Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G020105.433ON2131919841e-137
TPHA0E017705.433ON2171885003e-63
CAGL0A02794g5.433ON2161824925e-62
KNAG0C049205.433ON2171864863e-61
YDR367W (KEI1)5.433ON2211884865e-61
NCAS0F033705.433ON2111884839e-61
Smik_4.6335.433ON2211884821e-60
Kpol_1062.305.433ON2141884821e-60
TDEL0E019205.433ON2201904664e-58
Suva_2.5395.433ON2271954605e-57
KAFR0E039305.433ON2111884508e-56
Skud_4.6365.433ON2341984459e-55
TBLA0A065205.433ON2061804403e-54
ZYRO0F10010g5.433ON2081794333e-53
SAKL0G02508g5.433ON2281934102e-49
Kwal_55.214325.433ON2071803663e-43
KLLA0E21099g5.433ON2241903665e-43
AER256C5.433ON2391953642e-42
Ecym_47625.433ON2211933511e-40
NDAI0B056605.433ON1611353302e-38
KLTH0F16082g5.433ON2061693202e-36
KLLA0A09295g5.57ON22638654.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G02010
         (213 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   383   e-137
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   197   3e-63
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   194   5e-62
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   191   3e-61
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   191   5e-61
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   190   9e-61
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   190   1e-60
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   190   1e-60
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   184   4e-58
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   181   5e-57
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   177   8e-56
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   176   9e-55
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   174   3e-54
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   171   3e-53
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   162   2e-49
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   145   3e-43
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   145   5e-43
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   144   2e-42
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   139   1e-40
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   131   2e-38
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   127   2e-36
KLLA0A09295g Chr1 (810967..811647) [681 bp, 226 aa] {ON} similar...    30   4.5  

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  383 bits (984), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MYKRITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWL 60
           MYKRITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWL
Sbjct: 1   MYKRITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWL 60

Query: 61  TYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNK 120
           TYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNK
Sbjct: 61  TYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNK 120

Query: 121 QSENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPK 180
           QSENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPK
Sbjct: 121 QSENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPK 180

Query: 181 FIIDQDDVETD 191
           FIIDQDDVETD
Sbjct: 181 FIIDQDDVETD 191

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  197 bits (500), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 95/188 (50%), Positives = 126/188 (67%), Gaps = 5/188 (2%)

Query: 4   RITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63
           R+     K+LP SFF   PLY+GVE +LGI I NKCSG YGILALFTGHPL+ +QW++Y+
Sbjct: 8   RVRMQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYL 67

Query: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSE 123
           WS FTLLIY QG+F +  PN+  + QI   +S DTI T F T+YF   WF+ + +   + 
Sbjct: 68  WSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNI 127

Query: 124 NSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183
           NS    +K       QGAS + E F  + +TL  L+SR Y+N +LASF  +LF++PK++I
Sbjct: 128 NSSTTVDK-----YNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMI 182

Query: 184 DQDDVETD 191
           DQDDVE D
Sbjct: 183 DQDDVEQD 190

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  194 bits (492), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 92/182 (50%), Positives = 128/182 (70%), Gaps = 5/182 (2%)

Query: 14  PNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIYT 73
           P SFF   PLYLGVE++LGI ILNKCSG YGILALFTGHPL  +QW++Y+WS+FTL++++
Sbjct: 9   PKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFS 68

Query: 74  QGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSL----QRT 129
           QG+F I KP + +FSQI   F+ DT+ T F TL+F+  WF S +  K   ++     Q  
Sbjct: 69  QGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQNY 128

Query: 130 EKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVE 189
            +  +L+  QGAS  YE  + ++ TL TL+ R Y+N +LASF+ +L  +PK+++DQDDVE
Sbjct: 129 RRSTDLA-SQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDVE 187

Query: 190 TD 191
            D
Sbjct: 188 QD 189

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  191 bits (486), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 131/186 (70%), Gaps = 4/186 (2%)

Query: 10  SKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTL 69
           S  LP +FF +FPLY+GVE++LG+ +LNKCSG +GILALFTGHPL ++QW +Y+WS+FTL
Sbjct: 5   SSSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTL 64

Query: 70  LIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS----SDHSNKQSENS 125
           ++Y QG++ I KP +  FSQI  +FS+DT+ T   TL+F   WF+    +D +   + ++
Sbjct: 65  VVYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASA 124

Query: 126 LQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQ 185
           + R  K       QGA+ +YE    +I+T+ +L+ R Y+N +LASF+ +L  +P++++DQ
Sbjct: 125 VARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQ 184

Query: 186 DDVETD 191
           DD+E D
Sbjct: 185 DDIEQD 190

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  191 bits (486), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 135/188 (71%), Gaps = 10/188 (5%)

Query: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72
           LP SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL+++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67

Query: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS-SDHSNKQSENSLQR--- 128
           +QG++ I KPN+ +FSQI  ++++DTI T F TL+F   WF+  D +N    N+LQ    
Sbjct: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQSNPI 127

Query: 129 -----TEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183
                TE+ I++S KQ A+ +YE  + +++TL +LI R Y+N +LASF+ +L  +PK+++
Sbjct: 128 STGKLTERGIDIS-KQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLV 186

Query: 184 DQDDVETD 191
           D+DDVE +
Sbjct: 187 DRDDVEQN 194

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  190 bits (483), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 95/188 (50%), Positives = 129/188 (68%), Gaps = 8/188 (4%)

Query: 7   SSYSKVLP---NSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63
           + +S  LP    SFF + PLYLGVE++LGI I NKCSG YGILALFTGHPL  VQW+ Y+
Sbjct: 2   AHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYL 61

Query: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSE 123
           WSIFTL+I+ QG++ I KP +  FSQI   +SLDTI T   TL+F   WF ++ +   +E
Sbjct: 62  WSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTG--TE 119

Query: 124 NSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183
            +LQR  + +E    QGA+  YE  + + +TL TL  R Y+N +LA+F+ +L  +PK+++
Sbjct: 120 EALQRRNESLE---SQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLV 176

Query: 184 DQDDVETD 191
           DQDDVE D
Sbjct: 177 DQDDVEQD 184

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  190 bits (482), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 136/188 (72%), Gaps = 10/188 (5%)

Query: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72
           LP SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL+I+
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIF 67

Query: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS--------SDHSNKQSEN 124
           +QG++ I KPN+ LFSQI  +++LDT+FT F TL+F   WF+        +  SN  +  
Sbjct: 68  SQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNSNLI 127

Query: 125 SLQR-TEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183
           S +R T ++ ++S KQ A+ +YE  + +++TL +LI R Y+NL+LASF+ +L  +PK+++
Sbjct: 128 STERLTVRNTDIS-KQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLV 186

Query: 184 DQDDVETD 191
           D+DDVE +
Sbjct: 187 DRDDVEQN 194

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  190 bits (482), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 90/188 (47%), Positives = 127/188 (67%), Gaps = 9/188 (4%)

Query: 4   RITSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63
           R+ + YS  LP SFF   PLY+GVE +LGI ILNKCSG YGILALFTGHPL++ QW++Y+
Sbjct: 9   RVKTHYSN-LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYL 67

Query: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSE 123
           WS+FTL+IY+QG+F +  P++  +SQIF +FS DT  T   T+ F+  WF+   S     
Sbjct: 68  WSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDG 127

Query: 124 NSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183
           + +            QGAS TYE    +++T+  L+SR Y+N +LA+F  +LF++PK+++
Sbjct: 128 SGVDE--------YGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMV 179

Query: 184 DQDDVETD 191
           D DDVE D
Sbjct: 180 DFDDVEQD 187

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  184 bits (466), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 127/190 (66%), Gaps = 4/190 (2%)

Query: 6   TSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWS 65
           T S S  LP SF    PLY+GVE+ LGI I+NKCSG YGILALFTGHPL  +QW+ YIWS
Sbjct: 4   TRSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWS 63

Query: 66  IFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS-SDHSNKQSEN 124
           IFTL+I  QG++ I KPNV  FS IF  F +DT+FT F TL+F   W++   +SN   + 
Sbjct: 64  IFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDT 123

Query: 125 SLQRTEKDIELSQK---QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKF 181
               ++  ++ S K   QGAS  +E  + + +T+ +L  + Y+  ++ASF+ +L ++P++
Sbjct: 124 KSSYSDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRY 183

Query: 182 IIDQDDVETD 191
           ++DQDDVE D
Sbjct: 184 MLDQDDVEQD 193

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  181 bits (460), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 132/195 (67%), Gaps = 16/195 (8%)

Query: 12  VLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLI 71
            LP SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL++
Sbjct: 7   ALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIV 66

Query: 72  YTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS--------SDHSNKQSE 123
           + QG++ I KPN+ +FSQI  ++++DTI T F TL+F   WF+        +D S+  ++
Sbjct: 67  FAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQ 126

Query: 124 N-------SLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLF 176
                   + + T +  + S  QGAS +YE  + +++TL +LI R Y+N +LASF+ +L 
Sbjct: 127 TINYNPIATGKLTARSTDTS-GQGASESYEYSITILITLVSLIFRFYFNFILASFVQELL 185

Query: 177 INPKFIIDQDDVETD 191
            +PK+++D+DDVE D
Sbjct: 186 HHPKYLVDRDDVEQD 200

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  177 bits (450), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 127/188 (67%), Gaps = 8/188 (4%)

Query: 6   TSSYSKVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWS 65
           T+S+S  LP SF  + PLYL VE++LGI   NK SG +GILALFTGHPL+ +QW+ Y+WS
Sbjct: 3   TTSFS--LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 66  IFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENS 125
             TL ++ QG+F I KPN+  FSQIF  +S+DT+   F TL+F  DWF+ +   + +  S
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGS 120

Query: 126 --LQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183
              +RTE DI     QGAS  YE  + + +TL +L+ R Y+N +LASF+ +L  +PK++ 
Sbjct: 121 TITKRTE-DIS---SQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMF 176

Query: 184 DQDDVETD 191
           DQDD+E D
Sbjct: 177 DQDDIEQD 184

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  176 bits (445), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 87/198 (43%), Positives = 131/198 (66%), Gaps = 17/198 (8%)

Query: 11  KVLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLL 70
           K+   SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL+
Sbjct: 10  KIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLI 69

Query: 71  IYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDH-------SNKQSE 123
           +++QG++ I KPN+ +FSQI  ++++DTIFT F TL+F   WF+ ++       +N  ++
Sbjct: 70  VFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTAD 129

Query: 124 NSLQRTEKDIELSQK----------QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLH 173
            +L+       ++ K          Q A+  YE  + + +TL +LI R Y+NL+L SF+ 
Sbjct: 130 TALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQ 189

Query: 174 KLFINPKFIIDQDDVETD 191
           +L  +PK+++D+DDVE D
Sbjct: 190 ELLHHPKYLVDRDDVEQD 207

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  174 bits (440), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 113/180 (62%), Gaps = 14/180 (7%)

Query: 12  VLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLI 71
           +LP  F  + PLYLGVEL+LGI I NKC G YGILALF GHPL   QW+ Y WSI  L I
Sbjct: 14  ILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAI 73

Query: 72  YTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSLQRTEK 131
           Y QG+  + +P +Y FSQ+F  FS+DT+ T   T+YF  +WF+++ + +           
Sbjct: 74  YAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPA-------- 125

Query: 132 DIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETD 191
                  QGAS  YE  + ++VTL +L+SR Y+N ++ SFL +LF  P + +D D+VET+
Sbjct: 126 ------AQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETE 179

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  171 bits (433), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 118/179 (65%), Gaps = 4/179 (2%)

Query: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72
           LP  F    PLY+GVE+ LG+ ILNKCSG +GILALFTGHPL  +QW+ Y+WSIF+ ++Y
Sbjct: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66

Query: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSLQRTEKD 132
            QG+F   KP++ +FSQIF  FS+DT  T   TL+F   W++ +  N  ++ S+      
Sbjct: 67  AQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLE-DNTPTQKSIAAAAMQ 125

Query: 133 IELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETD 191
                 QGAS ++E  + + +TL +LI+R Y+N VLASF+  L  +P++++D  DVE +
Sbjct: 126 ---EPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQE 181

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  162 bits (410), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 120/193 (62%), Gaps = 14/193 (7%)

Query: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72
           LP SF    PLY+GVEL LGI I NK SGFYGILALFTGHPL  +QW  Y  S+ TLL+Y
Sbjct: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVY 68

Query: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS----SDHSNKQSENSLQR 128
             G++ I+KPN   +S +  +F++DT+   F T++F+  WFS     D+      + LQ 
Sbjct: 69  LSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128

Query: 129 TEKDI----ELSQK------QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFIN 178
             + +    EL+++      Q AS  YE  + ++ T+ TL  R Y+N +LA+F+ ++  +
Sbjct: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188

Query: 179 PKFIIDQDDVETD 191
           PK+I+D+DDVE D
Sbjct: 189 PKYIVDKDDVEQD 201

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  145 bits (366), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 111/180 (61%), Gaps = 13/180 (7%)

Query: 25  LGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFHIKKPNV 84
           +GVE+ LGI +LNKCSGFYGIL L TGH L  +QW+ Y+ SI T+++Y+ G+  I KP+V
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 85  YLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENS--LQRTEKDIELS------ 136
             +S I   F+ DT+ T F TL+F+  WFS+ +S     NS  LQ +  +   S      
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 137 -----QKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETD 191
                  Q AS   E F  ++VT+F L +R Y+N ++ +F+ +L  +PK+++DQDDVE D
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  145 bits (366), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 114/190 (60%), Gaps = 12/190 (6%)

Query: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72
           LP +F + +PLY+GVE+ LG+   NK SG YG+LALFTGHPL  VQW  YIWSIF L+++
Sbjct: 10  LPQTF-LSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68

Query: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSN-----KQSENSLQ 127
             G+  + KPN+ L S +  +FS+DTI +    L+F   WFS + S      K +  +L 
Sbjct: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128

Query: 128 RTEK------DIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKF 181
              +        ++   + ASS YE FLI+++TL  L  R Y+N ++ +F  +L  + KF
Sbjct: 129 PAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKF 188

Query: 182 IIDQDDVETD 191
             DQ+D+E +
Sbjct: 189 TFDQNDIEVN 198

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  144 bits (364), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 112/195 (57%), Gaps = 10/195 (5%)

Query: 6   TSSYSKV--LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63
           T S+S +  LP SFF L PLY+GVEL LGI I NK  G +G+LALFTGHPL I+QWL Y+
Sbjct: 20  TKSHSNMNHLPKSFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYL 78

Query: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDH---SNK 120
           WS  TLL+Y  G+  I +P +  +  +  ++S DTI T   TL+F   WF       +  
Sbjct: 79  WSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTAT 138

Query: 121 QSENSLQRTEKDIELSQK----QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLF 176
             E+    T+  + +  +    Q AS +YE    +  TLF L  R Y N ++ASF+ ++F
Sbjct: 139 AKEDDADATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMF 198

Query: 177 INPKFIIDQDDVETD 191
            + KF    DDVE D
Sbjct: 199 QHNKFAAGCDDVEQD 213

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  139 bits (351), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 108/193 (55%), Gaps = 15/193 (7%)

Query: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72
           LP SFF L PLY+GVEL LG+ I NK  G YGILALFTG PL ++QW  Y+WS   LL++
Sbjct: 4   LPQSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQS---------- 122
           T+G+  + KP +  +  + T++SLDT+   F  + F  DWFS + ++  S          
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 123 ----ENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFIN 178
               ++  Q       +   Q AS+ YE    +++TL     R Y N ++ASF+ ++   
Sbjct: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182

Query: 179 PKFIIDQDDVETD 191
            ++I + DDVE D
Sbjct: 183 NRYITEPDDVEYD 195

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  131 bits (330), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 88/135 (65%), Gaps = 1/135 (0%)

Query: 57  VQWLTYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSD 116
           +QW+ Y+WSIF L+I+ QG++ I KP +  FSQI   F+LDT+FT F TL+F   WF   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 117 HSNKQSENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLF 176
                 + S    ++D  L+  QGA++ YE F+ +++T  TL  R Y+N +LASF+ +L 
Sbjct: 61  EGESAVQTSTGVQKRDTSLA-SQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELL 119

Query: 177 INPKFIIDQDDVETD 191
            NPKF+IDQDDVE D
Sbjct: 120 SNPKFMIDQDDVEQD 134

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  127 bits (320), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 102/169 (60%), Gaps = 12/169 (7%)

Query: 25  LGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFHIKKPNV 84
           +GVE+ LGI ILNKCSGFYGIL L TGH L  +QW+ Y+ S+FTL++Y+ G+  + KP +
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 85  YLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSN-KQSENSLQRTEKDIELSQK----- 138
             ++ +   F+ DT+ T F TL+F+  WF++  S      ++ Q+T   I    K     
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 139 ------QGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKF 181
                 Q AS   E F  ++V+L  L+SR Y+N ++ +F+ +LF +PK+
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKY 169

>KLLA0A09295g Chr1 (810967..811647) [681 bp, 226 aa] {ON} similar
          to uniprot|P38869 Saccharomyces cerevisiae YHR181W
          SVP26 Component of Sed5p vesicles
          Length = 226

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 41 GFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFH 78
          G Y +L LF G P     WL   +SIFT ++Y Q M H
Sbjct: 53 GIYVLLLLFDGFP-----WLLTAFSIFTYVVYLQNMKH 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,204,558
Number of extensions: 806557
Number of successful extensions: 3241
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3295
Number of HSP's successfully gapped: 32
Length of query: 213
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 108
Effective length of database: 41,441,469
Effective search space: 4475678652
Effective search space used: 4475678652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 63 (28.9 bits)