENPGGAIAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKV 159

Query: 150 LYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNF 209
           +Y+ EIH++  +Q QG+G  ++      +L++   ++       GLELTVF+ N  A   
Sbjct: 160 VYVMEIHVSPSFQNQGLGSCML--LCARQLVQ--HMQPSFPQLKGLELTVFTGNRQALAL 215

Query: 210 Y 210
           Y
Sbjct: 216 Y 216

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 44/111 (39%), Gaps = 18/111 (16%)

Query: 100 WSINKREEMFTSNMIYITYWDCKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITK 159
           W   KR E+     ++I Y D     +A F+S+L               VLY+ E+H+  
Sbjct: 73  WPRCKRAELLDPAALHILYRD-PAGRLACFISLL--------LPGPADPVLYILELHVAA 123

Query: 160 EYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFY 210
            ++R+G+   L+                +      LELTVF+ N  A   Y
Sbjct: 124 PFRRRGLAAALLDAATRTA---------RAAGLTRLELTVFTANRPALALY 165

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 10/113 (8%)

Query: 100 WSINKREEMFTSNMIYITYWDCKQNSVALFLSI-LSCEETYILENNDQGE-VLYLYEIHI 157
           W   K +EM   +++YI  +      +  F S+ LS      L+++      L+LYEIH+
Sbjct: 86  WIRFKWDEMLDKDLVYIVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHL 145

Query: 158 TKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNFY 210
             EYQ +G+G  +    LI     PL    +D     +EL VF+ N+ A  +Y
Sbjct: 146 MGEYQSRGLGSLIFNGLLI-----PLA---RDLTCPSIELCVFTANDVACRWY 190

>Kpol_1020.18 s1020 complement(38564..40399) [1836 bp, 611 aa] {ON}
           complement(38564..40399) [1836 nt, 612 aa]
          Length = 611

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%)

Query: 119 WDC--KQNSVALF---LSILSCEETYILENNDQGEVLYLYEI 155
           WDC   + S  LF   +SIL   E + ++NND G  +Y + I
Sbjct: 422 WDCLFYEGSNFLFKISMSILKLNECHFMKNNDNGRTIYHFSI 463

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.140    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,614,474
Number of extensions: 1318126
Number of successful extensions: 3655
Number of sequences better than 10.0: 34
Number of HSP's gapped: 3745
Number of HSP's successfully gapped: 34
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)