Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G011106.10ON63860527580.0
Kpol_1045.776.10ON65059721520.0
TPHA0M002006.10ON63458721480.0
SAKL0E00880g6.10ON63658721190.0
KLLA0D00836g6.10ON64058820970.0
Kwal_56.223506.10ON65858720610.0
TDEL0G046106.10ON63359420450.0
ZYRO0F00484g6.10ON64359120410.0
ACR016W6.10ON64059220150.0
KLTH0C11528g6.10ON64259619820.0
CAGL0A01067g6.10ON64159319760.0
NCAS0D021906.10ON64559019700.0
KAFR0B065006.10ON63660918420.0
NDAI0I027506.10ON66360917570.0
KNAG0E027806.10ON65058915980.0
YPL263C (KEL3)6.10ON65160914410.0
Suva_16.426.10ON65460414270.0
Skud_16.146.10ON65260914250.0
Smik_6.4716.10ON65160514130.0
Kpol_1050.695.88ON10842501744e-12
Skud_8.2225.88ON11692581557e-10
NCAS0F005205.88ON10862641548e-10
YHR158C (KEL1)5.88ON11642581502e-09
Smik_8.2425.88ON11682511503e-09
KAFR0B043205.88ON9862621467e-09
KNAG0K005605.88ON11042741467e-09
ZYRO0B08228g5.88ON12932521432e-08
Kpol_1010.625.88ON9732521422e-08
YGR238C (KEL2)5.88ON8821901422e-08
TDEL0G011205.88ON10092551413e-08
Suva_15.3575.88ON11722591413e-08
CAGL0I02090g5.88ON11362671378e-08
NDAI0D026005.88ON11672791351e-07
TPHA0H010805.88ON8282591351e-07
CAGL0F07997g5.88ON9362571333e-07
KLTH0C01474g5.88ON10562551314e-07
SAKL0H02618g5.88ON10852541314e-07
KLLA0E15511g5.88ON9052701307e-07
Smik_16.685.88ON8941901281e-06
Suva_7.5305.88ON8942631271e-06
TBLA0C065305.88ON11723201271e-06
Kwal_14.10195.88ON9782551252e-06
Skud_7.5725.88ON8832671234e-06
TPHA0A051705.88ON10162741145e-05
ADL149W5.88ON12112041020.001
Ecym_20615.88ON1362204990.003
KNAG0A011803.15ON676117790.72
ZYRO0C03344g3.15ON65891780.96
NCAS0I003407.9ON85874771.3
KNAG0E041807.9ON81962761.4
ZYRO0C00550g7.9ON848104724.3
Smik_1.97.9ON87434724.7
TBLA0A043207.9ON838100707.8
Suva_15.193.15ON708116708.0
KAFR0C049107.9ON87833708.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01110
         (638 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...  1066   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   833   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   832   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   820   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   812   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   798   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   792   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   790   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   780   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   768   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   765   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   763   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   714   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   681   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   620   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   559   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   554   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   553   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   548   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    72   4e-12
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    64   7e-10
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    64   8e-10
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    62   2e-09
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    62   3e-09
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    61   7e-09
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    61   7e-09
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    60   2e-08
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    59   2e-08
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    59   2e-08
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    59   3e-08
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    59   3e-08
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    57   8e-08
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    57   1e-07
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    57   1e-07
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    56   3e-07
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    55   4e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    55   4e-07
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    55   7e-07
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    54   1e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    54   1e-06
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    54   1e-06
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    53   2e-06
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    52   4e-06
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    49   5e-05
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    44   0.001
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    43   0.003
KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15 Y...    35   0.72 
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    35   0.96 
NCAS0I00340 Chr9 complement(45659..48235) [2577 bp, 858 aa] {ON}...    34   1.3  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    34   1.4  
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    32   4.3  
Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)     32   4.7  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    32   7.8  
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    32   8.0  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    32   8.4  

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/605 (86%), Positives = 525/605 (86%)

Query: 34  LSKKNQXXXXXXXXXXXXXXXNFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNEL 93
           LSKKNQ               NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNEL
Sbjct: 34  LSKKNQLEEEDDDMAIEDILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNEL 93

Query: 94  ILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEF 153
           ILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEF
Sbjct: 94  ILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEF 153

Query: 154 SSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTS 213
           SSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTS
Sbjct: 154 SSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTS 213

Query: 214 TTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQ 273
           TTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQ
Sbjct: 214 TTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQ 273

Query: 274 KGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETE 333
           KGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETE
Sbjct: 274 KGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETE 333

Query: 334 ESLDSLFYNDLFTYQIEINRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNN 393
           ESLDSLFYNDLFTYQIEINRWFSLSMRSQR              EKELQDILNSILKKNN
Sbjct: 334 ESLDSLFYNDLFTYQIEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNN 393

Query: 394 LTDDDSEDPNAIEEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTL 453
           LTDDDSEDPNAIEEELKI           KDGQVTKQYEVMNQLPHVRFNATTAVVNDTL
Sbjct: 394 LTDDDSEDPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTL 453

Query: 454 YIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXX 513
           YIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFS         
Sbjct: 454 YIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEE 513

Query: 514 XXXXXXXXXIVDQKLVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGA 573
                    IVDQKLV                      RPWLPHPKPFETLRAFYVRTGA
Sbjct: 514 EDEDDGEEEIVDQKLVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGA 573

Query: 574 TFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQ 633
           TFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQ
Sbjct: 574 TFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQ 633

Query: 634 VNKRR 638
           VNKRR
Sbjct: 634 VNKRR 638

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/597 (67%), Positives = 466/597 (78%), Gaps = 13/597 (2%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDL 111
           NFKK+QE FE+INIE+V +P++RIN CMI NP HGK+ELILFGGE+T   ++TT F+NDL
Sbjct: 54  NFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDL 113

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           ++Y PENDQW++YTS+NSPMPRSS+AM +HP+G+AL+HGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 114 YSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLD 173

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C+TKEW+KVE KNGPSARSGHR+++WKN+ +LHGGFRDLGTSTTYL D WLFD+T YKW 
Sbjct: 174 CSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYKWK 233

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           Q+EFPPNH IPDARSGHS IPTQ+GA+LWGGYCKVKAGKGLQKGKIL+DCWYLKMK+D +
Sbjct: 234 QIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPT 293

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESLDS+FYNDLF+YQIEI
Sbjct: 294 AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEI 353

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLT-----DDDSEDPNAIE 406
           NRWF+L +R QR              EKELQD+LN IL+K NL      D + ED  AIE
Sbjct: 354 NRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKAIE 413

Query: 407 EELKIXXXXXXXXXX--XKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGE 464
            EL               +D +  K+Y+V+ QLPH RFNAT  VVNDTL+I+GG WELGE
Sbjct: 414 TELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWELGE 473

Query: 465 KDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELG-EQFSXXXXXXXXXXXXXXXXXXI 523
           KDY+IDSFYSIDLN+ DGVTV WED+ EIEAAKE G                       I
Sbjct: 474 KDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGEEEI 533

Query: 524 VDQKLVXXXXXXXXXXXXXXXXXXXXXXR--PWLPHPKPFETLRAFYVRTGATFLEWAIS 581
           +DQKLV                         PWLPHPKPFE+LR FYVRTGATFLEWAIS
Sbjct: 534 MDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWAIS 593

Query: 582 NNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           NNRD++GKHLKKKSF+L +DRWW+RRDQVRIEEDKMEELGGI  ++E+DT++  KRR
Sbjct: 594 NNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/587 (68%), Positives = 457/587 (77%), Gaps = 10/587 (1%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTST---TTTFYNDL 111
           NFKK+QEQFE+IN+E+V KPT+RINSCMI+NP HGK EL+LFGGENTS     T FYNDL
Sbjct: 55  NFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDL 114

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           +T+ P+ND WKK TSQNSPMPRSS+AM +HP+GIALLHGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 115 YTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C T+EW+KVE KNGPSARSGHR+TVWKN+ ILHGGFRDLG++T+YL D WLFD+T YKW 
Sbjct: 175 CTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWR 234

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           Q+EFPPNH +PDARSGHSLIPTQ+GA+LWGGYCKVKAGKGLQKGKIL DCWYLKMK+D S
Sbjct: 235 QIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKADPS 294

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            +RWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV+DFEETEESLDS+FYNDLF+YQIE 
Sbjct: 295 AVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIES 354

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLTDDDSEDPNAIEEELKI 411
           NRW++L +RSQR              E ELQ+ILN IL+K NL DDD ED N +   L  
Sbjct: 355 NRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDD-EDANELSNGLGS 413

Query: 412 XXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDS 471
                            K+Y V NQLPH RFNA+T VV+DTL+I+GG WELGEKDYSIDS
Sbjct: 414 DSDSDDESEKVS----KKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDS 469

Query: 472 FYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKLVXX 531
            YSIDLNKLDGVTVYWE++ +IE AKELG   +                   VDQKLV  
Sbjct: 470 MYSIDLNKLDGVTVYWENLHDIEKAKELG-AINSDEEDEEDEDDEDDDEEETVDQKLV-A 527

Query: 532 XXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGKHL 591
                               RPWLPHPK FE+LR FYVRTGA+FLEWAISNN+ ++GKHL
Sbjct: 528 EEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHL 587

Query: 592 KKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           K KSFEL +DRWWERRDQVRIEEDK+EELGG+  ++E+DTT+  KRR
Sbjct: 588 KTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/587 (66%), Positives = 461/587 (78%), Gaps = 7/587 (1%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTT---TTFYNDL 111
           NFK++QE+FE++ + TV +PT+RINS M++NP+HGK EL+LFGGENT++T   T FYNDL
Sbjct: 54  NFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDL 113

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           FTY+ + DQW+K +SQNSPMPRSS+A+ +HP+G+ L+HGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 114 FTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLD 173

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C TKEW+K+E KNGP+ARSGHR+TVWKN+ ILHGGFRDLGT TTYL D WLFD+T YKW 
Sbjct: 174 CNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWK 233

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QV+FPPNH IPDARSGHSL+PT DGA+LWGGYCKVKAGKGLQKGKIL+DCWYLKMKSD+ 
Sbjct: 234 QVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSDIG 293

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESL+S+FYNDLFT+QIE 
Sbjct: 294 AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQIET 353

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLTDDDSEDPNAIEEELKI 411
           NRW+S S+R QR              +KEL+DILN IL+K NL DD++E    I + LK 
Sbjct: 354 NRWYSASLRPQR-KAAKATSKNNRNKDKELEDILNQILEKANLNDDENEK-ETIGDVLKE 411

Query: 412 XXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDS 471
                       + +  K+Y +  QLPH RFNA+TAVV+DTL+IFGG WE+GEKDYSIDS
Sbjct: 412 LDEEDSDSAEELNSE-KKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470

Query: 472 FYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKLVXX 531
           FY+IDLN+LDG+ +YWED+ +IE AKELG++                    I DQKLV  
Sbjct: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLV-A 529

Query: 532 XXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGKHL 591
                               RPWLPHPKPFETLR FYVRTGA FLEWAIS+NRD++GKHL
Sbjct: 530 EDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHL 589

Query: 592 KKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           KKKSF+L +DRWWERRDQVRIEEDK+EELGGI  +VE+DT++  KRR
Sbjct: 590 KKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/588 (65%), Positives = 452/588 (76%), Gaps = 4/588 (0%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTST---TTTFYNDL 111
           NFK++QE FEKIN+E V +P +RIN CM  NP HGK EL++FGGE+T+    TT FYNDL
Sbjct: 53  NFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDL 112

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           F Y+ + D WK+YTSQNSPMPRSS+A+ SHPTG+AL+HGGEFSSPKQNTFYHYSD+WL D
Sbjct: 113 FVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFD 172

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C++KEW+KVE KNGPSARSGHRM +WKNFIILHGGFRDLGTSTTYL DLW+FD+T YKW 
Sbjct: 173 CSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QVE P NH IPDARSGHSLI T +GA+L+GGY KVKAGKGLQKGKILSDCWYLKMKSD+ 
Sbjct: 233 QVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLG 292

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERRKKQG QPSPRVGCSMVHHKGRG+LFGGV+DFEETEESL S+FYN+L+TYQIE 
Sbjct: 293 SIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIEN 352

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLTD-DDSEDPNAIEEELK 410
           NRW+++S+R QR              +KEL+DILN IL K NL D +D ++   IEE+L 
Sbjct: 353 NRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQLN 412

Query: 411 IXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSID 470
                        D +  K YE M+ LPH RFNA TAVV+DTL+IFGG+ E+GEKDY ID
Sbjct: 413 QLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYPID 472

Query: 471 SFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKLVX 530
           SFYSID+NKLDGV VYWE+++E+E A++LGEQ S                  IVD KL  
Sbjct: 473 SFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKLEA 532

Query: 531 XXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGKH 590
                                RPWLPHPK FETLRAFYVRTG TFLE AIS+NRDSKGKH
Sbjct: 533 EDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKGKH 592

Query: 591 LKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           LK KSFEL +DRWWERR+QVRIEEDK+EELGG+E+++E+DT++  +RR
Sbjct: 593 LKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/587 (66%), Positives = 456/587 (77%), Gaps = 11/587 (1%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTT---TTFYNDL 111
           NFKK+QE F+++ +  V +P++RINSCM++NPIHGK EL++FGGE+T++T   T FYN+L
Sbjct: 80  NFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNEL 139

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           FTY+ ++DQW+K TS+NSPMPRSS+A  +H +G+AL+HGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 140 FTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWLLD 199

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C TKEW+K+E KNGPSARSGHRMT+WKNF ILHGGFRDLGTSTTYL DLW+FD+T YKW 
Sbjct: 200 CTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWK 259

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QVEFPPNH IPDARSGHS+IPTQDGA+LWGGYCKVKAGKGLQKGK L+DCWYLKMKSDVS
Sbjct: 260 QVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVS 319

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERRKKQGFQPSPRVGCSMVHHKGRG+LFGGV+DFEETEE L S F+NDLF+YQ+E 
Sbjct: 320 AIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEA 379

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLTDDDSEDPNAIEEELKI 411
           NRW+S+ MR Q+              E EL++ILN IL++ NL DD  +D N I+ EL+ 
Sbjct: 380 NRWYSVKMRPQKKKTVAISRNNRNKDE-ELENILNDILQQANLADDTDDDDNEIKRELQR 438

Query: 412 XXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDS 471
                            KQYEV+ QLPH RFNATTAVV+D L+IFGG WE GE+D+SIDS
Sbjct: 439 IDEEEALENSR------KQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDS 492

Query: 472 FYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKLVXX 531
           FYSIDLNKLDGV VYWE++ E+E AK LGE                       DQKLV  
Sbjct: 493 FYSIDLNKLDGVKVYWENLSELEKAKALGED-DEEEFDDDEDDDDDDEEEETADQKLVAE 551

Query: 532 XXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGKHL 591
                               RPWLPHPKPFETLRAFY+RTGA FL+WAISNNRD+KGKHL
Sbjct: 552 DEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHL 611

Query: 592 KKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           KK+SF+L +DRWWERR+Q+RIEEDK+EELGG+EN+VERD  Q  KRR
Sbjct: 612 KKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/594 (64%), Positives = 450/594 (75%), Gaps = 25/594 (4%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDL 111
           NFKK+QEQFEK+ +E + +P++RIN  MI+NPIHGK+ELI+FGGE+T   ++TT F+NDL
Sbjct: 55  NFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDL 114

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
             ++P+N+QWK+ +SQNSPMPRSS+AM+ HP+G+ALLHGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 115 VVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           CATKEW+K+E KNGPSARSGHRM VWKNFIILHGGFRDLGTSTTYL D WLFD+T YKW 
Sbjct: 175 CATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QVEFP NH +PDARSGHSLI  Q+GA+LWGGYCKVKAGKGLQKGKIL+DCWYLKM S+ S
Sbjct: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTS 294

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRW+R+K+QGFQPSPRVGCSMV HKGRG+LFGGV+DFEETEESL+S FYND+FTYQI +
Sbjct: 295 AIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINM 354

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLTDD-------DSEDPNA 404
           NRW+SLS+R QR              EKEL+D+LN IL+   L D         +E+  A
Sbjct: 355 NRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEIDAAEESTA 414

Query: 405 IEEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGE 464
           +EE+              +   + K++ +MN+LPH RFNA TAVV+DTL+IFGG WE GE
Sbjct: 415 VEED------------SDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGE 462

Query: 465 KDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIV 524
           KDYSIDSFY IDLNK DGVTVYWED+  +E AK+  +                      V
Sbjct: 463 KDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEEDSEEEQ--V 520

Query: 525 DQKLVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNR 584
           DQKLV                      RPWLPHPK FE+LR+FYVRTGATFLEWAISNNR
Sbjct: 521 DQKLV-AEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNR 579

Query: 585 DSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
             KGKHLK KSFE+ E RWWERRDQVR+EEDK+EELGG+  I+ERDTT+  KRR
Sbjct: 580 HVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/591 (65%), Positives = 451/591 (76%), Gaps = 10/591 (1%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTS---TTTTFYNDL 111
           +FKK+QEQFEK+ +E+V KP+ RIN C++SNP HGK ELILFGGE T+   +TT FYN+L
Sbjct: 56  SFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNEL 115

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           FT+ P+NDQW+K +SQN+PMPRSS+AM +HP+GIALLHGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 116 FTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 175

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C TKEW+K++ KNGP++RSGHRMTVWKNF I++GGFRDLGTSTTYL D WLFD+T +KWT
Sbjct: 176 CTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWT 235

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QVEFP NH IPDARSGHS IP Q+GA+LWGGYCKVKAGKGLQKGKIL+DCWYLKM S  S
Sbjct: 236 QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPS 295

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERRKKQGFQPSPRVGCSMV HKGRG+LFGGV+DFEETEESLDS FYNDLFT+QI+ 
Sbjct: 296 AIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKT 355

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNL--TDDDSEDPNAIEEEL 409
           NRW+SLS+R QR              EKELQD LN IL++  L   D+D ED  AI E+ 
Sbjct: 356 NRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQF 415

Query: 410 KIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSI 469
           +            ++    KQ+ +  QLPH RFN + AVVNDTL+I+GG WELG+KDY+I
Sbjct: 416 E---DENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNI 472

Query: 470 DSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFS--XXXXXXXXXXXXXXXXXXIVDQK 527
           DSFY IDLNK+DGVTVYWE++ EIE AK+L EQ S                    + DQ 
Sbjct: 473 DSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQV 532

Query: 528 LVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSK 587
           LV                      RPWLPHPK FE+LRAFYVR G  FLEWAISNNRD++
Sbjct: 533 LVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDAR 592

Query: 588 GKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           GKHLK+KSF+L +DRWWERRDQVRIEEDKMEELGG+ +IVER+  Q  KRR
Sbjct: 593 GKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/592 (63%), Positives = 449/592 (75%), Gaps = 13/592 (2%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTTT---FYNDL 111
           NFK+QQ +FE +N+ETV +P +R +S +++NP+H K ELILFGGE T+ +T    FYNDL
Sbjct: 54  NFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDL 113

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           F Y+ + DQWKKYTSQNSPMPRSS+A+ +HP+G+ L+HGGEFSSPKQNTFYHYSDTWL D
Sbjct: 114 FIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFD 173

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           CAT EW+K+E KNGPS+RSGHRMTVWKN+IILHGGFRDLGTSTTYL D WLFD+T YKW 
Sbjct: 174 CATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQ 233

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           Q++FP NH IPDARSGHSL+PT +GA+LWGGYCKVKAGKGLQKGKIL+DCWYLKMKSDV+
Sbjct: 234 QLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSDVT 293

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERRKKQGFQPS R GCSMVHHKGRGILFGGV+D+EETEE LDSLFYNDLFTY IE 
Sbjct: 294 AIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHIET 353

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNL-TDDDSEDPNAIEEELK 410
           NRW+S+S+R+QR              +KEL+D+LN+ILKK NL  DD  ED   IEEEL 
Sbjct: 354 NRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKTIEEELN 413

Query: 411 IXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSID 470
                       +  +  K Y ++ +LPH RFNA+TA+V+DTL+IFGG WE GEKDY ID
Sbjct: 414 ----KLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMID 469

Query: 471 SFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKLVX 530
           SFYSID+NK+DGV VYWEDM  +E AKELGE+                      D+KLV 
Sbjct: 470 SFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKLV- 528

Query: 531 XXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNR----DS 586
                                RPWLPHPK FE+LRAFYVRTGA+FLEWAI+N      D+
Sbjct: 529 AEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSDA 588

Query: 587 KGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           KGKHLKK SF+L ++RWWERR+QVRIEEDK+EELGG+  ++E+D T+  KRR
Sbjct: 589 KGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/596 (60%), Positives = 446/596 (74%), Gaps = 19/596 (3%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGE---NTSTTTTFYNDL 111
           NF+K+QE F+++ +  V +P+ R N CM+ NP HGK EL++FGGE    TS+TTTFYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           FTY+ + DQWKK TS+N+PMPRSS+A   HP+G+ L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           C++KEW+K++ KNGPSARSGHRMTVWKNF ++HGGFRDLGTSTTYL D WLFD+T YKW 
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QVEFPPNH +PDARSGHSLIPTQ+GA++WGGYCK+KA KGLQKGKIL+DCWYL+MKSD++
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
           GIRWERRKKQGFQPSPRVGCSM HHKGRGILFGGV+D+EETEE L S F+NDL +YQ+E 
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 352 NRWFSLSMRSQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLT---DDDSEDPNAIEEE 408
           NRW+S+ MR Q+              + EL  ILN IL+K NL    ++++E  + IE+E
Sbjct: 354 NRWYSIKMRPQKKKIVAASKSAKSKDD-ELVGILNDILQKANLADEENEENESDSEIEKE 412

Query: 409 LKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYS 468
           L               G   KQY V+ QLPH RFNA T VV+DTL+IFGGSWE GE+D+S
Sbjct: 413 LHRLDEEELL------GHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFS 466

Query: 469 IDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKL 528
           IDSFYSIDLN+ DGV V+WED+EEIE AK+ G +                    + ++ +
Sbjct: 467 IDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELI 526

Query: 529 VXXXXXXXXXXXXXXXXXXXXX------XRPWLPHPKPFETLRAFYVRTGATFLEWAISN 582
                                        RPWLPHPK FETLRAFY+RTGA FL+WAISN
Sbjct: 527 AEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISN 586

Query: 583 NRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           NR +KGKHLKK+SF+L++DRWWERR+QVRIEEDK+EE+GG+ENI+ERD++   KRR
Sbjct: 587 NRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/593 (62%), Positives = 446/593 (75%), Gaps = 12/593 (2%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPI--HGKNELILFGGENT---STTTTFYN 109
           NFKK+QEQFEK+ +++V K  KR+N CM+ NP     K ELI+FGGE T   ++TTTFYN
Sbjct: 52  NFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYN 111

Query: 110 DLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWL 169
           DL T+ PEN+QWK+YTSQN+PMPRSS+AM +HP+GIALLHGGEFSSPKQNTFYHYSDTW+
Sbjct: 112 DLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWI 171

Query: 170 LDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYK 229
           LDC TKEW+KV+ K GPSARSGHR+TVWKNF ILHGGFRDLGTSTTYL D WLFD+T YK
Sbjct: 172 LDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYK 231

Query: 230 WTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAG-KGLQKGKILSDCWYLKMKS 288
           W QVEFP NH +PDARSGHS IPT +GA+LWGGYCKVKA  KG QKGKILSDCWYLKMKS
Sbjct: 232 WKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKMKS 291

Query: 289 DVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQ 348
           D+SGIRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESL+S F+NDLF+Y 
Sbjct: 292 DISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYH 351

Query: 349 IEINRWFSLSMRSQRXXXXXXXXXX---XXXXEKELQDILNSILKKNNLTDDDSEDPNAI 405
           IE NRW+SLS+RS++                 EKEL+ +L+SIL+K NL D   +D +  
Sbjct: 352 IESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDEDDE 411

Query: 406 EEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEK 465
           E    +              Q+  Q+ ++ QLPH RFNATT V++DTL+IFGG WELG+K
Sbjct: 412 EINTALAKVDLEDEEEE---QLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 466 DYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVD 525
           ++ IDS YSIDLNKLDGVT+YWED++EIE AKELG + S                    +
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNE 528

Query: 526 QKLVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRD 585
           +                         RPWLPHPKPFETLRAFY+R GA FLEWAISNN++
Sbjct: 529 KDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588

Query: 586 SKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           +KGKHLKK SF+L ++RWWERRDQ+RIEEDK+EE+GG+ +I+ERD +  +KRR
Sbjct: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/590 (62%), Positives = 441/590 (74%), Gaps = 6/590 (1%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDL 111
           NFK QQEQFE +N+E++SKP +R+NSCMI+ P H K EL++FGGE T   ++ T FYN+L
Sbjct: 55  NFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNEL 114

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
            TY+P+N QW+K TSQNSPMPRSS+AM +HP+GIALLHGGEFSSPKQNTFYHYSDTWLLD
Sbjct: 115 ITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
             TKEW+K+++  GP  RSGHR+T+WKN+ IL GGF+DLG ST+Y  D W FD+T YKW 
Sbjct: 175 THTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWK 234

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           Q+EFPPNH IPDARSGHS IPT++G +LWGGYCKVKAGKGLQKGKIL+DCWYLKMKSD+S
Sbjct: 235 QIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSDLS 294

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            +RWERRKKQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESL+S+FYNDLF+Y +E 
Sbjct: 295 QVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVES 354

Query: 352 NRWFSLSMRSQ---RXXXXXXXXXXXXXXEKELQDILNSILKKNNLTDDDSEDPNAIEEE 408
           NRWFSLS+R     +              EKELQD+LN IL+KNNL DDD +D  +   E
Sbjct: 355 NRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEISTGTE 414

Query: 409 LKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYS 468
            +            K+   + Q  VM+QLPH RFNA T VV+D+L+I+GG WE+GEKDY+
Sbjct: 415 TETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYA 474

Query: 469 IDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXIVDQKL 528
           IDS YSIDLNKLDGV+ YWED++EIE AKE+GEQ S                     + +
Sbjct: 475 IDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIEDKKLV 534

Query: 529 VXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKG 588
                                  RPWLPHPKPFE+LRAFY+R GA FLEWAISNN+  +G
Sbjct: 535 AEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKHVRG 594

Query: 589 KHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638
           KHLKKKSF+L EDRWWERRDQVRIEEDK+EELG + N++E+DT+    +R
Sbjct: 595 KHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/609 (58%), Positives = 432/609 (70%), Gaps = 51/609 (8%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTS---TTTTFYNDL 111
           NFKK+QE +EKINIE+V KP+ R N  +IS+    K EL+LFGGE+TS    TT FYNDL
Sbjct: 54  NFKKEQENYEKINIESVEKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFYNDL 111

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           +T++P+N+QWK+ TSQNSPMPRSS+AM +HP+GIALL+GGEFSSPKQ+TFYHYSDTW+LD
Sbjct: 112 YTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILD 171

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
             TKEW+K+E K  P  RSGHR+T WKN+ IL GGF+DLG STTY  D+WLFD+T YKW 
Sbjct: 172 LTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWK 231

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVS 291
           QVEFP NH +PDARSGHSLIPT +G +++GGYCK+KA KGLQKGK+LS CW LKMK+DV 
Sbjct: 232 QVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMKADVE 291

Query: 292 GIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEI 351
            IRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESL+S+FYNDLFTY IE 
Sbjct: 292 AIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIES 351

Query: 352 NRWFSLSMRSQRXXX---XXXXXXXXXXXEKELQDILNSILKKNNLT------------- 395
           NRWF+++++ +                  E+ELQD+LN IL+KNNL              
Sbjct: 352 NRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEEESSDIF 411

Query: 396 ----DDDSEDPNAIEEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVND 451
               +DD E  N I+                         + + QLPH RFNATT V++D
Sbjct: 412 GSDDEDDEEQKNKID------------------------IKTVTQLPHPRFNATTTVIDD 447

Query: 452 TLYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXX 511
            LYI+GG+WE GE DYSIDSFYSIDLNKLDGV VYWED+ EIE AKELGEQ S       
Sbjct: 448 MLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDD 507

Query: 512 XXXXXXXXXXXIVDQKLVXXXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRAFYVR 570
                      + D KL+                       RPWLPHPK FE+LRAFY+R
Sbjct: 508 FEEDEEDGEEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLR 567

Query: 571 TGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD 630
            G  FLEWAISNNR ++GK LK+KSFEL +DRWWERRDQ+ IEEDK+EE+G + ++VERD
Sbjct: 568 EGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERD 627

Query: 631 TTQ-VNKRR 638
           T++ V+KRR
Sbjct: 628 TSKAVSKRR 636

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/609 (57%), Positives = 427/609 (70%), Gaps = 26/609 (4%)

Query: 55  NFKKQQEQFEKINIETVSKP-----TKRINSCMISNP-IHGKN--ELILFGGENTST--- 103
           NFK +QE+FEKIN+E + +      + R NS MI+    H K   EL++FGGE TS    
Sbjct: 56  NFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETG 115

Query: 104 TTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYH 163
            T FYNDL +Y P+  QW+K TSQNSPMPRSS+AM  HP+GIA+LHGGEFSSPKQNTFYH
Sbjct: 116 MTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYH 175

Query: 164 YSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWL 222
           YSDTW+LD +TKEW+KV+ K  P ARSGHR+  WKN+ +L GGF+D+G + T Y  D+W 
Sbjct: 176 YSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWC 235

Query: 223 FDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKA--GKGLQKGKILSD 280
           FD+  YKWTQVEFP NH +PD RSGHS IP ++G +LWGGY KVK+    G QKGKIL+D
Sbjct: 236 FDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKILND 295

Query: 281 CWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLF 340
           CWYLKMKSD+S IRWERRKK GFQPSPRVGCSM +HKGRGILFGGV+DF+ETEESL+SLF
Sbjct: 296 CWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLF 355

Query: 341 YNDLFTYQIEINRWFSLSMRSQR---XXXXXXXXXXXXXXEKELQDILNSILKKNNLTDD 397
           YNDLF+Y +E NRWF+L++R  +                 EKELQD+LN IL+KNNL D+
Sbjct: 356 YNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNLKDE 415

Query: 398 DSEDPNAIEEELK-IXXXXXXXXXXXKDGQVTKQ----YEVMNQLPHVRFNATTAVVNDT 452
           D ED   + E                +D + T Q      +MNQLPH R+N    VV+D 
Sbjct: 416 DDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDL 475

Query: 453 LYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFS--XXXXXX 510
           L+I+GGSWELGEKDY I+SFYSIDLN++DGVT YWED++EIE AKELGEQ S        
Sbjct: 476 LFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDD 535

Query: 511 XXXXXXXXXXXXIVDQKLVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVR 570
                       I DQKLV                      RPWLPHPKPFE+LRAFY+R
Sbjct: 536 EEDDDEDDDEEEIKDQKLV-ADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFYIR 594

Query: 571 TGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD 630
            G  FLEWAISNN+  +GKHLKKKSFEL EDRWWERRDQ+RIEEDK+EELG + +++E+D
Sbjct: 595 EGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKD 654

Query: 631 TTQ-VNKRR 638
           T++  +KRR
Sbjct: 655 TSKGASKRR 663

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/589 (52%), Positives = 396/589 (67%), Gaps = 15/589 (2%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGE---NTSTTTTFYNDL 111
           NFK +QEQFEK+ +E V  PT R N+C+++N    K EL+LFGGE   N +  T FYNDL
Sbjct: 56  NFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDL 113

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
             YNP+N+QWKK+TSQNSPMPRSS+AM SH +G+ +L GGEFSSPKQNTFYHY+DTWLLD
Sbjct: 114 HVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLD 173

Query: 172 CATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
             T+EWSK++ KNGPSARSGHR+T WKN+ IL GGF+DL   T+Y  D+WLF+V  +KWT
Sbjct: 174 NTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWT 233

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKA--GKGLQKGKILSDCWYLKMKSD 289
           + E   N   PD RSGHS I + +G +++GGYCKVKA   K L KGK L+DCW LKM  +
Sbjct: 234 KWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQN 292

Query: 290 VSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQ 348
           V+ I+WERR K+G QPSPRVGCSM +H   RGILFGGV+D EETEE L S++YNDL++Y 
Sbjct: 293 VNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYN 352

Query: 349 IEINRWFSLSMR-----SQRXXXXXXXXXXXXXXEKELQDILNSILKKNNLTDDDSEDPN 403
           IE NRW+ L +R     S                EKELQD+LN IL++N+L D+++   +
Sbjct: 353 IESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNSYS 412

Query: 404 AIEEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELG 463
                 +            ++ ++      +NQLPH RFNA T V+NDT YI+GG WE  
Sbjct: 413 GSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFK 472

Query: 464 EKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXXXXXXI 523
           + DY+IDSFYSIDLNKLDG+T Y+E+++EIE  K LG+  S                   
Sbjct: 473 DNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGEAEP 532

Query: 524 VDQKLVXXXXXXXXXXXXXXXXXXXX-XXRPWLPHPKPFETLRAFYVRTGATFLEWAISN 582
            +++L                        RPWLPHPK FE+LR FY+R G  FLEWAISN
Sbjct: 533 TNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISN 592

Query: 583 NRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDT 631
           N+ +KGKHLK+KSFEL +DRWWERRDQ++IEEDK++ELG   +I+ERD 
Sbjct: 593 NKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDA 641

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/609 (49%), Positives = 387/609 (63%), Gaps = 39/609 (6%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDL 111
           +F K+Q + E ++I +V KP+ R +  M +NP H K+EL +FGGE T   +  T FYNDL
Sbjct: 57  SFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDL 116

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           ++Y+ +N+ WKKY SQN+P+PRSS+A+  HP+GIALLHGGEFSSPKQ+ FYHYSDTWL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 172 CATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTK 227
           C  ++++K+E     + PSARSGHR+  WKN+ IL GGFRDLG   T+YL DLW FD++ 
Sbjct: 177 CVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIST 236

Query: 228 YKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKV--KAGKGLQKGKILSDCWYLK 285
           YKWT++E    ++ PDARSGH  IPT + A+L GGYCK+  K  K L KGKIL+D W L 
Sbjct: 237 YKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293

Query: 286 MKSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYNDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353

Query: 345 FTYQIEINRWFSLSMRSQRXXXXXXXXXXXXX-----XEKELQDILNSILKKNNL----- 394
           + + +E+N+W  L ++ QR                   EKELQD+LNSIL K+NL     
Sbjct: 354 YMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDD 413

Query: 395 --TDDDSEDPNAIEEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDT 452
              D+ +  PN+I+++                    +   + NQLPH RFNA T VV D+
Sbjct: 414 DNDDNSTTGPNSIDDDEDNEDDSDL--------DNQEDITISNQLPHPRFNAATCVVGDS 465

Query: 453 LYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXX 512
           L+I+ G WELGEKDY I+SFYSIDLNKLDGV VYWED+  IE AK LG++ S        
Sbjct: 466 LFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYE 525

Query: 513 XXXXXXXXXXIVDQK--LVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVR 570
                            L                       R WLPHPKPFETLRAFY+R
Sbjct: 526 DDEEDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLR 585

Query: 571 TGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD 630
            GA FL W+ISNNR+ KGK LK KSFEL EDRWWERRDQV +EE+++E+ GG   I+ERD
Sbjct: 586 EGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERD 642

Query: 631 -TTQVNKRR 638
            TT+ +KRR
Sbjct: 643 TTTKPSKRR 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/604 (48%), Positives = 383/604 (63%), Gaps = 26/604 (4%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDL 111
           +F K+Q + E ++I  V +P+ R++  M +NP H K+EL +FGGE T   +  T FYNDL
Sbjct: 57  SFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDL 116

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           ++Y+ +N+ WKKY SQN+P+PRSS A+  H +GIALLHGGEFSSPKQ+ FYHYSDTWL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 172 CATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTK 227
           C  K+++K+E     + PSARSGHR+  WKN+ IL GGFRDLG+  T+YL DLW FD++ 
Sbjct: 177 CHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISN 236

Query: 228 YKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCK--VKAGKGLQKGKILSDCWYLK 285
           YKWT++E    +  PDARSGH  +PT + A+L GGYCK   K  K L KGKIL+D W L 
Sbjct: 237 YKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLT 293

Query: 286 MKSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLDS+FYNDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDL 353

Query: 345 FTYQIEINRWFSLSMRSQRXXX-----XXXXXXXXXXXEKELQDILNSILKKNNLTDDDS 399
           + + +E+N+W  L ++ QR                   EKELQD+LNSIL K+NL D++ 
Sbjct: 354 YMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEED 413

Query: 400 EDPNAIEEELKIXXXXXXXXXXXKDGQVTKQ-YEVMNQLPHVRFNATTAVVNDTLYIFGG 458
           ++ ++                        ++   + NQLPH RFNA T VV+D+L+I+ G
Sbjct: 414 DNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSG 473

Query: 459 SWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXXXX 518
            WELGEKDY I+SFYSIDLNKLDGV VYWED+  +E AK LG++ S              
Sbjct: 474 VWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDE 533

Query: 519 XXXXIVDQK---LVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGATF 575
                  Q    L                       R WLPHPKPFETLRAFY+R GA F
Sbjct: 534 DDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 593

Query: 576 LEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD-TTQV 634
           L W+ISNNR+ KGK LK KSFEL EDRWWERRDQV +EE+++E+ GG   I+ERD T + 
Sbjct: 594 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKP 650

Query: 635 NKRR 638
           +KRR
Sbjct: 651 SKRR 654

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/609 (48%), Positives = 391/609 (64%), Gaps = 38/609 (6%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDL 111
           +F K+Q + E ++I  V + + R +  M +NP H K EL +FGGE T   +  T FYNDL
Sbjct: 57  SFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDL 116

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           ++Y+ +N+ WKKY S+N+P+PRSS+A+  HP+GIALLHGGEFSSPKQ+ FYHYSDTWL D
Sbjct: 117 YSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 172 CATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTK 227
           CA ++++K+E     + PSARSGHR+  WKN+ IL GGFRDLG   T+YL DLW FD++ 
Sbjct: 177 CAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISN 236

Query: 228 YKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKV--KAGKGLQKGKILSDCWYLK 285
           YKWT++E    +  P+ARSGH  IPT + A+L GGYCK+  K  K L KGKIL+D W L 
Sbjct: 237 YKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293

Query: 286 MKSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYNDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353

Query: 345 FTYQIEINRWFSLSMRSQRXXXX-----XXXXXXXXXXEKELQDILNSILKKNNLTDDDS 399
           + + +E+N+W  L ++ QR                   EKELQD+LNSIL K+NL DDD 
Sbjct: 354 YMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDDDD 413

Query: 400 ED-----PNAIEEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLY 454
           +D      N+I+ + +                  +   + NQLPH RFNA T VV+D+L+
Sbjct: 414 DDNTTTGSNSIDGDDEGEDDDSDLDN-------PENITISNQLPHPRFNAATCVVDDSLF 466

Query: 455 IFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXX 514
           I+ G WELGEKDY I+SFYSIDLNKLDGV VYWED+  IE AK LG++ S          
Sbjct: 467 IYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDD 526

Query: 515 XXXXXXXXIVDQKLVXXXXXXXXXXXXXXXXXXXXXXRP----WLPHPKPFETLRAFYVR 570
                     +++ V                       P    WLPHPKPFETLRAFY+R
Sbjct: 527 DDDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLR 586

Query: 571 TGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD 630
            GA FL W+ISNN+D KGKHLK KSFE+ EDRWWERRDQV +EE+++E+ GG   I+ERD
Sbjct: 587 EGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERD 643

Query: 631 -TTQVNKRR 638
            TT+++KRR
Sbjct: 644 TTTKISKRR 652

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/605 (49%), Positives = 384/605 (63%), Gaps = 31/605 (5%)

Query: 55  NFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTTT---FYNDL 111
           +F K+Q + E ++I  V +P+ R +  M +NP H K+EL +FGGE T + T    FYNDL
Sbjct: 57  SFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDL 116

Query: 112 FTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLD 171
           ++Y+ +N+ WKKY SQN+P+PRSS+A+  HP+GIALLHGGEFSSPKQ+ FYHYSDTWL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 172 CATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTK 227
           C  ++++K+E     + PSARSGHR+  WKN+ IL GGFRDLG   T+YL DLW FD++ 
Sbjct: 177 CVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISN 236

Query: 228 YKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCK--VKAGKGLQKGKILSDCWYLK 285
           YKW+++E    ++ PDARSGH  IPT + A+L GGYCK   K  K L KGKIL+D W L 
Sbjct: 237 YKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLN 293

Query: 286 MKSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYNDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353

Query: 345 FTYQIEINRWFSLSMRSQRXXX-----XXXXXXXXXXXEKELQDILNSILKKNNLTDDDS 399
           + + +E+N+W  L ++SQR                   EKELQD+LNSIL K+NL DDD 
Sbjct: 354 YMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDD 413

Query: 400 EDPNAI---EEELKIXXXXXXXXXXXKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIF 456
           E+ +        +                 +T    + NQLPH RFNA T VV D+L+I+
Sbjct: 414 ENDDYTATGSNSIDGDEDEEDDSDLDNQEDIT----ISNQLPHPRFNAATCVVGDSLFIY 469

Query: 457 GGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSXXXXXXXXXXXX 516
            G WELGEKDY I+SFYSIDLNKLDGV VYWE++  IE AK LG++ S            
Sbjct: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEED 529

Query: 517 XXXXXXIVDQK--LVXXXXXXXXXXXXXXXXXXXXXXRPWLPHPKPFETLRAFYVRTGAT 574
                        L                       R WLPHPKPFETLRAFY+R GA 
Sbjct: 530 DEDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589

Query: 575 FLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD-TTQ 633
           FL W+ISNNR+ KGK LK KSFEL EDRWWERRDQV +EE+++E+ GG   I+ERD TT+
Sbjct: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTK 646

Query: 634 VNKRR 638
            +KRR
Sbjct: 647 PSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 103/250 (41%), Gaps = 44/250 (17%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDC---AT 174
           W +   QNSP PR    SSA  +    I +L G    S        Y DTW++ C   AT
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQS-------VYGDTWIISCNPDAT 191

Query: 175 KEWSKVEN--KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           +  SK  +  +N P  R GH  T+  N FI+  G    +        D++LF++  YKWT
Sbjct: 192 QFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKWT 251

Query: 232 QVEFP-PNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS-D 289
               P P    P  R GH +       +L     K K       G    D ++  +   D
Sbjct: 252 ---IPNPIGPRPLGRYGHKI------CILATSTVKTKL---YLFGGQFDDTYFNDLAVFD 299

Query: 290 VSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +S  R     WE  K +GF P P    +MV +     ++GG     +T++ L     ND+
Sbjct: 300 LSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL----INDI 350

Query: 345 FTYQIEINRW 354
           F +    N W
Sbjct: 351 FKFSPNTNTW 360

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 18/148 (12%)

Query: 74  PTKRINSCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMP 132
           P    N  M++   +G ++L ++GG+   T     ND+F ++P  + W K  T+   P P
Sbjct: 320 PPPLTNHTMVT---YG-SDLWIYGGD---TQQGLINDIFKFSPNTNTWTKVETTGTKPPP 372

Query: 133 RSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVEN-KNG-PSARS 190
               A + +   + ++ G +     +N  Y  S  +L +  + +W    + K+G    RS
Sbjct: 373 MQEHAAVVYKNIMCVVGGKD-----ENDMYLNS-VYLFNFDSSKWYTFPDFKSGIIQGRS 426

Query: 191 GHRMTVWKN--FIILHGGFRDLGTSTTY 216
           GH +T+  N   +I+ G   D      Y
Sbjct: 427 GHSVTLLNNDKLLIMGGDKYDFARPGDY 454

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 106/258 (41%), Gaps = 42/258 (16%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +   QNSP PR    +SA ++    I ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 175 K-EWSKVE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           K   + ++ ++  P  R GH   +  N F++  G    +        D++L ++  YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS-DV 290
                P    P  R GH +      +++     K K       G    D ++  +   D+
Sbjct: 226 VPA--PVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 291 SGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345
           S  R     WE  K + F P P    +M+ +  +  +FGG        ++L  L  ND+F
Sbjct: 275 SSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--------DTLQGLI-NDVF 325

Query: 346 TYQIEINRWFSLSMRSQR 363
            Y   IN WF +    ++
Sbjct: 326 MYDPAINDWFIIETTGEK 343

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 95/223 (42%), Gaps = 34/223 (15%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L +FGG+      T++NDL  Y+      P++  W+    +  +P P ++  MIS+ 
Sbjct: 251 KTKLYVFGGQ---FDDTYFNDLAVYDLSSFRRPDS-HWEFLKPKAFTPPPITNFTMISYD 306

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKN-GPSARSGHRMTVWKNFI 201
           + + +  G              +D ++ D A  +W  +E     P     H   V+ + +
Sbjct: 307 SKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLM 359

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWG 261
            + GG  +      YL  ++  ++  +KW ++       IP  RSGHSL   +D  +L  
Sbjct: 360 CVVGGKDE---HDAYLNSVYFLNLKSHKWFKLPVF-TAGIPQGRSGHSLTLLKDDKILIM 415

Query: 262 G-----YCKVK------AGKGLQKGKILSDCWYLKMKSDVSGI 293
           G     Y +V+      +   LQ+G I+      ++K    GI
Sbjct: 416 GGDKFDYARVEEFDLHTSDIDLQRGTIVYTLDLARIKDLCPGI 458

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 105/264 (39%), Gaps = 54/264 (20%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEW 177
           W +   QNSP PR    +S++IS    + ++ G    S        Y DTW+L C   + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 178 SKVEN-------KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYK 229
           S + +       +  P  R GH  T+  N F+I  G             D++LF++  YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 230 WTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQK-----GKILSDCWYL 284
           WT         IP     H + P   G   +G    + A K +Q      G    D ++ 
Sbjct: 244 WT---------IP-----HPIGPRPKGR--YGHKISIIARKQMQTKLYLFGGQFDDNYFN 287

Query: 285 KMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDS 338
            +   D+S  R     WE  K + F P P    +MV +  +  +FGG        ++L+ 
Sbjct: 288 DLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--------DTLEG 339

Query: 339 LFYNDLFTYQIEINRWFSLSMRSQ 362
           L  N +F Y   +N W  +    Q
Sbjct: 340 LL-NQVFMYDPAVNDWCVVETTCQ 362

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 32/189 (16%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN-----PENDQWKKYTSQN-SPMPRSSSAMISHPT 143
           + +L LFGG+       ++NDL  ++      ++  W+    ++  P P ++  M+S+  
Sbjct: 271 QTKLYLFGGQ---FDDNYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDF 327

Query: 144 GIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVEN-------KNGPSARSGHRMTV 196
            + +  GG+      N  + Y      D A  +W  VE        +N P     H   +
Sbjct: 328 KLWVF-GGDTLEGLLNQVFMY------DPAVNDWCVVETTCQDDDLENMPPPMQEHATLI 380

Query: 197 WKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPN--HAIPDARSGHSL-IPT 253
           +K  + + GG  +      YL D++  ++   KW ++   P     IP  RSGHS+ +  
Sbjct: 381 YKGLMCIVGGKDE---QDHYLNDVYFLNLKSLKWFRL---PRFMDGIPQGRSGHSVTLLK 434

Query: 254 QDGALLWGG 262
            D  L+ GG
Sbjct: 435 NDKLLIMGG 443

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 106/258 (41%), Gaps = 42/258 (16%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +   QNSP PR    +SA ++    I ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 175 K-EWSKVE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           +   + ++ ++  P  R GH   +  N F++  G    +        D++L ++  YKWT
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 232 QVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS-DV 290
                P    P  R GH +      +++     K K       G    D ++  +   D+
Sbjct: 226 VPA--PVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYDL 274

Query: 291 SGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345
           S  R     WE  K + F P P    +M+ +  +  +FGG        ++L  L  ND+F
Sbjct: 275 SSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--------DTLQGLV-NDVF 325

Query: 346 TYQIEINRWFSLSMRSQR 363
            Y   IN WF +    ++
Sbjct: 326 MYDPAINDWFIIDTTGEK 343

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 95/223 (42%), Gaps = 34/223 (15%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L +FGG+      T++NDL  Y+      P++  W+    +  +P P ++  MIS+ 
Sbjct: 251 KTKLYVFGGQ---FDDTYFNDLAVYDLSSFRRPDS-HWEFLKPRTFTPPPITNFTMISYD 306

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENK-NGPSARSGHRMTVWKNFI 201
           + + +  G              +D ++ D A  +W  ++     P     H   V+ + +
Sbjct: 307 SKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDLM 359

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSL-IPTQDGALLW 260
            + GG  +      YL  ++  ++   KW ++       IP  RSGHSL +   D  L+ 
Sbjct: 360 CVVGGKDE---HDAYLNSVYFLNLKSRKWFKLPVF-TAGIPQGRSGHSLTLLKNDKILIM 415

Query: 261 GG----YCKVK------AGKGLQKGKILSDCWYLKMKSDVSGI 293
           GG    Y +V+      +   +Q+G I+      ++K    G+
Sbjct: 416 GGDKFDYARVEEYDLHTSDIDMQRGTIVYTLDLARIKDLCPGV 458

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 104/251 (41%), Gaps = 44/251 (17%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +   Q+SP PR    SSA ++    I ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 175 K-EWSKVE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           K   + ++ ++  P  R GH   +  N F++  G    +        D++L ++  YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 232 QVEFP-PNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS-D 289
               P P    P  R GH +      +++     K K       G    D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATNQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 290 VSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +S  R     WE  K + F P P    +M+ +  +  +FGG        ++L  L  ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--------DTLQGLV-NDV 324

Query: 345 FTYQIEINRWF 355
           F Y   +N WF
Sbjct: 325 FMYDPALNDWF 335

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 94/223 (42%), Gaps = 34/223 (15%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L +FGG+      T++NDL  Y+      P++  W+    +  SP P ++  MIS+ 
Sbjct: 251 KTKLYVFGGQ---FDDTYFNDLAVYDLSSFRRPDS-HWEFLKPKTFSPPPITNFTMISYD 306

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENK-NGPSARSGHRMTVWKNFI 201
           + + +  G              +D ++ D A  +W  +E     P     H   V+ + +
Sbjct: 307 SKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYNDLM 359

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSL-IPTQDGALLW 260
            + GG  +      YL  ++  ++   KW ++       IP  RSGHSL +   D  L+ 
Sbjct: 360 CVVGGKDE---HDAYLNSVYFLNLKSNKWFKLPVF-TAGIPQGRSGHSLTLLKNDKILIM 415

Query: 261 GG----YCKVKAGK------GLQKGKILSDCWYLKMKSDVSGI 293
           GG    Y +V+          +QKG I+      ++K    G+
Sbjct: 416 GGDKFDYARVEESDLHTSDIDMQKGTIVYTLDLARIKDLCPGV 458

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 106/262 (40%), Gaps = 54/262 (20%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +    NSP PR    +SA  +    I ++ G    S        Y DTW+L   + A+
Sbjct: 134 WNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQS-------VYGDTWILTSENNAS 186

Query: 175 KEWSKVEN--KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           +  S+  +   N P  R GH  T+  N FII  G    +        DL+LF++  +KWT
Sbjct: 187 RFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINSHKWT 246

Query: 232 QVEFP-PNHAIPDARSGH--SLIPTQDGAL---LWGGYCKVKAGKGLQKGKILSDCWYLK 285
               P P    P  R GH  S+I T +      L+GG                 D ++  
Sbjct: 247 ---IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQ--------------FDDAYFND 289

Query: 286 MKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSL 339
           +   D+S  R     WE  K + F P P    +MV +  +  +FGG        ++L  L
Sbjct: 290 LVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG--------DTLQGL 341

Query: 340 FYNDLFTYQIEINRWFSLSMRS 361
             N +F Y   IN W ++   S
Sbjct: 342 -TNRVFMYDPMINDWTTIETSS 362

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 30/210 (14%)

Query: 88  HGKNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMIS 140
           + K  L LFGG+       ++NDL  ++      P++ +W+    ++  P P ++  M+S
Sbjct: 270 NSKTRLYLFGGQ---FDDAYFNDLVVFDLSSFRRPDS-RWEFVKPKSFVPPPLTNHTMVS 325

Query: 141 HPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNF 200
           +   + +  GG+      N  + Y D  + D  T E S     N       H   V+K+ 
Sbjct: 326 YDNKLWVF-GGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQEHAAIVYKDL 383

Query: 201 IILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVE-FPPNHAIPDARSGHSL-IPTQDGAL 258
           + + GG  +     TYL  ++  ++   KW ++  F P   IP  RSGHS+ +   D  L
Sbjct: 384 MCIFGGKDE---QDTYLNGVYFLNLRTLKWYKLPIFAP--GIPQGRSGHSITLLKNDKLL 438

Query: 259 LWGG----YCKVK------AGKGLQKGKIL 278
           + GG    Y +V       +   + KG IL
Sbjct: 439 IMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 109/274 (39%), Gaps = 65/274 (23%)

Query: 110 DLFTYNPE-----NDQWKKYTSQNSPMPRSSSAMISHPTG------IALLHGGEFSSPKQ 158
           ++F+ +PE     N  W +   ++SP PR      S+ T       I  LH        Q
Sbjct: 181 NVFSPSPELVPKGNVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLH-------DQ 233

Query: 159 NTFYHYSDTWL---LDCATKEWSKVEN--KNGPSARSGHRMTVWKN-FIILHGGFRDLGT 212
           + F    D W+   L+  TK  S   +  +N P  R GH  T+  N F++  G    +  
Sbjct: 234 SVF---GDVWIIKSLENGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNK 290

Query: 213 STTYLKDLWLFDVTKYKWTQVEFP-PNHAIPDARSGHSL-----IPTQDGALLWGGYCKV 266
                 DL+LF++  YKWT    P P    P  R GH +      P +    L+GG    
Sbjct: 291 DGLMDDDLYLFNINSYKWT---IPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQ--- 344

Query: 267 KAGKGLQKGKILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRG 320
                        D ++  +   D+S  R     WE  K + F P P    +MV ++ + 
Sbjct: 345 -----------FDDTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKL 393

Query: 321 ILFGGVFDFEETEESLDSLFYNDLFTYQIEINRW 354
            +FGG        ++L  L  N +F Y  E+N W
Sbjct: 394 WIFGG--------DTLQGLI-NKIFMYDPEVNDW 418

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 89/215 (41%), Gaps = 29/215 (13%)

Query: 80  SCMISNPIHGKNELILFGGENTSTTTTFYN-----DLFTYNPENDQWKKYTSQN-SPMPR 133
           S + + P+  K +L LFGG+   T   ++N     DL  +   +  W+    ++  P P 
Sbjct: 327 SIIATTPM--KTKLYLFGGQFDDT---YFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPL 381

Query: 134 SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVEN-------KNGP 186
           ++  M+S+   + +  GG+      N  + Y      D    +W+ VE        +N P
Sbjct: 382 TNHTMVSYQNKLWIF-GGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFP 434

Query: 187 SARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARS 246
                H   ++ + +++ GG  +      YL  ++   +   +W ++ F  +  IP  RS
Sbjct: 435 PPMQEHASVMYGDLMVVMGGKDE---QDNYLNTVYFLKINTLEWYKLPFL-SVGIPQGRS 490

Query: 247 GHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDC 281
           GHS+   +   LL  G  K    +  + G   +D 
Sbjct: 491 GHSITLLKGNKLLIMGGDKFDYARPEEHGLHTTDT 525

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 103/252 (40%), Gaps = 48/252 (19%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +   QNSP PR    +S+  S    + ++ G    S        Y DTW++   D  T
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWIISTNDNGT 193

Query: 175 KEWSK-VE-NKNGPSARSGHRMTVWKNFIILHGG-FRDLGTSTTYLKDLWLFDVTKYKWT 231
           +  SK VE ++  P  R GH  T+  N  +L GG    + +      DL+LF+V  YKWT
Sbjct: 194 QFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKWT 253

Query: 232 QVEFPPNHAI---PDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS 288
               P  H I   P  R GH +      +++     K K       G    D ++  +  
Sbjct: 254 ---IP--HPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFGGQFDDTYFNDLAV 299

Query: 289 -DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYN 342
            D+S  R     WE  K   F P P    +M+ +     +FGG        ++L  L  N
Sbjct: 300 FDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG--------DTLQGLI-N 350

Query: 343 DLFTYQIEINRW 354
            +F Y +  N W
Sbjct: 351 QVFKYDVANNDW 362

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 91/193 (47%), Gaps = 28/193 (14%)

Query: 80  SCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYN------PEND-QWKKYTSQNSPMP 132
           S M +N +  K +L LFGG+      T++NDL  ++      P++  ++ K T+  SP P
Sbjct: 271 SIMAANQM--KTKLYLFGGQ---FDDTYFNDLAVFDLSSFRRPDSHWEFLKPTT-FSPPP 324

Query: 133 RSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENK-NGPSARSG 191
            ++  MIS+   + +  GG+      N  + Y      D A  +WS  E     P     
Sbjct: 325 LTNHTMISYDNHLWVF-GGDTLQGLINQVFKY------DVANNDWSIAETTGTKPPPMQE 377

Query: 192 HRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHA-IPDARSGHSL 250
           H   V+K+ +++ GG  +     TYL  ++  ++  ++W   + P   A IP  RSGHSL
Sbjct: 378 HAAVVYKHVMVVVGGKDE---HDTYLNSVYFLNLKTHEW--FKLPTFKAGIPQGRSGHSL 432

Query: 251 -IPTQDGALLWGG 262
            +   D  L+ GG
Sbjct: 433 TLLNNDKLLIMGG 445

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 101/252 (40%), Gaps = 49/252 (19%)

Query: 121 WKKYTSQNSPMPRSSSAMISHPT--GIALLHGGEFSSPKQNTFYHYSDTWLL---DCATK 175
           W ++    SP PR      SH +      + GG     ++ + Y   D W +   D  + 
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVY--GDVWSINHKDDKSF 90

Query: 176 EWSKVE-NKNGPSARSGHRMTVWKNFIILHGG-FRDLGTSTTYLKDLWLFDVTKYKWTQV 233
             S +E     P  R GH  T+  N +IL GG    +        DL+LF++  YKWT  
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIP 150

Query: 234 EFPPNHAIPDARSGH--SLI---PTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS 288
           E  P    P  R GH  S+I   PT+    L+GG                 D ++  +  
Sbjct: 151 E--PIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ--------------FDDTYFNDLSM 194

Query: 289 -DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYN 342
            D+S  R     WE  K + F P P    +M+ +  +  +FGG        E+L  L  N
Sbjct: 195 FDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG--------ETLQGLI-N 245

Query: 343 DLFTYQIEINRW 354
           ++F Y   +N W
Sbjct: 246 EVFVYDPIVNDW 257

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 89/190 (46%), Gaps = 23/190 (12%)

Query: 80  SCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYNPE-----NDQWKKYTSQNS-PMPR 133
           S + SNP+  K  L LFGG+      T++NDL  ++       N  W+        P P 
Sbjct: 203 SIIASNPMQTK--LYLFGGQ---VDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPL 257

Query: 134 SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKN-GPSARSGH 192
           ++  M+++   + +  GGE  +PK  +    +DT+  D A  EWSKV+     P     H
Sbjct: 258 TNHTMVAYDNKLWVF-GGE--TPKTIS----NDTYRYDPAQSEWSKVKTTGEKPPPIQEH 310

Query: 193 RMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIP 252
              V+K+ + + GG +D  T   Y  D++  ++   KW ++       IP  RSGHSL  
Sbjct: 311 ASVVYKHLMCVLGG-KD--THNAYSNDVYFLNLLSLKWYKLPRM-KEGIPQERSGHSLTL 366

Query: 253 TQDGALLWGG 262
            ++  LL  G
Sbjct: 367 MKNEKLLIMG 376

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 103/255 (40%), Gaps = 54/255 (21%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL----DCA 173
           W +   +NSP PR   SSS ++++   I +  G    S        Y D W +    D  
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 174 TKEWSKVE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           +    +++ ++N P  R GH  T+  N +++  G    L  +     DL+LF++  YKWT
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 232 QVEFPPNHAIPDARSGH--SLI---PTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLK- 285
             +  P    P  R GH  S+I   P Q    L+GG                 D  Y   
Sbjct: 186 IPQ--PIGRRPLGRYGHKISIIASNPMQTKLYLFGGQV---------------DETYFND 228

Query: 286 -MKSDVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSL 339
            +  D+S  R     WE  +  G  P P    +MV +  +  +FGG     ET +++   
Sbjct: 229 LVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS-- 281

Query: 340 FYNDLFTYQIEINRW 354
             ND + Y    + W
Sbjct: 282 --NDTYRYDPAQSEW 294

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 63/132 (47%), Gaps = 16/132 (12%)

Query: 91  NELILFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMPRSSSAMISHPTGIALLH 149
           N+L +FGGE   T  T  ND + Y+P   +W K  T+   P P    A + +   + +L 
Sbjct: 267 NKLWVFGGE---TPKTISNDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKHLMCVLG 323

Query: 150 GGEFSSPKQNTFYHYS-DTWLLDCATKEWSKVEN-KNG-PSARSGHRMTVWKN--FIILH 204
           G       ++T   YS D + L+  + +W K+   K G P  RSGH +T+ KN   +I+ 
Sbjct: 324 G-------KDTHNAYSNDVYFLNLLSLKWYKLPRMKEGIPQERSGHSLTLMKNEKLLIMG 376

Query: 205 GGFRDLGTSTTY 216
           G   D  +   +
Sbjct: 377 GDKTDYASPNIH 388

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 105/255 (41%), Gaps = 54/255 (21%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +   Q+SP PR    +S+ +S    I ++ G    S        Y DTW++   D  T
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDES-------VYGDTWIINVDDSGT 146

Query: 175 KEWSKVENKN--GPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           +  SK  + +   P  R GH  T+  N F+I  G    + +      DL+LF++  +KWT
Sbjct: 147 QFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKWT 206

Query: 232 QVEFP-PNHAIPDARSGH--SLIPT---QDGALLWGGYCKVKAGKGLQKGKILSDCWYLK 285
               P P    P  R GH  S+I T   +    L+GG                 D ++  
Sbjct: 207 ---IPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQ--------------FDDTFFND 249

Query: 286 MKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSL 339
           +   D+S  R     WE  K + F P P    +MV +  +  +FGG        +++  L
Sbjct: 250 LAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG--------DTMQGL 301

Query: 340 FYNDLFTYQIEINRW 354
             N +F Y I  N W
Sbjct: 302 I-NKVFVYDIMSNDW 315

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 23/181 (12%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN-----PENDQWKKYTSQN-SPMPRSSSAMISHPT 143
           K +L LFGG+      TF+NDL  Y+       +  W+    +   P P ++  M+S+  
Sbjct: 232 KTKLYLFGGQ---FDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDH 288

Query: 144 GIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNG-PSARSGHRMTVWKNFII 202
            + +  GG+      N  + Y      D  + +WS VE     P     H   ++K+ + 
Sbjct: 289 KLWIF-GGDTMQGLINKVFVY------DIMSNDWSLVETTGARPPPLQEHAALIYKDLMC 341

Query: 203 LHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHA-IPDARSGHSLIPTQDGALLWG 261
           + GG  +      YL  ++  ++   +W   +FP   A IP  RSGHS+   ++  +L  
Sbjct: 342 VVGGKDE---QDIYLNSIYFLNLKSCRW--FKFPVFKAGIPQGRSGHSITLLKNNKILIM 396

Query: 262 G 262
           G
Sbjct: 397 G 397

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 105/259 (40%), Gaps = 44/259 (16%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +   QNSP PR    +SA  +    I ++ G    S        Y DTW+L   D AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 175 K-EWSKVE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           K   + ++ ++  P  R GH   +  N F++  G    +        D++L +V  YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 232 QVEFP-PNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS-D 289
               P P    P  R GH +      +++     K K       G    D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 290 VSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDL 344
           +S  R     W+  K   F P P    +M+ +  +  +FGG        ++L  L  ND+
Sbjct: 274 LSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--------DTLQGLI-NDV 324

Query: 345 FTYQIEINRWFSLSMRSQR 363
           F Y    N WF++    ++
Sbjct: 325 FMYDPAKNDWFTIETSGEK 343

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 94/224 (41%), Gaps = 36/224 (16%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PEN--DQWKKYTSQNSPMPRSSSAMISH 141
           K +L +FGG+      T++NDL  Y+      P++  D  K  T   +P P ++  MIS+
Sbjct: 251 KTKLYVFGGQ---FDDTYFNDLAVYDLSSFRRPDSHWDFLKPMTF--TPPPMTNFTMISY 305

Query: 142 PTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENK-NGPSARSGHRMTVWKNF 200
            + + +  G              +D ++ D A  +W  +E     P     H   V+ + 
Sbjct: 306 DSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDL 358

Query: 201 IILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSL-IPTQDGALL 259
           + + GG  +      YL  ++  ++  +KW ++       IP  RSGHSL +   D  L+
Sbjct: 359 MCVVGGKDE---HDAYLNTVYFLNLKTHKWFKLPIFA-AGIPQGRSGHSLTLLKNDKVLI 414

Query: 260 WGG----YCKVKAGK------GLQKGKILSDCWYLKMKSDVSGI 293
            GG    Y + +          +Q+G I+      ++K    GI
Sbjct: 415 MGGDKFDYARAEESDLHTSDFDMQRGTIIYTLDLTRIKDLCPGI 458

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 99/267 (37%), Gaps = 54/267 (20%)

Query: 111 LFTYNPENDQWKKYTSQNSPMPRSSSAMISHPT--GIALLHGGEFSSPKQNTFYHYSDTW 168
           +    P+   W +    NSP PR      SH T  G   + GG            Y DTW
Sbjct: 137 ILPSEPDYTPWGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTW 190

Query: 169 LLDCATKEWSKVEN----------KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYL 217
           +L  +  + +   N          ++ P  R GH  T+  N F++  G    + +     
Sbjct: 191 ILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMD 250

Query: 218 KDLWLFDVTKYKWTQVEFP-PNHAIPDARSGHSLI---PTQDGALLWGGYCKVKAGKGLQ 273
            DL+L ++  YKWT    P P    P  R GH ++     Q    L+GG           
Sbjct: 251 DDLYLLNINSYKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQ---------- 297

Query: 274 KGKILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVF 327
                 D ++  +   D+S  R     W   K  GF P P    +MV ++ +  +FGG  
Sbjct: 298 ----FDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG-- 351

Query: 328 DFEETEESLDSLFYNDLFTYQIEINRW 354
                 ++L+    N ++ Y    N W
Sbjct: 352 ------DTLEEGLINRVYLYSPTNNSW 372

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 111/279 (39%), Gaps = 62/279 (22%)

Query: 106 TFYNDLFTYNPENDQ--------WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFS 154
           T  N+L +YN   D         W +   QNSP PR    +S+ +S    I ++ G    
Sbjct: 137 TLGNNLPSYNEPTDYHKLHPTTIWNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQ 196

Query: 155 SPKQNTFYHYSDTWLLD-----CATKEWSKVEN--KNGPSARSGHRMTVWKN-FIILHGG 206
           S        Y DTW+L       +T   SK  +  +N P  R GH  T+  N F+I  G 
Sbjct: 197 SV-------YGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGD 249

Query: 207 FRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGH--SLIPT---QDGALLWG 261
              +    +   D++LF++  YKWT  +  P    P  R GH  S+I T   +    L+G
Sbjct: 250 THKVNKDGSMDDDIYLFNINSYKWTIPK--PVGQRPLGRYGHKISIIATSQMKTKLYLFG 307

Query: 262 GYCKVKAGKGLQKGKILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVH 315
           G                 D ++  +   D+S  R     WE  + + F P P    +M  
Sbjct: 308 GQ--------------FDDTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCS 353

Query: 316 HKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEINRW 354
           +  +  +FGG        ++L  L  N +F Y    N W
Sbjct: 354 YDHKLWVFGG--------DTLQGL-TNQVFMYDPVDNDW 383

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 79/188 (42%), Gaps = 30/188 (15%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L LFGG+      T++NDL  ++      P++  W+    ++  P P ++  M S+ 
Sbjct: 300 KTKLYLFGGQ---FDDTYFNDLVVFDLSSFRRPDS-HWEFIRPKSFIPPPLTNHTMCSYD 355

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVEN-------KNGPSARSGHRMT 195
             + +  G          F       + D    +W  VE         N P     H   
Sbjct: 356 HKLWVFGGDTLQGLTNQVF-------MYDPVDNDWCVVETFANNNDVSNIPPPIQEHAAV 408

Query: 196 VWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSL-IPTQ 254
           ++K+ + + GG  +   S  YL D++  ++   KW ++ F     +P  RSGHS+ +   
Sbjct: 409 LYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTLLKN 464

Query: 255 DGALLWGG 262
           D  L+ GG
Sbjct: 465 DKILIMGG 472

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 98/259 (37%), Gaps = 43/259 (16%)

Query: 121 WKKYTSQNSPMPRSSSAMISH--PTGIALLHGGEFSSPKQNTFYHYSDTWLLDCA----- 173
           W K   + +P PR      S+  P+    ++GG F S        Y DTW L+       
Sbjct: 22  WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKENYNE 75

Query: 174 --TKEWSKVEN-----KNGPSARSGHRMTVWKNFIILHGG-FRDLGTSTTYLKD-LWLFD 224
              + W    N        P  R GH  T+  N +I+ GG    +  S   + D L+  +
Sbjct: 76  NDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLN 135

Query: 225 VTKYKWTQVEFPPNHAI-PDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWY 283
           +   KWT    P    I P  R GH +        L+GG         L K  +L+    
Sbjct: 136 LDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN---- 188

Query: 284 LKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYND 343
              K   S  +WE  K +GF P P    SM   + +  +FGG     +T + L     N+
Sbjct: 189 --FKDANS--QWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG-----DTYQVLT----NE 235

Query: 344 LFTYQIEINRWFSLSMRSQ 362
            F Y  E+N W  L    Q
Sbjct: 236 TFVYDPELNEWSILETFGQ 254

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 23/149 (15%)

Query: 55  NFKKQQEQFEKINIET-VSKPTKRINSCMISNPIHGKNELILFGGENTSTTTTFYNDLFT 113
           NFK    Q+E I  +  +  P    + C        +N+L +FGG+   T     N+ F 
Sbjct: 188 NFKDANSQWEFIKPKGFIPPPLSNFSMCTF------ENKLYVFGGD---TYQVLTNETFV 238

Query: 114 YNPENDQWKKYTS-----QNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTW 168
           Y+PE ++W    +      N P P    A I +   + ++ G + +    N+ Y      
Sbjct: 239 YDPELNEWSILETFGQEDTNKPPPIQEHAGIIYKHLMCVVGGKDSNDNYLNSVY------ 292

Query: 169 LLDCATKEWSKVE--NKNGPSARSGHRMT 195
            L+  +K+W K+   N      RSGH ++
Sbjct: 293 FLNLISKKWFKLPEFNDTAMLGRSGHSVS 321

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 101/257 (39%), Gaps = 52/257 (20%)

Query: 121 WKKYTSQNSPMPRSS--SAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDC---ATK 175
           W +    +SP+PR    ++  + P     + GG            Y DTW+L     +T 
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 176 EWSKVEN--KNGPSARSGHRMTVWKNFIILHGG-FRDLGTSTTYLKDLWLFDVTKYKWTQ 232
             ++V +   N P  R GH  T+  N +++ GG    L +      DL+LF+V  ++WT 
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWT- 274

Query: 233 VEFP-PNHAIPDARSGHSL-----IPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKM 286
              P P    P  R GH +      P +    L+GG               L D ++  +
Sbjct: 275 --IPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQ--------------LDDNYFNDL 318

Query: 287 KS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLF 340
              D+S  R     W+  K + F P P    +MV +  +  +FGG    E          
Sbjct: 319 AMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGE---------L 369

Query: 341 YNDLFTYQIEINRWFSL 357
            N L+ Y  ++N W  L
Sbjct: 370 QNQLYVYIPDLNEWRCL 386

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 103/255 (40%), Gaps = 54/255 (21%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL---DCAT 174
           W +    NSP PR    +SA  S    + ++ G    S        Y DTW++   D  +
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 175 KEWSKVEN--KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           K  SK  +     P  R GH  T+  N F+I  G    + +      D++LF++  YKWT
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

Query: 232 QVEFP-PNHAIPDARSGH--SLIPT---QDGALLWGGYCKVKAGKGLQKGKILSDCWYLK 285
               P P    P  R GH  S+I T   +    ++GG                 D ++  
Sbjct: 191 ---IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQ--------------FDDTYFND 233

Query: 286 MKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSL 339
           +   D+S  R     W+  K   F P P    +M+ +  +  +FGG     +T + L   
Sbjct: 234 LTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL--- 285

Query: 340 FYNDLFTYQIEINRW 354
             ND+F +  +IN W
Sbjct: 286 -INDVFMFDPQINDW 299

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 32/182 (17%)

Query: 62  QFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYNPENDQW 121
           QF K N  T   P    N  MIS       +L +FGG+   T     ND+F ++P+ + W
Sbjct: 250 QFIKPNTFT---PPPLTNHTMISY----DYKLWVFGGD---TPQGLINDVFMFDPQINDW 299

Query: 122 K-KYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKV 180
           K   T+ + P P    A + +   + ++ G      K     + +  + L+  + +W K+
Sbjct: 300 KVMQTTGDKPPPLQEHAAVLYGDLMCVVGG------KDEQDVYSNSVFFLNLISLKWFKL 353

Query: 181 EN-KNG-PSARSGHRMTVWKNFIIL----------HGGFRDLGTSTTYLKD---LWLFDV 225
            + ++G P  RSGH +T+  N  +L           GG  D+ TS   L     L++ D+
Sbjct: 354 PSYRSGIPQGRSGHSLTLLPNHKLLIMGGDKFDYARGGEGDVHTSDVDLGCGTLLYVLDL 413

Query: 226 TK 227
           +K
Sbjct: 414 SK 415

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 83/192 (43%), Gaps = 27/192 (14%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYNPEN----DQWKKYTSQNS--PMPRSSSAMISHPT 143
           + +L +FGG+      T++NDL  ++  +    D   ++   N+  P P ++  MIS+  
Sbjct: 216 RTKLYVFGGQ---FDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDY 272

Query: 144 GIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNG--PSARSGHRMTVWKNFI 201
            + +  G    +P+       +D ++ D    +W KV    G  P     H   ++ + +
Sbjct: 273 KLWVFGG---DTPQG----LINDVFMFDPQINDW-KVMQTTGDKPPPLQEHAAVLYGDLM 324

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNH--AIPDARSGHSLIPTQDGALL 259
            + GG  +      Y   ++  ++   KW ++   P++   IP  RSGHSL    +  LL
Sbjct: 325 CVVGGKDE---QDVYSNSVFFLNLISLKWFKL---PSYRSGIPQGRSGHSLTLLPNHKLL 378

Query: 260 WGGYCKVKAGKG 271
             G  K    +G
Sbjct: 379 IMGGDKFDYARG 390

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 100/254 (39%), Gaps = 52/254 (20%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCA---T 174
           W +    +SP PR    +SA  S    + ++ G    S        Y DTW+L      T
Sbjct: 73  WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQS-------VYGDTWILTAHANNT 125

Query: 175 KEWSKVEN--KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           +  SK  +     P  R GH  T+  N F+I  G    +        D++LF++  YKWT
Sbjct: 126 RFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVYLFNINSYKWT 185

Query: 232 QVEFP-PNHAIPDARSGH--SLIPT---QDGALLWGGYCKVKAGKGLQKGKILSDCWYLK 285
               P P    P  R GH  S+I T   +    ++GG         L        C Y  
Sbjct: 186 ---IPHPVGPRPLGRYGHKISVIATSQMKTKLYVFGGQFDDTYFNDL--------CVY-- 232

Query: 286 MKSDVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLF 340
              D+S  R     WE  K Q F P P    +MV +  +  +FGG     +T + L    
Sbjct: 233 ---DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----DTAQGL---- 280

Query: 341 YNDLFTYQIEINRW 354
            N++F Y   +N W
Sbjct: 281 INEVFMYDPTVNDW 294

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 78/167 (46%), Gaps = 23/167 (13%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L +FGG+      T++NDL  Y+      P++  W+    Q+  P P ++  M+S+ 
Sbjct: 211 KTKLYVFGGQ---FDDTYFNDLCVYDLSSFRRPDS-HWEFLKPQSFVPPPLTNHTMVSYD 266

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNG-PSARSGHRMTVWKNFI 201
             + +  GG+ +    N  + Y      D    +W+ VE     P A   H   V+K+ +
Sbjct: 267 YKLWIF-GGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAVVYKDLM 319

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGH 248
            + GG  +     +Y  D++  ++  +KW ++ F  N  +P  RSGH
Sbjct: 320 CVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKN-GVPQGRSGH 362

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 104/270 (38%), Gaps = 48/270 (17%)

Query: 100 NTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPT--GIALLHGGEFSSPK 157
           +TST +T    +FT       W +   + SP PR      S+ T  G   + GG      
Sbjct: 78  STSTQSTLQQQVFT------PWNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV 131

Query: 158 QNTFYHYSDTWL---LDCAT--KEWSKVENKNGPSARSGHRMTVWKN-FIILHGGFRDLG 211
                 Y DTW+   LD AT  K  +       P  R GH  T+  N F+I  G    + 
Sbjct: 132 ------YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVN 185

Query: 212 TSTTYLKDLWLFDVTKYKWTQVEFP-PNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGK 270
            +     D++LF++  +KWT    P P    P  R GH +      +++     K K   
Sbjct: 186 DAGLMDDDIYLFNINSHKWT---IPTPQGPRPLGRYGHKI------SIIAANQMKTKL-- 234

Query: 271 GLQKGKILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFG 324
               G    D ++  +   D+S  R     WE  K   F P P    +M+    +  +FG
Sbjct: 235 -YVFGGQFDDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFG 293

Query: 325 GVFDFEETEESLDSLFYNDLFTYQIEINRW 354
           G     +T + L     N++F +    N W
Sbjct: 294 G-----DTPQGL----TNEVFMFDPAANDW 314

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 79/181 (43%), Gaps = 23/181 (12%)

Query: 90  KNELILFGGENTSTTTTFYNDLF-----TYNPENDQWKKYTSQN-SPMPRSSSAMISHPT 143
           K +L +FGG+      T++NDL      ++   +  W+        P P ++  MIS   
Sbjct: 231 KTKLYVFGGQ---FDDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDH 287

Query: 144 GIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENK-NGPSARSGHRMTVWKNFII 202
            + +  G    +P+  T    ++ ++ D A  +W  V+   N P     H   ++++ + 
Sbjct: 288 KLWVFGG---DTPQGLT----NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIYRDLMC 340

Query: 203 LHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPP-NHAIPDARSGHSLIPTQDGALLWG 261
           + GG +D      Y   ++  +    KW   + P  N+ IP ARSGHSL    +  LL  
Sbjct: 341 VFGG-KD--AQDNYSNAVYFLNFRSLKW--FKLPTFNNMIPRARSGHSLTLLSNNKLLIM 395

Query: 262 G 262
           G
Sbjct: 396 G 396

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 87/190 (45%), Gaps = 23/190 (12%)

Query: 80  SCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYNPE-----NDQWKKYTSQNS-PMPR 133
           S + S  +H   EL LFGG+      T++NDL  ++       N  W+     ++ P P 
Sbjct: 203 SIIASKQMH--TELYLFGGQ---IDETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPL 257

Query: 134 SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKN-GPSARSGH 192
           ++  M++    + +  GGE  +PK  +    +DT+  D     WSKVE     P     H
Sbjct: 258 TNHTMVTFDNKLWVF-GGE--TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPVQEH 310

Query: 193 RMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIP 252
              V+K+ + + GG +D+    TY  D++  ++   KW ++       IP  RSGHSL  
Sbjct: 311 ASVVYKHLMCVFGG-KDI--HNTYSNDVYFLNLLSLKWFKLPCV-KEGIPQERSGHSLTL 366

Query: 253 TQDGALLWGG 262
             +  L+  G
Sbjct: 367 MNNEKLVIMG 376

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 91  NELILFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMPRSSSAMISHPTGIALLH 149
           N+L +FGGE   T  T  ND + Y+P  + W K  T+   P P    A + +   + +  
Sbjct: 267 NKLWVFGGE---TPKTISNDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFG 323

Query: 150 GGEFSSPKQNTFYHYSDTWLLDCATKEWSKVEN-KNG-PSARSGHRMTVWKN--FIILHG 205
           G +      NT+ +  D + L+  + +W K+   K G P  RSGH +T+  N   +I+ G
Sbjct: 324 GKDI----HNTYSN--DVYFLNLLSLKWFKLPCVKEGIPQERSGHSLTLMNNEKLVIMGG 377

Query: 206 GFRDLGTS 213
              D  +S
Sbjct: 378 DKFDYASS 385

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 97/254 (38%), Gaps = 52/254 (20%)

Query: 121 WKKYTSQNSPMPR--SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWS 178
           W +   ++SP PR   SS+ I+       + GG +          Y D W +       S
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRIFVTGGLYDQSV------YGDVWEITANANGTS 126

Query: 179 KVENK-----NGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQ 232
               +     N P  R GH  T+  N +++  G    L  +     DL+LF++  YKWT 
Sbjct: 127 FTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT- 185

Query: 233 VEFP-PNHAIPDARSGH--SLIPTQD---GALLWGGYCKVKAGKGLQKGKILSDCWYLKM 286
              P P  + P  R GH  S+I ++       L+GG               + + ++  +
Sbjct: 186 --IPHPIGSRPLGRYGHKISIIASKQMHTELYLFGGQ--------------IDETYFNDL 229

Query: 287 KS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLF 340
              D+S  R     WE  +     P P    +MV    +  +FGG     ET +++    
Sbjct: 230 AVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTIS--- 281

Query: 341 YNDLFTYQIEINRW 354
            ND + Y    N W
Sbjct: 282 -NDTYCYDPIQNAW 294

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 56/144 (38%), Gaps = 13/144 (9%)

Query: 211 GTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGK 270
           G ST     L   +  +Y W +++   +   P  R   S I T D  +   G        
Sbjct: 54  GASTNLPSPLERKNSRRYIWNRIKLK-DSPFPRYRHSSSFITTNDNRIFVTG-------- 104

Query: 271 GLQKGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFE 330
           GL    +  D W +   ++ +    +R +     P PRVG +        ++FGG    +
Sbjct: 105 GLYDQSVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG----D 160

Query: 331 ETEESLDSLFYNDLFTYQIEINRW 354
             + + + L  +DL+ + I   +W
Sbjct: 161 THKLNKNRLLDDDLYLFNINSYKW 184

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 101/263 (38%), Gaps = 52/263 (19%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEW 177
           W +   +NSP PR   S+S ++++   I       F +   +    Y DTW +       
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRI-------FVTGGLHDHLVYGDTWQITGNLDGT 125

Query: 178 SKVEN-----KNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
           S V       +N P  R GH  T+  N +++  G    L  +     DL+LF++  YKWT
Sbjct: 126 SFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWT 185

Query: 232 QVEFPPNHAIPDARSGH--SLI---PTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKM 286
             +  P    P  R GH  S+I   P Q    L+GG               + + ++  +
Sbjct: 186 IPQ--PVGTRPLGRYGHKISIIANNPMQTKLFLFGGQ--------------IDETYFNDL 229

Query: 287 KS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLF 340
              D+S  R     W   K     P P    +MV    +  +FGG     +T  +L    
Sbjct: 230 AMFDLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KTPNTLS--- 281

Query: 341 YNDLFTYQIEINRWFSLSMRSQR 363
            N+ F Y    N W  +    +R
Sbjct: 282 -NETFCYDPVQNDWSKIQTTGER 303

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 22/138 (15%)

Query: 91  NELILFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMPRSSSAMISHPTGIALLH 149
           N+L +FGG+   T  T  N+ F Y+P  + W K  T+   P      A + +   + +  
Sbjct: 267 NKLWVFGGK---TPNTLSNETFCYDPVQNDWSKIQTTGERPPAVQEHASVVYKHLMCIFG 323

Query: 150 GGEFSSPKQNTFYHYSDTWLLDCATKEWSKVEN-KNG-PSARSGHRMTVWKN-FIILHGG 206
           G +     QN + +  D + L+  T +W K+   K G P  RSGH +T+ KN  +++ GG
Sbjct: 324 GKDI----QNAYSN--DVYFLNLITFKWYKLPRIKEGLPKERSGHSLTLIKNDKLVIMGG 377

Query: 207 ---------FRDLGTSTT 215
                      DL TS+T
Sbjct: 378 DKFDYASSDIHDLHTSST 395

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 115/320 (35%), Gaps = 84/320 (26%)

Query: 72  SKP-TKRINSCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSP 130
           S+P T + N   +S  IHG               +T  N+L  Y P    W +Y   NSP
Sbjct: 23  SRPSTGQRNLSSVSQTIHG--------------VSTNPNNLNEYTP----WCRYKLHNSP 64

Query: 131 MPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKN--- 184
            PR    +S+++S    + ++ G    S        Y DTW++   T   +     +   
Sbjct: 65  FPRYRHVASSVVSSDNKVFVIGGLHDQS-------VYGDTWIISENTININSPATMHTPT 117

Query: 185 ---------------------GPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWL 222
                                 P  R GH  T+  N F+I  G             D++L
Sbjct: 118 STTSTTSNISFSSKTVEITEYTPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYL 177

Query: 223 FDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKA---GKGLQKGKILS 279
           F++  YKWT  +  P    P  R GH +      +++     K K    G          
Sbjct: 178 FNINSYKWTIPQ--PVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDSYFND 229

Query: 280 DCWYLKMKSDVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEE 334
            C Y     D+S  R     WE  K + F P P    +MV +  +  +FGG     +T++
Sbjct: 230 LCVY-----DLSSFRKPESHWEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQ 279

Query: 335 SLDSLFYNDLFTYQIEINRW 354
            L     N LF +   IN W
Sbjct: 280 GL----INQLFMFDPVINDW 295

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 79/182 (43%), Gaps = 25/182 (13%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L +FGG+      +++NDL  Y+      PE+  W+    ++  P P ++  M+S+ 
Sbjct: 212 KTKLYVFGGQ---FDDSYFNDLCVYDLSSFRKPES-HWEFLKPKSFIPPPLTNHTMVSYD 267

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKN-GPSARSGHRMTVWKNFI 201
             + +  GG+      N  +      + D    +W  VE     P     H   ++ + +
Sbjct: 268 YKLWVF-GGDTQQGLINQLF------MFDPVINDWRVVETTGEKPPPVQEHAAVMFNDLM 320

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQV-EFPPNHAIPDARSGHSLIPTQDGALLW 260
            + GG  +      YL  ++  ++   KW +  ++  N  IP  RSGHS+   ++  LL 
Sbjct: 321 CIMGGKDE---QDVYLNSVYFLNLKSLKWFKFNDYKLN--IPQGRSGHSITLLKNNRLLI 375

Query: 261 GG 262
            G
Sbjct: 376 MG 377

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 101/255 (39%), Gaps = 54/255 (21%)

Query: 121 WKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLL----DCA 173
           W++    NSP PR    +SA  S    + ++ G    S        Y DTW++    + A
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 174 TKEWSKVENKNG-PSARSGHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWT 231
                 VE  +  P  R GH  T+  N F+I  G    + +      D++LF++  YKWT
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 232 QVEFP-PNHAIPDARSGH-----SLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLK 285
               P P    P  R GH     ++ P +    ++GG                 D ++  
Sbjct: 189 ---IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ--------------FDDTYFND 231

Query: 286 MKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSL 339
           +   D+S  R     W+      F P P    +M+ +  +  +FGG     +T + L   
Sbjct: 232 LAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG-----DTPQGL--- 283

Query: 340 FYNDLFTYQIEINRW 354
             +D+F +  ++N W
Sbjct: 284 -IDDVFVFDPQVNDW 297

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 90/217 (41%), Gaps = 27/217 (12%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYN------PENDQWKKYTSQN-SPMPRSSSAMISHP 142
           K +L +FGG+      T++NDL  ++      P++  W+  T  + +P P ++ AMIS+ 
Sbjct: 214 KTKLYVFGGQ---FDDTYFNDLAVFDLSSFRRPDS-SWQFITPNSFTPPPLTNHAMISYD 269

Query: 143 TGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENK-NGPSARSGHRMTVWKNFI 201
             + +  G    +P+        D ++ D    +W  ++     P     H   ++ + +
Sbjct: 270 YKLWVFGG---DTPQG----LIDDVFVFDPQVNDWKFIQTTGQKPPPLQEHASVLYGDLM 322

Query: 202 ILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWG 261
            + GG  +      Y   ++  ++   KW +  F     IP  RSGHSL    +  LL  
Sbjct: 323 CIVGGKDE---QDVYSNGVYFLNLISLKWFKFPFF-RAGIPQGRSGHSLTLLPNHKLLIM 378

Query: 262 GYCKVKAGKG----LQKGKILSDCWYLKMKSDVSGIR 294
           G  K    +G        ++   C  L    D+S +R
Sbjct: 379 GGDKFDYARGGDDDFHTSEVDMACGTLLYTLDLSKLR 415

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 103/267 (38%), Gaps = 47/267 (17%)

Query: 79  NSCMISNPIHGKNELILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPR---SS 135
           NS  I  P    N+     G     +TT  + +   N +   W +   ++SP PR   SS
Sbjct: 33  NSTRIVTPALPPNQQRSISG----ASTTLPSPIERENAKKYVWNRIKLKDSPFPRYRHSS 88

Query: 136 SAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVE-----NKNGPSARS 190
           S ++S    I  + GG ++         Y D W +       S        ++N P  R 
Sbjct: 89  SPIVSSENRI-FVTGGLYNQSV------YGDVWQITANADGTSFTPKAIQIDRNTPPPRV 141

Query: 191 GHRMTVWKN-FIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGH- 248
           GH  T+  N +++  G    L        D++LF+V  YKWT  +  P  + P  R GH 
Sbjct: 142 GHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWTIPQ--PIGSRPLGRYGHK 199

Query: 249 -SLI---PTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS-DVSGIR-----WERR 298
            S+I   P Q    L+GG               L   ++  +   D+S  R     WE  
Sbjct: 200 ISIIAYNPMQTKLYLFGGQ--------------LDKTYFNDLAMFDLSSFRRRNSHWEFL 245

Query: 299 KKQGFQPSPRVGCSMVHHKGRGILFGG 325
           +     P P    +MV +  +  +FGG
Sbjct: 246 EPATTVPPPLANHTMVTYGNKLWVFGG 272

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 15/121 (12%)

Query: 91  NELILFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMPRSSSAMISHPTGIALLH 149
           N+L +FGGE   T  T  N+ + Y+P  + W K  T+   P P    A + +   I  + 
Sbjct: 265 NKLWVFGGE---TPKTVSNETYCYDPIQNDWSKIETTGEIPPPVQEHASVVY-KHIMCVF 320

Query: 150 GGEFSSPKQNTFYHYS-DTWLLDCATKEWSKVEN-KNG-PSARSGHRMTVWKN-FIILHG 205
           GG++      T   YS D + LD  + +W K+ + K G P  RSGH +T+ KN  I++ G
Sbjct: 321 GGKY------THNAYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGHSLTLMKNEKILIMG 374

Query: 206 G 206
           G
Sbjct: 375 G 375

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 108/274 (39%), Gaps = 62/274 (22%)

Query: 105 TTFYNDLFTYNPENDQWKKYTSQNSPMPR---SSSAMISHPTGIALLHGGEFSSPKQNTF 161
           TT +++   Y P    W +    NSP PR    +S+  S    I ++ G    S      
Sbjct: 130 TTLHHNQKEYTP----WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV----- 180

Query: 162 YHYSDTWLLDCATKEWSKVENKN------GPSARSGHRMTVWKN-FIILHGGFRDLGTST 214
             Y DTW +  +T   ++  +K        P  R GH  T+  N F++  G    +    
Sbjct: 181 --YGDTWSI-TSTNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDG 237

Query: 215 TYLKDLWLFDVTKYKWTQVEFP-PNHAIPDARSGH--SLIPTQDGAL---LWGGYCKVKA 268
               D++LF++  +KWT    P P    P  R GH  S+I T        L+GG      
Sbjct: 238 LMDDDIYLFNINSHKWT---IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ----- 289

Query: 269 GKGLQKGKILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGIL 322
                      D ++  +   D+S  R     WE  K +G  P P    +MV +  +  +
Sbjct: 290 ---------FDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWV 340

Query: 323 FGGVFDFEETEESLDSLFYNDLFTYQI--EINRW 354
           FGG     +T++ L     ND++ +     IN W
Sbjct: 341 FGG-----DTKDGL----INDIYAFDPADSINTW 365

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 81/204 (39%), Gaps = 34/204 (16%)

Query: 164 YSDTWLLDCAT--KEWSK--VE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYL 217
           Y DTW+L      K++S   +E  +  P  R GH  T+  N F+I  G            
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 218 KDLWLFDVTKYKWTQVEFP-PNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGK 276
            D++L +V  +KWT    P P    P  R GH +      +++     K K       G 
Sbjct: 151 DDVYLLNVNSHKWT---IPHPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFGG 198

Query: 277 ILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFE 330
              D ++  +   D+S  R     W   K   F P P    +MV +  +  +FGG     
Sbjct: 199 QFDDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG----- 253

Query: 331 ETEESLDSLFYNDLFTYQIEINRW 354
           +T + L     N+LF Y   +N W
Sbjct: 254 DTPQGL----INELFVYDPVVNDW 273

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 95  LFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMPRSSSAMISHPTGIALLHGGEF 153
           +FGG+   T     N+LF Y+P  + W    T+   P P    A + +   + ++ G   
Sbjct: 250 VFGGD---TPQGLINELFVYDPVVNDWSVVETTGAKPPPLQEHAAVLYRDLMCVVGG--- 303

Query: 154 SSPKQNTFYHYSDTWLLDCATKEWSKVENKNG--PSARSGHRMTVWKNF-IILHGG 206
              K +   +  D + ++  T  W K+ +     PS RSGH +T+  N  +++ GG
Sbjct: 304 ---KDDQDNYSQDVYFMNMKTFRWFKLPHFQDMVPSPRSGHSVTLLANRKLLIMGG 356

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 81/204 (39%), Gaps = 34/204 (16%)

Query: 164 YSDTWLL---DCATKEWSK-VE-NKNGPSARSGHRMTVWKN-FIILHGGFRDLGTSTTYL 217
           Y DTW++   +   K  SK VE  +  P  R GH  T+  N F+I  G            
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMD 256

Query: 218 KDLWLFDVTKYKWTQVEFP-PNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGK 276
            D++L ++  +KWT    P P    P  R GH +      +++     K K       G 
Sbjct: 257 DDVYLLNINSHKWT---IPRPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFGG 304

Query: 277 ILSDCWYLKMKS-DVSGIR-----WERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFE 330
              D ++  +   D+S  R     W+  K   F P P    +MV +  +  +FGG     
Sbjct: 305 QFDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG----- 359

Query: 331 ETEESLDSLFYNDLFTYQIEINRW 354
           +T + L     N+LF Y    N W
Sbjct: 360 DTPQGL----INELFMYDPTTNDW 379

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 95  LFGGENTSTTTTFYNDLFTYNPENDQWKKY-TSQNSPMPRSSSAMISHPTGIALLHGGEF 153
           +FGG+   T     N+LF Y+P  + W    T+   P P    A + +   + ++ G   
Sbjct: 356 VFGGD---TPQGLINELFMYDPTTNDWSVVDTTGVKPPPLQEHAALLYKDLMCIVGG--- 409

Query: 154 SSPKQNTFYHYSDTWLLDCATKEWSKVENKNG--PSARSGHRMTVWKN-FIILHGG 206
              K +   +  + + L+  +  W K+ +     PS RSGH +T+  N  +++ GG
Sbjct: 410 ---KDDQDNYSQEVYFLNLKSFRWFKLPHFRSLVPSPRSGHSVTLLSNKKLLIMGG 462

>KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15
           YOL141W
          Length = 676

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 8/117 (6%)

Query: 89  GKNELILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALL 148
           G  +++L GG N       YND++ Y+ E++ W++ TS   P  R  +A +       L+
Sbjct: 430 GNGKVLLVGGRNAPHRP--YNDIWIYDTEHNLWEQKTSLPYPRFRHCTAQVDE--NCVLI 485

Query: 149 HGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHG 205
           +GG  SS    T ++  D         E S V      SA   H       ++IL G
Sbjct: 486 YGG--SSTLSVTPFNICDVKNGTVTVPEGSAVLKCLASSAMDRH--PALNEYVILGG 538

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 43/91 (47%), Gaps = 10/91 (10%)

Query: 90  KNELILFGGENTSTTTTFYNDLFTYNPEND-QWKKYTSQNSPMPRSSSAMISHPTGIALL 148
           K +L+ FGG     T    N++ +  P+ D +   +    +P+ R+           A++
Sbjct: 372 KKQLLYFGGSCPQRT----NEIISIGPDGDCEAVPFDKTTAPVARACHTFTLVNNDTAMV 427

Query: 149 HGGEFSSPKQNTFYHYSDTWLLDCATKEWSK 179
            GG     ++N +   SDTW+ + ++ EW++
Sbjct: 428 VGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>NCAS0I00340 Chr9 complement(45659..48235) [2577 bp, 858 aa] {ON}
           Anc_7.9 YAL056W
          Length = 858

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 13/74 (17%)

Query: 197 WKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDG 256
           +   I+LHGG      +     D+W F+VT+ +WT+VE     A      G +L+P +  
Sbjct: 672 FPQIIVLHGG----SNNREVYGDMWWFNVTEERWTKVETYVEQA------GEALVPME-- 719

Query: 257 ALLWGGYCKVKAGK 270
            +   G+  V AGK
Sbjct: 720 -MKLVGHTMVTAGK 732

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 174 TKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQV 233
           + ++   ++K G  A S    T  ++FII HGG      +     DLW FD+ K KW ++
Sbjct: 601 SSDFKPADDKYGCVANSTPSKTCKRSFII-HGG----SNNAKVYGDLWWFDLQKLKWEKI 655

Query: 234 EF 235
           E 
Sbjct: 656 EL 657

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 38/104 (36%), Gaps = 10/104 (9%)

Query: 165 SDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFD 224
           ++  L  C T   S          RS  +       +I+HGG       T   +D+W +D
Sbjct: 635 TNPLLKQCLTSSSSHSAPTKPLQPRSKTQPNFEHKVLIMHGG----SNKTDVCRDMWWYD 690

Query: 225 VTKYKWTQVEFPPNH------AIPDARSGHSLIPTQDGALLWGG 262
           +    W+Q+     H       I     GHSL+     A+  GG
Sbjct: 691 IETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)
          Length = 874

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 201 IILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVE 234
           ++LHGG   L      L D+WL D+   KWT +E
Sbjct: 690 VVLHGGSNGLNV----LDDMWLMDLESEKWTPIE 719

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 39/100 (39%), Gaps = 10/100 (10%)

Query: 169 LLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKY 228
           L    + + +K    +GP  +     T   + +++HGG      +T    D+W FD    
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 229 KWTQVEFPPNH------AIPDARSGHSLIPTQDGALLWGG 262
            W Q+E            I  A +GHS+      ++  GG
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 43/116 (37%), Gaps = 5/116 (4%)

Query: 91  NELILFGGENTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHG 150
           +++   GG N            + +  N Q  +  S   P+ R    + S      LL  
Sbjct: 411 DDIFYVGGSNPYRVNEILQLSISNDKMNIQTIEPISNELPLARMCHTLTSFCGSSQLLLV 470

Query: 151 GEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGG 206
           G   +P Q      SD W+ D  T EWS V+  +    R      +  N +++ GG
Sbjct: 471 GGRKAPHQG----LSDNWIFDTKTNEWSMVQKLSHTRFRHS-ACNLSDNSVLIFGG 521

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 4/33 (12%)

Query: 201 IILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQV 233
           I+LHGG  D    T    D+W FD+  ++WT+V
Sbjct: 696 IVLHGGSDD----TNVYGDMWWFDLETFQWTKV 724

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,808,125
Number of extensions: 2760547
Number of successful extensions: 8411
Number of sequences better than 10.0: 72
Number of HSP's gapped: 8236
Number of HSP's successfully gapped: 110
Length of query: 638
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 522
Effective length of database: 40,180,143
Effective search space: 20974034646
Effective search space used: 20974034646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)