Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010506.21ON35032314230.0
KNAG0M011706.21ON3393278581e-113
TPHA0J003406.21ON3383408531e-113
TDEL0G044806.21ON3433318531e-113
Kpol_1037.266.21ON3423398521e-112
NCAS0H008306.21ON3383398411e-111
SAKL0E01210g6.21ON3233388301e-109
ZYRO0C07788g6.21ON3343298281e-109
CAGL0E02739g6.21ON3433258251e-108
Kwal_56.224336.21ON3223268141e-107
KAFR0L004106.21ON3313287921e-103
YOR007C (SGT2)6.21ON3463327901e-103
Smik_15.1766.21ON3453307901e-103
Skud_15.1686.21ON3483397851e-102
NDAI0D008106.21ON3493427791e-101
Suva_15.1826.21ON3463327643e-99
KLLA0D01155g6.21ON3353407278e-94
ACR005W6.21ON3273407042e-90
KLTH0C11220g6.21ON3273426824e-87
Ecym_30256.21ON3183256814e-87
Kpol_1032.86.21ON3433395496e-67
TBLA0A072706.21ON3733443685e-40
TPHA0M002706.21ON3773493651e-39
NCAS0D026706.21ON3512273203e-33
NDAI0I022406.21ON3502232871e-28
CAGL0H08195g5.617ON5831832367e-21
NDAI0F009105.617ON583952295e-20
AEL224W5.617ON5802022271e-19
ZYRO0A05676g5.617ON5721922243e-19
TBLA0E033005.617ON582932216e-19
KNAG0B032005.617ON5791882191e-18
SAKL0G07084g5.617ON5852102181e-18
Kpol_1018.695.617ON5901832181e-18
TPHA0D028805.617ON5852152163e-18
YOR027W (STI1)5.617ON5891832136e-18
Kwal_55.199355.617ON5932112128e-18
TDEL0A048405.617ON5761842111e-17
Skud_15.1925.617ON5891832111e-17
Smik_15.2055.617ON589942101e-17
KLTH0E02178g5.617ON5931842074e-17
NCAS0G008105.617ON5842152065e-17
Suva_8.805.617ON5861842012e-16
KLLA0A07062g5.617ON5812222003e-16
KAFR0C058905.617ON575971977e-16
Ecym_55825.617ON5841731969e-16
NCAS0A00490singletonON620931763e-13
TPHA0D032203.481ON513711382e-08
Ecym_44133.481ON510711363e-08
CAGL0D05060g3.481ON510711346e-08
NDAI0B057903.481ON523881328e-08
KNAG0A079003.481ON512711328e-08
TBLA0C039503.481ON512691329e-08
KLLA0F24046g2.152ON604671292e-07
Smik_6.2153.481ON513881274e-07
YGR123C (PPT1)3.481ON513881265e-07
Suva_7.4083.481ON513881256e-07
KAFR0B066103.481ON5111141257e-07
TDEL0D055003.481ON5121071257e-07
NCAS0F034903.481ON512811249e-07
SAKL0F03102g3.481ON5131201249e-07
Skud_7.4323.481ON513881249e-07
AAR083C3.481ON5381041212e-06
NCAS0B070102.152ON625891212e-06
Kpol_1043.605.689ON7061031176e-06
YHR117W (TOM71)2.152ON639671142e-05
Kpol_505.413.481ON513711104e-05
ZYRO0B04224g3.481ON5131071104e-05
ABR131W2.152ON594671071e-04
Suva_15.3142.152ON644671071e-04
KLTH0B05170g2.152ON593671052e-04
TDEL0B051402.152ON599891043e-04
Skud_8.1782.152ON638671043e-04
KLTH0F14542g3.481ON513821024e-04
Ecym_82042.152ON597671024e-04
Kwal_55.211753.481ON511711025e-04
Smik_8.1952.152ON635671025e-04
Kwal_33.147672.152ON594821016e-04
CAGL0K09240g6.328ON14255966e-04
NDAI0B043402.152ON664821007e-04
NDAI0F028102.152ON609821008e-04
ZYRO0G06512g2.152ON604891008e-04
CAGL0L12936g2.152ON60082970.002
TBLA0C055302.152ON61089970.002
NCAS0G024802.152ON59676970.002
CAGL0L04048g2.152ON58763960.002
SAKL0E14542g5.689ON69059970.002
KAFR0F007202.152ON60889960.002
SAKL0E10956g2.152ON60067960.002
SAKL0H10934g8.506ON380115950.003
ADR230W5.689ON68599950.004
Smik_4.4918.470ON61254950.004
Skud_4.5068.470ON61154940.004
Suva_2.4108.470ON61154940.005
TDEL0B013108.506ON38096930.005
CAGL0C01903g7.412ON76991930.006
KNAG0A039508.506ON38696910.008
KLLA0B10912g3.481ON51282910.008
TBLA0I023106.328ON11657850.009
YDR244W (PEX5)8.470ON61254910.009
KNAG0F040107.546ON141880920.009
NCAS0D045006.328ON12155850.010
KLLA0E20857g7.412ON71088900.012
CAGL0K11209g8.470ON59063890.016
NDAI0J001307.546ON140363890.021
AGL268C8.506ON37998860.030
Skud_2.247.412ON76976870.031
CAGL0H07425g8.506ON380117860.031
ZYRO0B03828g7.412ON72775870.033
SAKL0F16236g7.546ON140884870.036
KAFR0E029808.506ON380128850.039
NDAI0C051308.470ON59054860.040
Kpol_1031.648.470ON60754850.052
YBL084C (CDC27)7.412ON75875840.064
AGL294W7.412ON65692840.066
Suva_2.347.412ON76375840.067
Kpol_513.28.506ON37496830.071
SAKL0H11946g8.470ON57363840.073
Smik_2.367.412ON75175840.083
YNL121C (TOM70)2.152ON61782830.094
NCAS0B025608.470ON57858830.097
Ecym_71427.412ON67592820.11
NCAS0E024907.412ON80999820.11
NCAS0B024008.506ON38096820.12
Kwal_27.117378.470ON57554820.12
Ecym_40315.689ON688104820.12
Ecym_13968.470ON57364820.13
KAFR0L018707.412ON71288820.14
KLTH0E10934g8.470ON56854810.16
Skud_14.2112.152ON61767800.22
Smik_2.2958.506ON38585790.22
TPHA0D038606.328ON12071750.25
TDEL0C027207.412ON70075790.25
KLLA0C15455g8.470ON56662790.26
YBR155W (CNS1)8.506ON38585790.28
KAFR0J025706.328ON12189740.29
Smik_14.2072.152ON61767790.29
Kpol_1048.212.152ON59767790.30
KNAG0A041208.470ON60263780.34
Suva_14.2192.152ON61767780.34
CAGL0E01573g3.32ON90498780.37
KLTH0F18150g5.689ON689165780.38
TDEL0H002507.546ON139772780.39
KLTH0C06204g7.412ON62792780.43
TBLA0H033808.506ON375130770.43
TBLA0A016908.470ON66248770.47
TPHA0I015102.152ON60367770.50
Kpol_1050.1127.546ON136050770.58
TBLA0B079705.72ON687130760.59
Kwal_23.54087.546ON141051770.60
KLLA0B09966g8.506ON37092760.62
TPHA0L014208.506ON37486750.68
TDEL0B016608.470ON54949760.69
Kpol_1018.1067.412ON75354760.70
AFR453W8.470ON56963750.80
CAGL0M08030g1.456ON387142741.1
Ecym_20906.328ON17283721.1
Kwal_27.107407.412ON62892741.1
NCAS0A153007.546ON139848741.1
TPHA0L012108.470ON58874741.1
NDAI0I004406.328ON12856701.2
Smik_2.2543.367ON102073741.2
TPHA0G004305.689ON72860731.4
SAKL0A01672g6.328ON12857691.4
KNAG0H035302.152ON61467731.5
CAGL0H07095g5.352ON661101731.5
NDAI0F004005.689ON76469731.6
Suva_4.3613.367ON96373731.6
Skud_2.2403.367ON98473731.6
Suva_4.4058.506ON38585721.7
YBR112C (CYC8)3.367ON96673722.0
KLTH0A00638g7.546ON141146722.1
KNAG0H006103.367ON97381722.4
KLLA0E08009g2.665ON72166713.0
SAKL0F12936g7.412ON63292703.1
Kpol_1006.43.367ON73281703.2
Suva_16.5217.546ON142463703.5
TPHA0P015903.5ON107751703.7
ZYRO0A02926g8.470ON57750703.8
KLLA0E07239g3.32ON89697704.1
Skud_2.2828.506ON38551694.3
SAKL0D11110g1.456ON43279694.5
TDEL0B053001.456ON397104685.1
NDAI0C033505.72ON64998695.2
Kpol_1028.516.328ON11756646.2
NCAS0G003505.689ON69858686.4
TPHA0E007407.412ON74654686.6
KNAG0B022407.412ON73999677.2
TDEL0B076002.665ON75257677.3
CAGL0I02288g5.72ON63991678.0
YPR189W (SKI3)7.546ON143263678.6
ADL177C3.32ON905112678.9
NCAS0C044903.32ON91863679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01050
         (350 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   552   0.0  
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   335   e-113
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   333   e-113
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   333   e-113
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   332   e-112
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   328   e-111
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   324   e-109
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   323   e-109
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   322   e-108
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   318   e-107
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   309   e-103
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   308   e-103
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   308   e-103
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   306   e-102
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   304   e-101
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   298   3e-99
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   284   8e-94
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   275   2e-90
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   267   4e-87
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   266   4e-87
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   216   6e-67
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   146   5e-40
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   145   1e-39
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   127   3e-33
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   115   1e-28
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    96   7e-21
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     93   5e-20
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    92   1e-19
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    91   3e-19
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    90   6e-19
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    89   1e-18
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    89   1e-18
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    89   1e-18
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    88   3e-18
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    87   6e-18
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    86   8e-18
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    86   1e-17
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    86   1e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    86   1e-17
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    84   4e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    84   5e-17
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    82   2e-16
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    82   3e-16
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    80   7e-16
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    80   9e-16
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       72   3e-13
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    58   2e-08
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    57   3e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    56   6e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    55   8e-08
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    55   8e-08
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    55   9e-08
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    54   2e-07
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    54   4e-07
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    53   5e-07
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    53   6e-07
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    53   7e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    53   7e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    52   9e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    52   9e-07
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    52   9e-07
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    51   2e-06
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    51   2e-06
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    50   6e-06
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    49   2e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    47   4e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    47   4e-05
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    46   1e-04
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    46   1e-04
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    45   2e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    45   3e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    45   3e-04
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    44   4e-04
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    44   4e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    44   5e-04
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    44   5e-04
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    44   6e-04
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    42   6e-04
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    43   7e-04
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    43   8e-04
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    43   8e-04
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    42   0.002
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    42   0.002
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    42   0.002
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    42   0.002
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    42   0.002
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    42   0.002
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    42   0.002
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    41   0.003
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    41   0.004
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    41   0.004
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    41   0.004
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    41   0.005
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    40   0.005
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    40   0.006
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    40   0.008
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    40   0.008
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    37   0.009
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    40   0.009
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    40   0.009
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    37   0.010
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    39   0.012
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    39   0.016
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    39   0.021
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    38   0.030
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    38   0.031
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    38   0.031
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    38   0.033
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    38   0.036
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    37   0.039
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    38   0.040
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    37   0.052
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    37   0.064
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    37   0.066
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    37   0.067
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    37   0.071
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    37   0.073
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    37   0.083
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    37   0.094
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    37   0.097
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    36   0.11 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    36   0.11 
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    36   0.12 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    36   0.12 
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    36   0.12 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    36   0.13 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    36   0.14 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    36   0.16 
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    35   0.22 
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.22 
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    33   0.25 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    35   0.25 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    35   0.26 
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    35   0.28 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    33   0.29 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    35   0.29 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    35   0.30 
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    35   0.34 
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    35   0.34 
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    35   0.37 
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    35   0.38 
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    35   0.39 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    35   0.43 
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    34   0.43 
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    34   0.47 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    34   0.50 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    34   0.58 
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    34   0.59 
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    34   0.60 
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    34   0.62 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    33   0.68 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    34   0.69 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    34   0.70 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   0.80 
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    33   1.1  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    32   1.1  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    33   1.1  
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            33   1.1  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    33   1.1  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    32   1.2  
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    33   1.2  
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    33   1.4  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    31   1.4  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    33   1.5  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    33   1.5  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    33   1.6  
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    33   1.6  
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    33   1.6  
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    32   1.7  
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    32   2.0  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    32   2.1  
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    32   2.4  
KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} simila...    32   3.0  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   3.1  
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    32   3.2  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    32   3.5  
TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3...    32   3.7  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    32   3.8  
KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {...    32   4.1  
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    31   4.3  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    31   4.5  
TDEL0B05300 Chr2 (932958..934151) [1194 bp, 397 aa] {ON} Anc_1.4...    31   5.1  
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    31   5.2  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    29   6.2  
NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}...    31   6.4  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    31   6.6  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    30   7.2  
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    30   7.3  
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    30   8.0  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    30   8.6  
ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON} S...    30   8.9  
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    30   9.3  

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/323 (86%), Positives = 281/323 (86%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           GKSLTELLDAATNAKGRSSSPEDIKVSIS                    GNKAMAAKDYN
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
           LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK            
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 241 XXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLSS 300
                     MLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLSS
Sbjct: 241 SAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLSS 300

Query: 301 GSSEGMGDFMNNPAIREMASNLF 323
           GSSEGMGDFMNNPAIREMASNLF
Sbjct: 301 GSSEGMGDFMNNPAIREMASNLF 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  335 bits (858), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 227/327 (69%), Gaps = 8/327 (2%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M+YSNK++++L++D+L+  + K  VS+D+ DSLNVAIDC+TE F  EKD + +T+ SKF 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GKSLTELLDAATNAKGRS--SSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKD 118
           GKSLTELLDAA+   G +     E +K++I                     GNKA+A+KD
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLE----GNKAVASKD 116

Query: 119 YNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG 178
           Y+LAVEKY  AIK++PT AVY+ANRAAAY++ + YDEA+KDAE AIK++P +SKGYSRL 
Sbjct: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176

Query: 179 FAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXX 238
           +AK+ Q   +E+LEAYKK LE++GD AT++ KR YETAKK+VE+SLN+EK          
Sbjct: 177 YAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQ 236

Query: 239 XXXXXXX--XXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAE 296
                         ++ GGL   +NNPQ+MQAAQ MMSNP AME+++SMMQNP+I+QMAE
Sbjct: 237 TNPAAGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAE 296

Query: 297 NLSSGSSEGMGDFMNNPAIREMASNLF 323
               G++    + MNNPA+R MAS+LF
Sbjct: 297 QFKGGNTPDFSEMMNNPAVRNMASSLF 323

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  333 bits (853), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 227/340 (66%), Gaps = 29/340 (8%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M+ SNK+IA L+VD+L+  ++KK VS DNADSLNVA+DCI EAFEFE+D VK T+ S F 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           G  LT  L          S+  DI+V+I+                    GNKAMA KDY 
Sbjct: 61  GNGLTSFL--------SGSATNDIQVNIADDAADEEQKATAEGLKLE--GNKAMATKDYE 110

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
            A++KY+ AI+++PT AVYYANRAAAYSS +KYD+A+ DAESAIKV P +SKGYSRLGFA
Sbjct: 111 SAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           KFAQGK ++AL+AYKK L+++GDKATDIMKRDYETAKKKVEQSLN+EK            
Sbjct: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNA 230

Query: 241 XXXXXXXXXXMLGG--GLGSF------------LNNPQIMQAAQQMMSNPRAMEQMESMM 286
                      +GG   L S             L NPQIMQAAQQMM NP AM+QMESMM
Sbjct: 231 DAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMM 290

Query: 287 QNPSIRQMAENLSSGSSEGMGDF---MNNPAIREMASNLF 323
           QNP++RQMAEN +SG  EG  D    MNNP +++MA N+F
Sbjct: 291 QNPAVRQMAENFASG--EGTPDLSAMMNNPDLKDMAKNMF 328

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  333 bits (853), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/331 (55%), Positives = 236/331 (71%), Gaps = 16/331 (4%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS SNK++A+L+VD+LS  +EKKAVS +  DSLNVAIDCI E+FE +K D K+     FG
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 61  GKSLTELL--DAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKD 118
           GK L ELL  ++ ++++  ++  E IKV+I                     GNKAMA KD
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLE----GNKAMACKD 112

Query: 119 YNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG 178
           ++LA++KY+ AI+++PT AVYYANRAAA+SS + Y+EAIKDAESAIK +P +SKGYSRLG
Sbjct: 113 FDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG 172

Query: 179 FAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXX--- 235
           +AKFA G++++ALEAYKK L+++GDKA+D+MKRDYETAKKKVEQSL++EK          
Sbjct: 173 YAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGAD 232

Query: 236 --XXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQ 293
                            MLGGGLG  LNNPQ+MQAAQQMM NP+AM QMESMMQNP +RQ
Sbjct: 233 AGAGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQ 292

Query: 294 MAENLSSGSS-EGMGDFMNNPAIREMASNLF 323
           MAEN + G+    MGD MNNPA+R+MA +LF
Sbjct: 293 MAENFAQGNGMPNMGDLMNNPALRDMAGSLF 323

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  332 bits (852), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 184/339 (54%), Positives = 233/339 (68%), Gaps = 24/339 (7%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS SNKDIA L++DFLST ++K  VS DNADSLNVA+DCI EAFEFE+D V   + S F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GKSLTELLDAATNAKGRSSSP-EDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDY 119
           G SL+  L+ +T+A   +++  E +KV+++                    GNKAMA KDY
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLE----GNKAMAGKDY 116

Query: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179
            LA++KY  AI  +PT AVY+ANRAAAYSS +KYDEA++DA SAIK+ P +SKGYSRLGF
Sbjct: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGF 176

Query: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXX 239
           AKFAQGK+++ALEAYKK L+++GDKAT++MKRDYETAKKKVEQSLN+EK           
Sbjct: 177 AKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAES 236

Query: 240 XXXXXXXXXXXMLGGGLGSF------------LNNPQIMQAAQQMMSNPRAMEQMESMMQ 287
                      M  GG+  F            LNNPQ+MQAAQQMM +P AM+Q+ESMMQ
Sbjct: 237 DSASAADPFAGM--GGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQ 294

Query: 288 NPSIRQMAENLSSGSSEGMGDF---MNNPAIREMASNLF 323
           NPS++QMA+  SSG+  G  DF   MN+P+IR+MA N+F
Sbjct: 295 NPSVKQMADQFSSGN--GTPDFSALMNDPSIRDMAKNMF 331

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/339 (51%), Positives = 226/339 (66%), Gaps = 24/339 (7%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS SNK++ +L+VDFLST I+ K +S D+ADSLNVAIDCITE+FEFE+D V  TL  KF 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           GK+L E+L +A+     S   E +KV+I                     GNKAMAAKDY 
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLE----GNKAMAAKDYR 116

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
           LA+EKY+ AIK +PT  +YYANRAAAYSS ++YD AIKDAE AI+++P +SKGYSRL FA
Sbjct: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           K+A  K +EALE YKK L+++GDKAT  MKRD+E AK +VE S+N+EK            
Sbjct: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEK---SSTTTPEPS 233

Query: 241 XXXXXXXXXXMLGGG----------------LGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
                       G G                L SFLNNPQ+MQAAQQMMS+P +M++M+ 
Sbjct: 234 RSAGQQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQE 293

Query: 285 MMQNPSIRQMAENLSSGSSEGMGDFMNNPAIREMASNLF 323
           MMQNP++R+MA+NL+SG +  + D MNNP++++MA+NLF
Sbjct: 294 MMQNPNLREMAQNLASGDA-NLDDLMNNPSVKDMANNLF 331

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  324 bits (830), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 225/338 (66%), Gaps = 33/338 (9%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M+ SNK+IA L+VDFLS+ +EK AVS D ADSLNVAIDCI+EAFEFE+D V   + + F 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
            + L ELL +A  A    S P  +KV+I                     GNKAMA+KD+ 
Sbjct: 61  NRKLDELLKSAATALPTQSEP--VKVNIPAEDANTKAKAEDLKLQ----GNKAMASKDFE 114

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
            A++KY  AI+++P+ AVYYANRAAAYSS +KY+E+++DAESAIKV P++SKGYSRLGFA
Sbjct: 115 TAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFA 174

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           K+A GK +EALEAYK  L+++GDKATD+MKRDYETAK+KVEQSLN+EK            
Sbjct: 175 KYALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESS 234

Query: 241 XXXXXXXXXXMLGGGLGSF--------------LNNPQIMQAAQQMMSNPRAMEQMESMM 286
                       G G   F              LNNPQ+M AAQ++M NP AM++   MM
Sbjct: 235 TDA---------GAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDE---MM 282

Query: 287 QNPSIRQMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323
           +NP++RQMAEN SS G +  +GD M+NPAI++MA NLF
Sbjct: 283 KNPAVRQMAENFSSGGGTPNLGDLMSNPAIKDMAKNLF 320

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  323 bits (828), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 177/329 (53%), Positives = 225/329 (68%), Gaps = 26/329 (7%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M+ SNKDI++L+VD+L+  ++KK+VS D+ DSLNVAI+CITEAF  EK     + ++ FG
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEK----GSSSAAFG 56

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           GK+L ELL A   A   SS  E++KV+I                     GNKAMA KDY 
Sbjct: 57  GKNLAELLSAGAGAP--SSQGENVKVNIPAEDAELKSKAESLKLE----GNKAMAGKDYE 110

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
           LA++KY+ AI +VPT AVYYANRAAA+SS + YDEAIKDAESA+KV+ ++SKGYSRLG+A
Sbjct: 111 LAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYA 170

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           KFAQGKS+EALEAYKK L+++GD ATD+MKRDYETAK+KVEQ+L + K            
Sbjct: 171 KFAQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTG 230

Query: 241 XXXXXXXXXXMLGGGL----------GSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPS 290
                       GGG           G  LNNPQ+MQAAQQMM NP+AM QME+MMQNP+
Sbjct: 231 EPAGANP-----GGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPN 285

Query: 291 IRQMAENLSSGS-SEGMGDFMNNPAIREM 318
           +RQMAE  + G+ +  + D MNNPA+R+M
Sbjct: 286 VRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  322 bits (825), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 220/325 (67%), Gaps = 13/325 (4%)

Query: 5   NKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFGGKSL 64
           +K++A +++ +L   + +KAV  D  DS+NVAIDCI E+FE E+ DV S L      K L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  TELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYNLAVE 124
            E L+     KG +   ED+KV+I                     GNKAMA KD+ LA+ 
Sbjct: 62  EECLECM---KGGAVKSEDVKVNIPAEDAETKAKAEALKLE----GNKAMAGKDFELAIA 114

Query: 125 KYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQ 184
           KY+ AI+++PT A+YYANRAAA+SS ++YDEA+ DAE AI+++P +SKGYSRLGFAK+AQ
Sbjct: 115 KYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQ 174

Query: 185 GKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXXXXXX 244
            K +EALEAYKK ++++GDKATDIMKRDYETAKKKVEQSLN+EK                
Sbjct: 175 NKPEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAG 234

Query: 245 XXXX-----XXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLS 299
                      ML GGL   +NNPQIMQAAQQMMSNP+A++QM+SMMQ+PSIRQMAE  +
Sbjct: 235 AGGAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFT 294

Query: 300 SGS-SEGMGDFMNNPAIREMASNLF 323
           SG+ +  M D M+NPA+R MAS++F
Sbjct: 295 SGNGTPNMDDLMSNPALRNMASSMF 319

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 179/326 (54%), Positives = 225/326 (69%), Gaps = 12/326 (3%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS SNKD+ANL+VDFLS  +E K VS D  DSLNVAIDCITEAFEF+++ V +TL   F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           G+SL ++++AA+   G SS  E +KV+I                     GNKAMAAKD+ 
Sbjct: 61  GRSLKQVVEAAS--VGSSSPQESVKVNIPVEDAETKAKAESLKLE----GNKAMAAKDFE 114

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
            AV KY+ AI+++PT AVYYANRAAA+SS +KY+EA+KDAE AIKV P++SKGYSRLGFA
Sbjct: 115 QAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFA 174

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           ++A GK +EAL+AYKK L+++G+ ATD MKRDY+TA KKV QSLNVEK            
Sbjct: 175 QYALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGS 234

Query: 241 XXXXXXXX--XXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENL 298
                       MLGGGLG  LNNPQ+MQAAQQMM NP AM++   +M NP+++QMAE  
Sbjct: 235 ATGSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQE---VMNNPAVKQMAEKF 291

Query: 299 -SSGSSEGMGDFMNNPAIREMASNLF 323
            S G +  M D MNNPA+ +MA N+F
Sbjct: 292 QSGGGTPSMADLMNNPALMDMAKNMF 317

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  309 bits (792), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 219/328 (66%), Gaps = 9/328 (2%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M  SNK+I+ L+VD+L    EK  VS D  DSLNVAIDCIT++FEFE+D     + SKF 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
             SL ELL+ A      +S+ E++ V++                     GNKAMA KD++
Sbjct: 61  NLSLPELLEVAM----ENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFD 116

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
           LA+ KY+ AI + P  A+YYANRAAAYSS + +++A +DAESAI+V+PN+SKGYSRLGFA
Sbjct: 117 LAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFA 176

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           K+A  K +EALEAYKK L+++GDKAT+IMKRDYETAKK+VEQSLN+EK            
Sbjct: 177 KYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTE 236

Query: 241 XXXXXXX-----XXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMA 295
                          MLGGGL   LNNPQ+MQAAQQMMS+P AM +++SMMQNPSIRQMA
Sbjct: 237 SAANAAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMA 296

Query: 296 ENLSSGSSEGMGDFMNNPAIREMASNLF 323
           EN  +G++      MN+P I++MA N F
Sbjct: 297 ENFQNGNTPDFSQLMNDPNIKDMAKNFF 324

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  308 bits (790), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/332 (50%), Positives = 228/332 (68%), Gaps = 13/332 (3%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLA-SKF 59
           MS S ++IA L+V++ S+ +EKK +S D ADSLNVA+DCI+EAF FE++ V   L  S+F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  GGKSLTELLDAATNAK--GRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAK 117
            G+ L ++L++A+      +    E+++++I                     GNKAMA K
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQ----GNKAMANK 116

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           DY LA+ KY  AIK++PT A+YYANRAAA+SS ++YD+A+KDAESAI ++P++ +GYSRL
Sbjct: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXX-- 235
           GFAK+AQGK +EALEAYKK L+++GD AT+ MKRDYE+AKKKVEQSLN+EK         
Sbjct: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDA 236

Query: 236 ---XXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIR 292
                             +LGGGLG  +NNPQ+MQAAQ+MMSNP AM+ ++ MMQ+PSIR
Sbjct: 237 DVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIR 296

Query: 293 QMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323
           QMAE  +S G +  + D MNNPA+R MA NLF
Sbjct: 297 QMAEGFASGGGTPNLSDLMNNPALRNMAGNLF 328

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  308 bits (790), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 170/330 (51%), Positives = 225/330 (68%), Gaps = 9/330 (2%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLA-SKF 59
           M  S ++IA L+V++ S+ +EKK +S D ADSLNVA+DCI+EAF FE+D     L  S+F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  GGKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDY 119
            GKSL ++L++A+  K   S+ +D   ++                     GNKAMA KDY
Sbjct: 61  KGKSLADVLNSAS--KASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDY 118

Query: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179
            LA+ KY  AI+++PT A+YYANRAAA+SS  +YDEA+KDAES+I ++P++ +GYSRLGF
Sbjct: 119 ELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGF 178

Query: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXX 239
           AK+AQGK +EALEAYKK L+++GD AT+ MKRDYE+AKKKVEQSLN+EK           
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADA 238

Query: 240 XXXXXXXXX-----XXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQM 294
                           +LGGGLG  +NNPQ+MQAAQ+MMSNP AM+ ++ MMQ+PSIRQM
Sbjct: 239 NASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQM 298

Query: 295 AENLSS-GSSEGMGDFMNNPAIREMASNLF 323
           AE  +S G +  + D MNNPA+R MA NLF
Sbjct: 299 AEGFTSGGGAPNLSDLMNNPALRNMAGNLF 328

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  306 bits (785), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 165/339 (48%), Positives = 223/339 (65%), Gaps = 25/339 (7%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLA-SKF 59
           MS S  +IA+L+V++ S+ +EKK +S D+ADSLNVA+DCI+EAF FE++ V S L  S+F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  GGKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDY 119
            G++LT+LL++ +  +   S+ +D   ++                     GNKAMA KDY
Sbjct: 61  KGQNLTDLLNSTS--RVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDY 118

Query: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179
            LA+ KY  AIK++PT A+YYANRAAA+SS + YDEA++DAESAI ++P + +GYSRLGF
Sbjct: 119 ELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGF 178

Query: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXX 239
           AK+AQGK +EALEAYKK L+++GD AT+ MKRDYE+AKKKVEQSLN+EK           
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADA 238

Query: 240 XXXXXXXXXXXMLGGGLG--------------SFLNNPQIMQAAQQMMSNPRAMEQMESM 285
                        G G                  +NNPQ+MQAAQ+MMSNP AM+ ++ M
Sbjct: 239 NADASQ-------GAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKM 291

Query: 286 MQNPSIRQMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323
           MQ+P+I+QMAE  +S G +  + D MNNPA+R MA NLF
Sbjct: 292 MQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLF 330

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  304 bits (779), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 224/342 (65%), Gaps = 24/342 (7%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS +NKDI  L+VDFLST IEK  VS DNADSLNVA+DCI+EA EF+++ V  T+ +KF 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GKSLTELLDAATNAKGRSS--SPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKD 118
           GK+L ++L+  + A   ++    E ++V+I                     GNKAMA KD
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLE----GNKAMAMKD 116

Query: 119 YNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG 178
           ++LAVEKY  AIK++PT A+YYANRAAA+SS ++++EAIKDAESAIK++P++SKGYSRL 
Sbjct: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176

Query: 179 FAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXX-XXX 237
           FAK+  GK +EALE+YKK L+++GD AT  MKRDYETAKK+VE+S+NVEK          
Sbjct: 177 FAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQ 236

Query: 238 XXXXXXXXXXXXXMLGGGLGSF----------------LNNPQIMQAAQQMMSNPRAMEQ 281
                           GG+                   L+NP  M  AQ++MS+P AM+Q
Sbjct: 237 QQTNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQ 296

Query: 282 MESMMQNPSIRQMAENLSSGSSEGMGDFMNNPAIREMASNLF 323
           ++SMM +PS+R +A N  +G+++ M D MNNPAIR MASNLF
Sbjct: 297 VQSMMSDPSMRDLANNFKNGNTD-MNDIMNNPAIRNMASNLF 337

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  298 bits (764), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 230/332 (69%), Gaps = 13/332 (3%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTL-ASKF 59
           MS S ++IA+L+V++ S+ +EKK VS D+ADSLNVA+DCI+EAF FE+D V S L  S F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  GGKSLTELLDAATN--AKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAK 117
            G+SL  LL +++     G+    ++++V+I                     GNKAMA K
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQ----GNKAMANK 116

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           +Y LA++KY  AI ++PT A+YYANRAAA+SS ++YDEAIKDAESAI V+P++ +GYSRL
Sbjct: 117 EYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRL 176

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXX-- 235
           GFAK+AQGK +EALEAYKK L+++GD ATD MKRDYE+AKK+VEQSLN+EK         
Sbjct: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDA 236

Query: 236 ---XXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIR 292
                             +LGGGLG  +NNPQ+MQAAQ+MMSNP AM+ +++MMQ+PSIR
Sbjct: 237 GANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIR 296

Query: 293 QMAENLSS-GSSEGMGDFMNNPAIREMASNLF 323
           QMAE  +S G +  + D M NPA+R MA +LF
Sbjct: 297 QMAEGFTSGGGTPNLSDLMKNPALRNMAGSLF 328

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  284 bits (727), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 166/340 (48%), Positives = 221/340 (65%), Gaps = 30/340 (8%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS SNK+IA L+VDFLS++    +V+ D  DSLNVAIDCITEAF+FE+D+  S ++  F 
Sbjct: 1   MSLSNKEIAALIVDFLSSS--SSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           GK L ELL +A ++ G S  P  + + +                     GNKAMAAK ++
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQ------GNKAMAAKKFD 112

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
            A+EKY AAI++ P+ AVYY+NRAAAYSS ++Y++A+KDAE AI+V+P +SKG+SRLGFA
Sbjct: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFA 172

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           K+A  K +EAL+AYKK L+++G+KATD+MKRDYETAKKKVE S+N+EK            
Sbjct: 173 KYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSD 232

Query: 241 XXXXX--------------XXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMM 286
                                    LGGGLG+ LNNPQ+MQAA++MM NP     M+ MM
Sbjct: 233 KSATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGL---MQDMM 289

Query: 287 QNPSIRQMAENLSSGSSEGMGDF---MNNPAIREMASNLF 323
            NP+++QMA   SSG   GM D    MN+P+IR+MA N+F
Sbjct: 290 SNPAMKQMANQFSSGG--GMPDLSQMMNDPSIRDMAKNMF 327

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  275 bits (704), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 217/340 (63%), Gaps = 33/340 (9%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS SNKDIA L+VDFL+T+   K V  D  DSL VAIDCITEAFE    +  + ++ K G
Sbjct: 1   MSPSNKDIAALIVDFLTTSA--KTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           G+SL++LL   T     +S   + KV+                      GN+AMAAKDY 
Sbjct: 59  GRSLSQLL---TTGMAHTSDAGEPKVA--------AEELKKEAEALKLEGNRAMAAKDYE 107

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
            A++KY AAI+++PT AVYYANRAAAYSS ++Y++A++DAE A KV+ ++SKG+SRLG+A
Sbjct: 108 TAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYA 167

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           K+A G+ +EALEAYK+ L+++GD AT+ M+RDYE+AK+KVE+S+N+++            
Sbjct: 168 KYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAA 227

Query: 241 XXXXXXXXXXMLG----------------GGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
                     +                  GGLG  LNNPQ+MQAAQ+MM NP A+++   
Sbjct: 228 GSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQE--- 284

Query: 285 MMQNPSIRQMAENLSSGS-SEGMGDFMNNPAIREMASNLF 323
           MM NP+I++MAEN +SG+ S G+GD M +PA+R MAS  F
Sbjct: 285 MMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFF 324

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  267 bits (682), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 157/342 (45%), Positives = 213/342 (62%), Gaps = 39/342 (11%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M+ + K++A+L++D+L    E K +  D  DSLNVAIDC+TEAFE EK+   S +   FG
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GKSLTELLDAATNAKGRSSSP-EDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDY 119
           G+SL +++ A++  KG +++  E +KV+I                     GNKAMA KD+
Sbjct: 61  GQSLEQIVGASS--KGPTATQQEPVKVNIPVEDAEIKAKAEALKLE----GNKAMATKDF 114

Query: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179
             A+ KY+ AI+ +P+ AVY+ANRAAAYSS +KY EA++DAE+AIKV P++SKGYSRLGF
Sbjct: 115 EHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGF 174

Query: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXX 239
           A++A G+ +EAL+AYKK L+++G  ATD MKRDY+TA KKVEQSLNVE+           
Sbjct: 175 AQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESP 234

Query: 240 XXXXXXXXXXXMLGGGLG-----------------SFLNNPQIMQAAQQMMSNPRAMEQM 282
                         GG G                   L NPQ+MQAAQQMM NP AM++ 
Sbjct: 235 DA-----------AGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQE- 282

Query: 283 ESMMQNPSIRQMAENL-SSGSSEGMGDFMNNPAIREMASNLF 323
             MM NP+I+QMA+   S G +  M D MNNPA+ +MA N+F
Sbjct: 283 --MMSNPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMF 322

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  266 bits (681), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 207/325 (63%), Gaps = 12/325 (3%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M  SNK+IA L+V FLST+   K V  +  DSLNVAIDCI EAFE E++D    ++  + 
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDYN 120
           G+ L +L+ +  +    SSS                             GNKA AAKD+ 
Sbjct: 59  GRGLVDLVKSGASEPTLSSSE-----PTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFE 113

Query: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180
            AV+KY  AI+L+P  AV+Y NRAAAYSS +K++EA++DAESA+++ P++S+GYSRLG A
Sbjct: 114 GAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLA 173

Query: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXXXXX 240
           K+A GK +EA+EAYKK L+++GD AT+ MKRDYE+AKKKVE+SLN+E             
Sbjct: 174 KYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEG 233

Query: 241 XXXXX-XXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAENLS 299
                      MLGGGLG  LNNPQ+MQAAQ+MM NP AM++   MM NP+I+QMA+N +
Sbjct: 234 SSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQE---MMNNPAIKQMAQNFA 290

Query: 300 S-GSSEGMGDFMNNPAIREMASNLF 323
           S G +  +GD M +P I++MA   F
Sbjct: 291 SGGGTPNLGDMMKDPNIKDMAGKFF 315

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  216 bits (549), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 188/339 (55%), Gaps = 34/339 (10%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFE-------------FE 47
           MS +NKD   L+V++L   I+ K VS DNA+SLNVAIDCI++ FE             F 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 48  KDDVKSTLASKFGGKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXX 107
           K D+K+      G ++++++++     +  S   ED K                      
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEIS---EDKK---------------KEAEALK 102

Query: 108 XXGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVE 167
             GNK M+ K+Y  A++KY+ AI++ P+   YY+NRAAAY   E +  A+ DA +AIK++
Sbjct: 103 LEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLD 162

Query: 168 PNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVE 227
           P +SK YSRLG AK A+G +++A+ A+KK LE++GDK+T++MK DYE AKK V+  + + 
Sbjct: 163 PTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLN 222

Query: 228 KXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNP--QIMQAAQQMMSNPRAMEQMESM 285
           K                      +LG   GS +NN              NP  M+Q+E +
Sbjct: 223 KNVPDPSGPPPLNTTDVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGL 282

Query: 286 MQNPSIRQMAENLSSGSSE-GMGDFMNNPAIREMASNLF 323
           MQNP +RQ AEN+++G+   G+ D +NNP+++E+A+ L 
Sbjct: 283 MQNPVVRQFAENVANGNGPGGLSDVLNNPSVKEVANGLM 321

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  146 bits (368), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 98/344 (28%), Positives = 161/344 (46%), Gaps = 36/344 (10%)

Query: 4   SNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFGGKS 63
           ++KD+A L+V+FL   I KK +S DN DSLNVAIDCI + +   +  + S+L  KF    
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSD 66

Query: 64  LTELLD--AATNAKGRSSSPEDI--------------------------KVSISXXXXXX 95
           LT +L+  A  N K  +S+ E                            K+SI+      
Sbjct: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126

Query: 96  XXXXXXXXXXXXX---XGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEK 152
                            GN+ M ++DY  A+E Y  AI   P   +YY+NR+ AY     
Sbjct: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 153 YDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRD 212
           Y+ AI DA   I ++ N+SK Y RL   K  Q +  +AL+ YKK +E++ D   + + R+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246

Query: 213 YETAKKKVEQSLNVEKXXXXXXXXXXXXXXXXXXXXX----XMLGGGLGSFLNNPQIMQA 268
           +E  K KV+  +++ +                          +LG G  + L+NP + Q 
Sbjct: 247 FEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQM 306

Query: 269 AQQMM-SNPRAMEQMESMMQNPSIRQMAENLSSGSSEGMGDFMN 311
             +++ +NP A + +  ++ NP+++ + +N  +GS+     FM+
Sbjct: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFDKKLFMD 350

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  145 bits (365), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 162/349 (46%), Gaps = 47/349 (13%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           M+ ++++IA+++VD+ +  I    ++ DN DSLNVAIDCI + F+ +KD + + L + + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GKSLTELL-----------------DAATNAKGR-------SSSPEDIKVSI-------S 89
              L   L                 + +   K +       S + +DI V +        
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 90  XXXXXXXXXXXXXXXXXXXXGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSS 149
                               GN+ M AK Y+ A+  Y+ AIKL PT   YY NRA AY  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 150 QEKYDEAIKDAESAI----KVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV----- 200
              +D AI DA  +I    K+ P   K Y RLG AK+  G  + +L A+K+ +E+     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 201 DGDKATDIMKRDYETAKKKVEQSLNVE------KXXXXXXXXXXXXXXXXXXXXXXMLGG 254
            GD+ T  M  DYE AK+KV++   ++      K                      M G 
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAGN 300

Query: 255 GLGSFLNNPQIMQAAQQMM-SNPRAMEQMESMMQNPSIRQMAENLSSGS 302
            L   ++NP   +  +Q++ SNP+A +Q +++M +P +RQM EN++S S
Sbjct: 301 NLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVNSDS 349

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  127 bits (320), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/227 (34%), Positives = 128/227 (56%), Gaps = 26/227 (11%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKD-DVKSTLASKF 59
           MS SNK+IA+ +V +LS+ I    V+ D A+S++VAI+CI ++F+ +++    S LA+  
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 60  GGKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDY 119
                 E     +  +    + + IK+ +                     GNKA+  ++Y
Sbjct: 61  LANLNLEPEPKLSEKERELVNEQAIKLKLE--------------------GNKAVERENY 100

Query: 120 NLAVEKYNAAIKLV-----PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGY 174
             A++KY  AI L+     P    Y +N++ A +   +Y+EA  DA + IK++P +SKGY
Sbjct: 101 KDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGY 160

Query: 175 SRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVE 221
           SRL  AK  Q K ++A+ AYK+ L+++G+KATD MKRD+E  K+K E
Sbjct: 161 SRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  115 bits (287), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 116/223 (52%), Gaps = 24/223 (10%)

Query: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60
           MS + +  A+L++ +LS       +  D  +SL VAI CI E+F  + D + ++L  +  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  GKSLTELLDA-ATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMAAKDY 119
              L E L+      K  +   E +K                        GN+AM    Y
Sbjct: 61  KTILQENLNTLEATQKIHNEEAEALK----------------------KEGNEAMIEGQY 98

Query: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179
             A++KY  AI+     A YY+NR+ AYS   +Y++A+ DA  AI ++P++SK YSRLG+
Sbjct: 99  EEAIKKYTEAIQFSKNVA-YYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGY 157

Query: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQ 222
           AK  Q K ++ + AYK+A++++G  A+  +  DYE A+ K EQ
Sbjct: 158 AKCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 95.5 bits (236), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 92/183 (50%), Gaps = 8/183 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY  A++ ++ AI++  T   V+Y+NR+A Y+S +K+ EA+ DAE  +K+ P
Sbjct: 11  GNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINP 70

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDK-----ATDIMKRDYETAKKKVEQS 223
            WSKGY+RLG A    G   EA  +YKKALE+DG         D +KR  E+ +   +  
Sbjct: 71  TWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAAKDGLDQVKRTQESRQGMPDLG 130

Query: 224 LNVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQME 283
           L+                          L   L  +  NPQ M  +Q + + PR M  M 
Sbjct: 131 LSKIFADPNLIENLKKNPKTSEMMKDPELVAKLIKYKTNPQAM--SQDLFTEPRLMTIMA 188

Query: 284 SMM 286
           ++M
Sbjct: 189 TLM 191

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 44/86 (51%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D+  AV+ Y   IK  P  A  Y+NRAAA S    + EAI+D   AI+ +PN+ + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGD 203
             A+ A  +   A+E    A   D +
Sbjct: 465 ATAQIAVKEFAAAIETLDAARTKDAE 490

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNKA  A+ ++ A+  Y+AA  L      Y  NR+AA   +   + A+K  + A+    +
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   +K ++R+G         ++A+E Y+K+L      +  T +   + E  K++ 
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPEILTKLRNTEKELKKQEA 381

Query: 221 EQSLNVEK 228
           E+ +N EK
Sbjct: 382 EEYINPEK 389

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  +KD+N A+E +  AI++ PT   V Y+NR+AAY+S +++ EA+ DA   +K+ P
Sbjct: 12  GNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGD 203
            WSKGY+RLG A+F  G  +EA + YK+AL++D +
Sbjct: 72  TWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 83/187 (44%), Gaps = 22/187 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y+  IK  P  A  Y+NRAAA S    + EAIKD ++AIK +PN
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD-----GDKATDIMKRDYETAKKKVEQSL 224
           + + Y R   A+ A  +   AL+  ++A   D     G  + +IM+   +  +++ +   
Sbjct: 456 FVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKATQERFQAPT 515

Query: 225 NVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
             E                       M    + + + +P +    QQ  +NP A+++   
Sbjct: 516 GNE--------------TPEETYKRAMQDPEVAAIMQDPVMQSILQQAQTNPAALQE--- 558

Query: 285 MMQNPSI 291
            M+NP I
Sbjct: 559 HMKNPEI 565

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 65/128 (50%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A  ++ A+E+YN A  L      Y  NR+AA   +  ++ AI     A+    +
Sbjct: 262 GNKLYKAHKFDEAIEQYNKAWALN-KDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRE 320

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   +K ++R+G A   +G  +++++ Y+K+L      D  T +   + E  K++ 
Sbjct: 321 LRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKELKKQEA 380

Query: 221 EQSLNVEK 228
           EQ ++ EK
Sbjct: 381 EQYIDPEK 388

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 100/202 (49%), Gaps = 35/202 (17%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A AAKD+  A+E +  AI++      V Y+NR+A Y+S  K+ EA+ DA+  ++++P
Sbjct: 11  GNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKP 70

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDK--ATDIMKRDYETAKKKVEQSLNV 226
           +WSKG++RLG A +  G   EA E+YKKALE+D     A D + +   T ++++EQ    
Sbjct: 71  DWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQP--- 127

Query: 227 EKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMM 286
                                       G G    +P ++   Q++ +NP+  E M+   
Sbjct: 128 --------------------------DLGFGQMFQDPNLI---QKLKNNPKTAEMMKDPQ 158

Query: 287 QNPSIRQMAENLSSGSSEGMGD 308
               + Q   N  + S+E M D
Sbjct: 159 LVAKVLQFQSNPQAISTELMRD 180

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D+  AV+ Y   IK  P  A  Y+NRAAA +    + +AIKD + AI+ +PN+ + Y R 
Sbjct: 403 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRK 462

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGD 203
             A+ A  +   A+E    A E D +
Sbjct: 463 ATAQIAVQEYAAAIETLDTAREKDAE 488

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GN+    + ++ A+  Y  A  L      Y  NRAAA   +  Y+ AIK  E A+    +
Sbjct: 261 GNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRE 319

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   +K ++RLG A +     ++A+E Y+K+L
Sbjct: 320 LRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 96/192 (50%), Gaps = 36/192 (18%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY  A++ +  AI++  T   V Y+NR+A Y+S +K++EA+KDAE  +K+ P
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
           +WSKGY+R+G A+F   +  EA ++YK+ALE+D            + AK  +E       
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN---------KAAKDGLEH------ 114

Query: 229 XXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQ------MMSNPRAMEQM 282
                                 M   GL    N+P ++Q  +       MM +P+ + ++
Sbjct: 115 -------------VQSAKAGPQMPDLGLSQMFNDPNLIQNLKNNPKTADMMKDPQLVAKL 161

Query: 283 ESMMQNP-SIRQ 293
           E    NP SI Q
Sbjct: 162 EGYRNNPQSISQ 173

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D+  AV+ Y   +K  P  A  ++NRAAA +    + EAI+D   A+ ++PN+ + Y R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 178 GFAKFAQGKSQEALEAYKKALEVDG 202
             A+ A  +   A+E    A E D 
Sbjct: 455 ATAQIAVKEFAAAIETLNIAREKDA 479

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ +  A+E YN A +L      Y  NR+AA   +  YD AIK    A+    +
Sbjct: 253 GNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRE 311

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   +K ++R+G A +     ++A+E Y ++L
Sbjct: 312 LRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (69%), Gaps = 1/93 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AK+Y+ A+EK+  AI++  T   V Y+NR+A Y+S++++ + ++DA   +K+ P
Sbjct: 12  GNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
            WSKGY+R+G A F  G   EA +AYKKALE+D
Sbjct: 72  TWSKGYNRVGAAHFGMGDLDEAEKAYKKALELD 104

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 74/189 (39%), Gaps = 12/189 (6%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   I   P+ A  Y+NRAAA S    + EAI D  +AI+ +PN
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKX 229
           + + Y R   A+ A      A+E    A   D +       R+ +    K  Q       
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKANQQ------ 509

Query: 230 XXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNP 289
                                M    + + + +P +    QQ  +NP A+++    M+NP
Sbjct: 510 ---RFQPSNANETPEQTYERAMKDPEVAAIMQDPVMQSILQQAQTNPAALQE---HMKNP 563

Query: 290 SIRQMAENL 298
            I +  + L
Sbjct: 564 EIFKKIQTL 572

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 98/188 (52%), Gaps = 34/188 (18%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A AAK Y+ AV+ +  AI++  T   V Y+NR+A+Y+S++K++EA+KDA    K+ P
Sbjct: 12  GNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
           +W+KGY+R G A F  G   +A  +YKKALE+D +          + AK+ +EQ   V+ 
Sbjct: 72  SWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN---------KIAKEGIEQIQRVQS 122

Query: 229 XXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQ------QMMSNPRAMEQM 282
                                     GL    N+P +++  +      ++M++P+ + ++
Sbjct: 123 QRQAQPDL------------------GLTEMFNDPNLIEKLKNNPKTAELMNDPQLVAKL 164

Query: 283 ESMMQNPS 290
            S   NP+
Sbjct: 165 LSFRSNPN 172

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 82/194 (42%), Gaps = 22/194 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA S    + +AI D   AI+ +PN
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 170 WSKGYSRLGFAKFAQGKSQEALE----AYKKALEVDGD-KATDIMKRDYETAKKKVEQSL 224
           + + Y R   A+ A      A+E    A  K  EV+G   A +I +   + A+++ + + 
Sbjct: 452 FVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYMKAAQQRFQPAT 511

Query: 225 NVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
             E                       M    +   + +P +    QQ  ++P A+++   
Sbjct: 512 GDE--------------TPEQTYERAMRDPEVAKIMQDPVLQSILQQAQNDPAALQE--- 554

Query: 285 MMQNPSIRQMAENL 298
            M+NP I +  + L
Sbjct: 555 HMKNPEIFKKIQTL 568

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK---- 165
           GNKA  A++++ A+  YN A +L      Y  NR+AA   + +YD AI     AI+    
Sbjct: 258 GNKAYKARNFDEAIACYNKAWEL-DNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGRE 316

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   +K ++R+G A    G  +EA+  Y+K+L
Sbjct: 317 MRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 110/210 (52%), Gaps = 42/210 (20%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLV-PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A AAKD+  A+E +  AI++      V Y+NR+A Y+S +++++A++DA+  + + P
Sbjct: 10  GNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDG--DKATDIMKRDYETAKKKVEQSLNV 226
            WSKGY+R+G A F  G   EA + YKKALE+D     A D +++ ++T + + +Q    
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSRQQQP--- 126

Query: 227 EKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMM 286
                                       GLG   N+P ++   +++ +NP+  E    +M
Sbjct: 127 --------------------------DLGLGQIFNDPNLI---EKLKNNPKTAE----LM 153

Query: 287 QNPSIRQMAENLSSGSSEGMG-DFMNNPAI 315
           ++P +  +A+ L   S+  MG + + +P +
Sbjct: 154 KDPQL--VAKILQFKSNPQMGMEVLQDPRL 181

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA S    + EAIKD   AI  +PN
Sbjct: 400 GKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPN 459

Query: 170 WSKGYSRLGFAKFA 183
           + + Y R   A+ A
Sbjct: 460 FIRAYIRKATAQIA 473

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ ++ A+E Y+ A +L      Y  NRAAA   + +Y+ AIK    A+    +
Sbjct: 266 GNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRE 324

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   SK ++R+G +     + ++A+E Y+K+L
Sbjct: 325 LRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 91/183 (49%), Gaps = 8/183 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVP-TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY+ A++ ++ AI +      V Y+NR+A Y+S +K+  A+KDAE  +K+ P
Sbjct: 12  GNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD-----GDKATDIMKRDYETAKKKVEQS 223
           +WSKGY+R+G A F  G   EA   YKKALE+D       +  + + R  E+ +   +  
Sbjct: 72  SWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKAAQEGLEQVHRTQESRRGMPDMG 131

Query: 224 LNVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQME 283
           L                           L   L  + +NPQ +  +Q + ++PR M  M 
Sbjct: 132 LTQMFNDPNLIENLKKNPKTAEMMKDPQLVAKLIQYRSNPQAI--SQDLFTDPRLMTIMA 189

Query: 284 SMM 286
           ++M
Sbjct: 190 TLM 192

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 70/181 (38%), Gaps = 12/181 (6%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D+  AV+ Y   IK  P  A  Y+NRAA  S    + EAI D   AI+ +PN+ + Y R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKXXXXXXXXX 237
             A+ A  +   ALE    A   D +       R+ +    K  Q               
Sbjct: 472 ATAQIAVREFSSALETLDAARSKDAEVNKSANTREIDQLYIKASQQ---------RFQPN 522

Query: 238 XXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAEN 297
                        M    + + + +P +    QQ   NP A+++    M+NP I +  + 
Sbjct: 523 DSNESPEQTYERAMKDPEVAAIMQDPVMQSILQQAQQNPAALQE---HMKNPEIFKKIQT 579

Query: 298 L 298
           L
Sbjct: 580 L 580

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ ++ AV KYN A +       Y  NR+AA   +  Y+ +IK  E A+    +
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWE-AHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   +K ++R+G         ++A++ YKK+L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 104/215 (48%), Gaps = 35/215 (16%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVP-TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A +AK+Y  AV+ ++ AI++ P    V Y+NR+A Y+S +K+ +A+ DA    K+ P
Sbjct: 12  GNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
            WSKGY+R+G A +  G   EA ++YKKALE+D            + A++ +EQ    ++
Sbjct: 72  TWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASN---------KVAQEGLEQVKRTQE 122

Query: 229 XXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQN 288
                                     GL S  N+P ++   +++ SNP+  E    MM +
Sbjct: 123 ARKAQPDM------------------GLTSMFNDPNLI---EKLKSNPKTAE----MMND 157

Query: 289 PSIRQMAENLSSGSSEGMGDFMNNPAIREMASNLF 323
           P +     +  S S     +  ++P +  + + L 
Sbjct: 158 PQLVAKLLSYRSNSQALSTELFSDPRLMTIMATLL 192

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 96/249 (38%), Gaps = 24/249 (9%)

Query: 56  ASKFGGKSLTELLDAATNAKGRSSSPEDIKVSISXXXXXXXXXXXXXXXXXXXXGNKAMA 115
           A++F  KSLTE    AT  K RS   + IKV                       G     
Sbjct: 351 AAEFFNKSLTEFRTPATLTKLRSLE-KKIKVQ-----EAEAYINPEKAEEARIQGKDFFN 404

Query: 116 AKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYS 175
              +  AV+ Y   I   P  A  Y+NRAAA S    + EAI D E A++ +PN+ K Y 
Sbjct: 405 KGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYI 464

Query: 176 RLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMK-RDYETAKKKVEQSLN--VEKXXXX 232
           R       +  +Q A++ Y  ALE       DI + +D E       + +N    K    
Sbjct: 465 R-------KATAQIAIKEYSSALET-----LDIARSKDTELNNGSNIREINQLYAKATQQ 512

Query: 233 XXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIR 292
                             M    + + + +P +    QQ  +NP A+++    M+NP I 
Sbjct: 513 RFEPASSNETPEQTYQRAMKDPEVAAIMQDPVMQSILQQAQTNPAALQE---HMKNPEIF 569

Query: 293 QMAENLSSG 301
           +  + L S 
Sbjct: 570 KKIQTLISA 578

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 88/183 (48%), Gaps = 8/183 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY+ A+E +  AI++  T   V Y+NR+A Y+S +K+ +A+ DA   +K+ P
Sbjct: 12  GNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGD-----KATDIMKRDYETAKKKVEQS 223
           +WSKGY+RLG A    G   EA   YKKALE+D       +  D + R  +  + + +  
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRTQQARQAQPDLG 131

Query: 224 LNVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQME 283
           L                           L   L  +  NPQ +   Q + ++PR M  M 
Sbjct: 132 LTQLFADPNLIENLKKNPKTSEMMKDPQLVAKLIGYKQNPQAI--GQDLFTDPRLMTIMA 189

Query: 284 SMM 286
           ++M
Sbjct: 190 TLM 192

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 22/187 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA +    + EAI D   AI+ +PN
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 170 WSKGYSRLGFAKFAQGKSQEALE----AYKKALEV-DGDKATDIMKRDYETAKKKVEQSL 224
           + + Y R   A+ A  +   ALE    A  K  EV +G  A +I +  Y+ ++++ +   
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQPGT 522

Query: 225 NVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
           + E                       M    + + + +P +    QQ   NP A+++   
Sbjct: 523 SNE--------------TPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQE--- 565

Query: 285 MMQNPSI 291
            M+NP +
Sbjct: 566 HMKNPEV 572

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ ++ A+E YN A +L      Y  NRAAA   + +Y+ AI     A+    +
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 327

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   SK ++R+G A    G  ++ +E Y+K+L      D  T +   + E  K + 
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEA 387

Query: 221 EQSLNVEK 228
           E  +N EK
Sbjct: 388 EAYVNPEK 395

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 102/211 (48%), Gaps = 14/211 (6%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKD+  A E ++ AI+   T   V Y+NR+A Y+S +K+ EA++DAE  +K+ P
Sbjct: 10  GNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINP 69

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
            WSKGY+R+G A++  G   +A + YKKALE+D            + A++ +EQ    + 
Sbjct: 70  TWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN---------KAAQEGLEQVQKTQN 120

Query: 229 XXXXXXXXXXXXXXXXXXXXXXMLGGG-LGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQ 287
                                 +         + +PQ++    Q  SNP+ M Q   +M+
Sbjct: 121 ARQQQPDLGFGQLFNDPNMIEKLKSNPKTAELMKDPQLVSKVLQFQSNPQMMGQ--EVMK 178

Query: 288 NPSIRQ-MAENLSSGSSEGMGDFMNNPAIRE 317
           +P +   MA  L    + G GD    PA ++
Sbjct: 179 DPRMMTIMAAILGIDLNMGAGDEPKEPATQQ 209

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 6/91 (6%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D+  AV  Y   IK  P  A  Y+NRAA  +    + +AIKD + AI  +PN+ + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGDKATDI 208
             A+ A  +   A+E       +D  +A D+
Sbjct: 476 ASAQIAVREFAPAMET------LDAARAKDL 500

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ ++ A+E YN A  L      Y  NR+AA   +  Y++AIK    A+    +
Sbjct: 274 GNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGRE 332

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   SK ++R+G A       ++A+E Y+++L
Sbjct: 333 MRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 94/184 (51%), Gaps = 37/184 (20%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVP-TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY  A E +  AI +      V Y+NR+A Y+S +K+ E +KDAE  +K+ P
Sbjct: 11  GNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINP 70

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD-GDKATDIMKRDYETAKKKVEQSLNVE 227
            WSKGY+R+G A+F     ++A ++Y+KALE+D  +KA          AK+ ++Q L   
Sbjct: 71  GWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSANKA----------AKEGLDQVLKTR 120

Query: 228 KXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQ 287
           +                      M   GLG   N+P ++   +++  NP+  E    +M+
Sbjct: 121 E------------------SRQQMPDLGLGQMFNDPNMI---EKLKKNPKTAE----LMK 155

Query: 288 NPSI 291
           +P +
Sbjct: 156 DPQL 159

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +  +  D+  AV+ Y   IK  P  A  Y+NRAAA +    + EAI D + AI+ +PN
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 170 WSKGYSRLGFAKFA 183
           + + Y R   A+ A
Sbjct: 449 FIRAYIRKASAQIA 462

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 68/130 (52%), Gaps = 14/130 (10%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ ++ A+E YN A +L      Y  NRAAA   +  Y+ AI    +A+    +
Sbjct: 255 GNKFYKARKFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGDYETAIATLTNAVDEGRE 313

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKR----DYETAKK 218
           +  ++   +K ++R+G A    G  ++++  Y+K+L     ++ D++ +    + E  K+
Sbjct: 314 MRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL--TEHRSADVLNKLRNAEKELKKQ 371

Query: 219 KVEQSLNVEK 228
           + E+ ++ EK
Sbjct: 372 EAEEYVDPEK 381

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 96/183 (52%), Gaps = 8/183 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKA-VYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AK+Y+ A+E +  AI++  T + V ++NR+A Y+S +K+ +A+ DA   +K+ P
Sbjct: 12  GNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDK--ATDIMKRDYETAK-KKVEQSLN 225
           +WSKGY+RLG A    G   EA   YKKALE+D +   A D +++ + T + ++ +  L 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQARQAQPDLG 131

Query: 226 VEK--XXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQME 283
           + +                         L   L S+  NPQ +   Q + S+PR M  M 
Sbjct: 132 LTQLFADPNLIENLKKNPKTSEMMKDPQLVAKLISYKMNPQAI--GQDLFSDPRLMTIMA 189

Query: 284 SMM 286
           ++M
Sbjct: 190 TLM 192

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 22/194 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA +    + EAI D   AI+ +PN
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 170 WSKGYSRLGFAKFAQGKSQEALE----AYKKALEVD-GDKATDIMKRDYETAKKKVEQSL 224
           + + Y R+  A+ A  +   ALE    A  K  EV+ G  A +I +  Y+ ++++ +   
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETLDVARTKDAEVNKGASAKEIDQLYYKASQQRFQPDT 522

Query: 225 NVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
             E                       M    + + + +P +    QQ   NP A+++   
Sbjct: 523 GSE--------------TPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQE--- 565

Query: 285 MMQNPSIRQMAENL 298
            M+NP++ +  + L
Sbjct: 566 HMKNPAVFKKIQTL 579

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 58/124 (46%), Gaps = 18/124 (14%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAI----------KD 159
           GNK   A  ++ A+E YN A +L      Y  NRAAA   +  Y+  I          +D
Sbjct: 269 GNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRD 327

Query: 160 AESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMK--RDYETAK 217
             +  KV    SK ++R+G A    G  ++ +E Y+K+L     +  DI+   R+ E  +
Sbjct: 328 MRADYKV---ISKSFARIGNAYHKLGDLKKTIEYYQKSLT--EHRTADILAKLRNVEKEQ 382

Query: 218 KKVE 221
           KK E
Sbjct: 383 KKAE 386

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 61/94 (64%), Gaps = 1/94 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY+ A+E +  AI++  T   V Y+NR+A Y+S +K+ +A+ DA+  I + P
Sbjct: 12  GNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDG 202
           +WSKGY+RLG A    G   EA   YKKALE+D 
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 75/179 (41%), Gaps = 22/179 (12%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D+  AV+ Y   IK  P  A  Y+NRAAA +    + EAI D   AI+ +PN+ + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 178 GFAKFAQGKSQEALEAYKKALEVDGD-----KATDIMKRDYETAKKKVEQSLNVEKXXXX 232
             A+ A  +   ALE    A   D D      + +I +  Y+ ++++ +     E     
Sbjct: 471 ATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKASQQRFQPGTGNE----- 525

Query: 233 XXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSI 291
                             M    + + + +P +    QQ   NP A+++    M+NP +
Sbjct: 526 ---------TPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQE---HMKNPEV 572

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 62/128 (48%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ ++ A+E YN A +L      Y  NRAAA   + +Y  AI     A+    +
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGRE 327

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   S+ ++R+G A    G  ++ +E Y+K+L      D  T +   + E  K + 
Sbjct: 328 MRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILTKLRNAEKELKKAEA 387

Query: 221 EQSLNVEK 228
           E  +N EK
Sbjct: 388 EAYINPEK 395

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 87/184 (47%), Gaps = 14/184 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL--VPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVE 167
           GN A  AKDY  A E +  AI+    P   V Y+NR+A ++S +K++EA+ DA   +K+ 
Sbjct: 10  GNAAFVAKDYEKASELFTKAIEASEAPNH-VLYSNRSACFTSLKKFNEALNDANECVKIN 68

Query: 168 PNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVE 227
           P WSKGY+R+G A F  GK  EA + YKKALE+D            + A+  +EQ    +
Sbjct: 69  PAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN---------KAAQDGLEQVQKAQ 119

Query: 228 KXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQ 287
           K                               + +PQ++    Q  SNP+ M     ++Q
Sbjct: 120 KSQQQPDLGFGQMFSDPNMIEKLKNNPKTAELMKDPQLVSKVLQFQSNPQMM--GPEILQ 177

Query: 288 NPSI 291
           +P +
Sbjct: 178 DPRM 181

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y    K  P  A  Y+NRAAA +    + EAIKD + AI  +PN
Sbjct: 408 GKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPN 467

Query: 170 WSKGYSRLGFAKFA 183
           + + Y R   A+ A
Sbjct: 468 FIRAYIRKATAQIA 481

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 15/124 (12%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK---- 165
           GNK   A+ ++ A+E YN A  L      Y  NR+AA   +  Y++AIK    A++    
Sbjct: 274 GNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGRE 332

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQ 222
           +  ++   SK ++R+G A          LE +KKA+E      T+    D  T  +  E+
Sbjct: 333 MRADYKLISKSFARIGNAYLK-------LEDFKKAIEFYQKSLTEHRTPDILTKLRNCEK 385

Query: 223 SLNV 226
              V
Sbjct: 386 EQKV 389

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 101/215 (46%), Gaps = 35/215 (16%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A A+KD+  A+E +  AI    T   V Y+NR+A Y+S +++ EA+ DA+  +K+ P
Sbjct: 11  GNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINP 70

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
           +WSKGY+R+G A    G   +A   YKKALE+D +          + A + +EQ   V++
Sbjct: 71  DWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASEGLEQVHRVQE 121

Query: 229 XXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQN 288
                                     G+    ++P +++  +Q   NP+     + MM +
Sbjct: 122 SRKSRPDF------------------GMTEMFSDPNLIEKLRQ---NPKT----KDMMND 156

Query: 289 PSIRQMAENLSSGSSEGMGDFMNNPAIREMASNLF 323
           PS+    ++  S       D M +P +  + + L 
Sbjct: 157 PSLVAKLQSYKSNPQGLSSDLMGDPRLMTIMATLL 191

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 86/197 (43%), Gaps = 22/197 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA +    + EAIKD E AI+ +PN
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD-----GDKATDIMKRDYETAKKKVEQSL 224
           + + Y R   A+ A     +ALE  ++A + D     G  + +IMK   +  +++ +   
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKATQERFQAPT 516

Query: 225 NVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
             E                       M    + + + +P +    QQ  ++P A+++   
Sbjct: 517 GNE--------------TPEETYKRAMQDPEVAAIMQDPVMQSILQQAQNDPAALQE--- 559

Query: 285 MMQNPSIRQMAENLSSG 301
            M+NP I +  + L S 
Sbjct: 560 HMKNPEISKKIQVLVSA 576

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK---- 165
           GNK   +  ++ A+ +YN A  L      Y  NR+AA   +  ++ A+     A++    
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLH-KDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRE 321

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   +K ++R+G A   Q   ++A+E Y+K+L      D  T +   + E  K+++
Sbjct: 322 LRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQEI 381

Query: 221 EQSLNVEK 228
           E+ +N EK
Sbjct: 382 EEYINPEK 389

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 89/184 (48%), Gaps = 10/184 (5%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL--VPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVE 167
           GN A  AKDY  A++ +  AI++   P   V Y+NR+A Y+S +K+ +A+ DA   +K+ 
Sbjct: 12  GNAAFTAKDYGKAIDLFTKAIEVSEAPNH-VLYSNRSACYTSLKKFTDALNDATECVKIN 70

Query: 168 PNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD-GDKAT----DIMKRDYETAKKKVEQ 222
           P+WSKGY+RLG A    G   +A   YKKALE+D  +KA     D + R  +  + + + 
Sbjct: 71  PSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAANKAAKDGLDQVHRSQQARQAQPDL 130

Query: 223 SLNVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQM 282
            L                           L   L  +  NPQ +   Q + S+PR M  M
Sbjct: 131 GLTQLFADPNLIENLKKNPKTSEMMKDPQLVAKLIGYKQNPQAI--GQDLFSDPRLMTIM 188

Query: 283 ESMM 286
            ++M
Sbjct: 189 ATLM 192

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 83/194 (42%), Gaps = 22/194 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA +    + EAI D   AI+ +PN
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 170 WSKGYSRLGFAKFAQGKSQEALE----AYKKALEV-DGDKATDIMKRDYETAKKKVEQSL 224
           + + Y R   A+ A  +   ALE    A  K  EV +G  A +I +  Y+ ++++ +   
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQQRFQSGT 519

Query: 225 NVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284
             +                       M    + + + +P +    QQ   NP A+++   
Sbjct: 520 GND--------------SPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQE--- 562

Query: 285 MMQNPSIRQMAENL 298
            M+NP + +  + L
Sbjct: 563 HMKNPEVYKKIQTL 576

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GNK   A+ +  A+E YN A +L      Y  NRAAA   +  Y+ AI     A+    +
Sbjct: 266 GNKFYKARQFEEAIEHYNKAWELH-RDITYLNNRAAAEYEKGDYETAIATLTDAVEQGRE 324

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   SK ++R+G A    G  ++ ++ Y+K+L      D  T +   + E  K + 
Sbjct: 325 MRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSLTEHRTADILTKLRNAEKELKKAEA 384

Query: 221 EQSLNVEK 228
           E  +N EK
Sbjct: 385 EAYINPEK 392

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 102/222 (45%), Gaps = 26/222 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVP-TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN+A A+KDY  A+E +  AI++      V ++NR+A Y+S + + +A+ DA   +K+ P
Sbjct: 10  GNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINP 69

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
           +W+KGY+RLG A +  G   EA ++YKKALE+D             +A K  +  L+  +
Sbjct: 70  SWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD-------------SANKAAQDGLSQVQ 116

Query: 229 XXXXXXXXXXXXXXXXXXXXXXML-----GGGLGSFLNNPQIMQAAQQMMSNPRAMEQME 283
                                 M+           F+ +PQ +    Q   NP+AM Q  
Sbjct: 117 QTQQQRTAQPDLGLGNMFKDPMMIEKLKKNPKTAEFMKDPQFVAKILQFQQNPQAMGQ-- 174

Query: 284 SMMQNPSIRQ-----MAENLSSGSSEGMGDFMNNPAIREMAS 320
            M+ +P +       M  +LS   +E        PA +E AS
Sbjct: 175 EMLSDPRLMTVLAALMGIDLSMDPNESNSIPKEEPAAKEAAS 216

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AVE Y   IK  P  A  Y+NRAAA S    + +AI+D + AI+ +PN
Sbjct: 396 GKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPN 455

Query: 170 WSKGYSRLGFAKFA 183
           + + Y R    + A
Sbjct: 456 FVRAYIRKATGQIA 469

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 10/128 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAI----KDAESAIK 165
           GNK    + ++ A+EKYN A +       Y  NRAAA   +  Y+ AI    K  E   +
Sbjct: 262 GNKLYKQRKFDEAIEKYNEAWE-THNDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRE 320

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL--EVDGDKATDIMKRDYETAKKKV 220
           +  ++   SK ++R+G +    G  ++A++ Y+K+L      D  T +   + E  +K+ 
Sbjct: 321 LRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEA 380

Query: 221 EQSLNVEK 228
           E  ++ EK
Sbjct: 381 ESYMDPEK 388

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (65%), Gaps = 1/97 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTK-AVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKDY  A++ +  AI++  T   V Y+NR+AAY+S ++Y++A+ DA+  IK+ P
Sbjct: 12  GNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINP 71

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKA 205
           +W+KGY+R G A     K +EA + Y + L++D + A
Sbjct: 72  SWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y   IK  P  A  Y+NRAAA +    + +AI D   AI+ +P+
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDK 204
           + + Y R    + A  +   A+E    A E D  K
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAIETLDLARERDDGK 486

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKD----AESAIK 165
           GNKA  A+ ++ A+  YN A +       Y  NR+AA   +  Y+  IK      E+A +
Sbjct: 258 GNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVENARE 316

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +  ++   +K ++R+G A       ++A+E Y+K+L
Sbjct: 317 LRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 86/173 (49%), Gaps = 10/173 (5%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVP-TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GN A  AKD+  AVE +  AI+       V Y+NR+ AY+S +K+DEA+ DA   +K++ 
Sbjct: 11  GNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKA 70

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
           +WSKG++RLG A F  G   EA E+YKKALE+D   AT+      + AK  +EQ    ++
Sbjct: 71  DWSKGHNRLGAAHFGLGNLDEAEESYKKALELD---ATN------KAAKDGLEQVQAAQQ 121

Query: 229 XXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQ 281
                                          + +PQ++    Q  +NP+ M Q
Sbjct: 122 RRQQPDLGFGQMFQDPNLIEKLKNNPKTAEMMKDPQLVAKVLQFRNNPQLMSQ 174

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 7/187 (3%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +     D+  AV+ Y+  I   P  A  Y+NRAAA S    + +AIKD + AI+++P+
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 170 WSKGYSRLGFAKFAQGKSQEALE----AYKKALEVDGDKATDIMKRDYETAKKKVEQSLN 225
           + + Y R   A+ A  +   A+E    A  K  EV+   +   + + Y  A ++  Q  N
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSSIREIDQLYVKATQQRFQPAN 518

Query: 226 VEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESM 285
             +                      ++   L     NP    A Q+ M NP   ++M+++
Sbjct: 519 TNESPEETYARAVKDPEVASILQDPVMQSILAQAQQNP---AALQEHMKNPEVFKKMQTL 575

Query: 286 MQNPSIR 292
           +    IR
Sbjct: 576 IAAGIIR 582

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 14/130 (10%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI----K 165
           GN+    + ++ A+ KY  A  L      Y  NRAAA   +  Y+ AIK    A+    +
Sbjct: 265 GNQLYKQRKFDEAIAKYEEAWNLQ-KDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRE 323

Query: 166 VEPNW---SKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKR----DYETAKK 218
           +  ++   +K ++RLG A +   + ++A+E Y+K+L     +  D++ +    + E  K+
Sbjct: 324 LRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL--TEHRTPDVLNKLRNLEREIKKR 381

Query: 219 KVEQSLNVEK 228
           + E  ++ EK
Sbjct: 382 EAEAYIDPEK 391

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPT-KAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP 168
           GNK    K Y  AV  + +A+    T K + Y+NRAAA+   + Y EA++D ++ +++ P
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 169 NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           NW KGYSR+G A     K  EA E +KKAL+++
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQLN 107

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (51%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G +    ++Y  A++ Y   IK  PT  V + NRAA +       + I D + AI V+P+
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAY 194
           + K Y R GFA+  +    EALE +
Sbjct: 496 YIKAYVRKGFAQITERDLDEALETW 520

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 46/71 (64%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+ +   DY+ A+E Y+ AI L  T+++Y++NRA A+  Q+ +  A+ D ++A+K++P 
Sbjct: 19  GNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPK 78

Query: 170 WSKGYSRLGFA 180
             K Y R G +
Sbjct: 79  NIKAYHRRGLS 89

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 47/71 (66%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GNK +A+KDY  A+E Y  AI+L   ++++++NRA A    +++  A++D+  AI+++ +
Sbjct: 16  GNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSS 75

Query: 170 WSKGYSRLGFA 180
             KGY R G A
Sbjct: 76  NVKGYHRRGMA 86

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  +DY  A+EKY+ AI+L  T++VY++NRA  +   + +  A +D + A+ ++P 
Sbjct: 16  GNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPK 75

Query: 170 WSKGYSRLGFA 180
             K Y R G A
Sbjct: 76  NVKAYHRRGLA 86

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GNK +  K Y  AVE Y  AI+L  T++++++NRA A    + +   + D  SA++++P 
Sbjct: 20  GNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPK 79

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
             K Y R       +G SQ  L  +KKA
Sbjct: 80  NIKAYHR-------RGLSQLGLLHFKKA 100

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  + ++DY  A+E Y  AI+L  T +++Y+NRA A+   + +  A+ D   AIK++ N
Sbjct: 19  GNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNN 78

Query: 170 WSKGYSRLGFA 180
             K Y R G A
Sbjct: 79  NIKAYHRRGLA 89

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN A+  +DY  A+E Y  AIKL  T ++Y++NRA  +   + +   I D + A++++P 
Sbjct: 19  GNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPK 78

Query: 170 WSKGYSRLG 178
             K Y R G
Sbjct: 79  NIKAYHRRG 87

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+   AKD+  A+E Y  AI L     V+Y+NR+AAY S   +++ ++D  +A+K++P+
Sbjct: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169

Query: 170 WSKGYSR 176
           +SK + R
Sbjct: 170 YSKCWLR 176

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K +  A+EKY  AI L  T+++Y++NRA A+   + +  A+ D + AIK++P 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
             K Y R       +  S  AL  +KKA
Sbjct: 79  NIKAYHR-------RALSCMALLEFKKA 99

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K +  A+EKY  AI L  T+++Y++NRA A+   + +  A+ D + AIK++P 
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
             K Y R       +  S  AL  +KKA
Sbjct: 79  NIKAYHR-------RALSCMALLEFKKA 99

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K +  A+EKY  AI L  T+++Y++NRA A+   + +  A+ D + A+K++P 
Sbjct: 19  GNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPK 78

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
             K Y R       +  S  AL  +KKA
Sbjct: 79  NIKAYHR-------RALSCMALLEFKKA 99

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GNK +  +D+  A E Y  AI+  PT++++Y+NRA A    + +  A+ D  +AI++  +
Sbjct: 16  GNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSS 75

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIM-KRDYETAKKKVEQ 222
             K Y R G A       + A   +   L+    K  DI+ K  ++T +K + +
Sbjct: 76  NLKAYHRRGLANIGLLNFKSARNDFNIVLKY---KPNDIIAKNGFDTCEKVIRE 126

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 57/107 (53%), Gaps = 5/107 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  +D+  A++ Y  AI L  T+++Y++NRA A+   + +  ++ D + A+K++P 
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPK 78

Query: 170 WSKGYSR-----LGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKR 211
            +K Y R     +G  +F + K+   +    K  +    +A D+ ++
Sbjct: 79  NAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALDVCEK 125

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 47/81 (58%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  ++Y  A+E Y+ AI+L PT++++++NRA A    + +   + D + A++++P 
Sbjct: 19  GNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPK 78

Query: 170 WSKGYSRLGFAKFAQGKSQEA 190
             K Y R G +     + ++A
Sbjct: 79  NIKAYHRRGLSHLGLLQCKKA 99

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K+++ A E Y+ AI+L  T+++Y++NRA A+   + +  A+ D   AI+++P 
Sbjct: 19  GNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPK 78

Query: 170 WSKGYSR-----LGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSL 224
             K Y R     +G  +F + +    +    K  E    +A D+ +R     K+K E+++
Sbjct: 79  NVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEPVATRALDVCER--VIRKEKFEKAI 136

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K +  A+EKY  AI L  T+ +Y++NRA ++   + +  A+ D + AIK++P 
Sbjct: 19  GNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPK 78

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
             K Y R       +  S  AL  +KKA
Sbjct: 79  NIKAYHR-------RALSCMALLEFKKA 99

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 13/104 (12%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+ + AKDY  AVE Y  AI+   T++++++NRA A    +++  A++D+  AI+++  
Sbjct: 45  GNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAG 104

Query: 170 WSKGYSRLGFAKFA---QGKSQEAL----------EAYKKALEV 200
             K Y R G A       G ++  L          EA ++ALEV
Sbjct: 105 NVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEV 148

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GNK   AKDY  A++ YN A+ L     ++Y+N +A Y S  + D+ I+ +  A+++ PN
Sbjct: 129 GNKYFKAKDYTNAIKYYNLALDL-NKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +SK   R       +  + E+LE Y  AL
Sbjct: 188 YSKALLR-------RASANESLENYSDAL 209

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 12/103 (11%)

Query: 134 PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEA 193
           P     Y N +A Y   ++ D+A + +   I +EP   KGY R+G     QGK  EA + 
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 194 YKKALE-----------VDGDKATDIMKRDYETAKKKV-EQSL 224
           YKK L            V  +K  DI+K+  +  KK++  QSL
Sbjct: 128 YKKGLLMSREMLQKFDIVVPEKFRDIIKQQRDIVKKRINNQSL 170

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN    AK++N A++ Y  AI+L P + V+Y+N +A Y S    ++ I+    A++++P+
Sbjct: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193

Query: 170 WSKGYSR 176
            SK   R
Sbjct: 194 HSKALLR 200

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%)

Query: 137 AVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKK 196
           AV   NR   + + + ++EAIK  + AI+++PN    YS +     + G  ++ +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 197 ALEVDGDKATDIMKR 211
           ALE+  D +  +++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  ++Y+ A+E Y  AI+L P ++++Y+NRA A    + +  A  D   A+ ++  
Sbjct: 19  GNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSK 78

Query: 170 WSKGYSRLGFA 180
             K Y R G A
Sbjct: 79  NVKAYHRRGLA 89

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%)

Query: 136 KAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYK 195
           KAV + N    +  ++ Y +AI+    AI+++PN S  YS    A+      Q A     
Sbjct: 11  KAVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCN 70

Query: 196 KALEVD 201
           +AL +D
Sbjct: 71  EALTLD 76

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 56/107 (52%), Gaps = 5/107 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  +D+  A E Y  AI+L  TK+++++NRA A+  Q+ +  ++ D + A++++  
Sbjct: 19  GNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSK 78

Query: 170 WSKGYSR-----LGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKR 211
             K Y R     +G  +F + ++        K  +V  D+A  I ++
Sbjct: 79  NIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    + Y  A++ Y+ A+KL     V+Y+NR+A Y    K ++ ++D  +A+K++P+
Sbjct: 102 GNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 161 YSKCLLR 167

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN    AK +  A++ Y  AI+L P   V+Y+N +A Y S    D+ ++    A++++P+
Sbjct: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197

Query: 170 WSKGYSR 176
            SK   R
Sbjct: 198 HSKALLR 204

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%)

Query: 137 AVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKK 196
           AV   ++   + + + + +AIK  + AI+++PN    YS +     + G   + +E   K
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190

Query: 197 ALEVDGDKATDIMKR 211
           ALE+  D +  +++R
Sbjct: 191 ALEIKPDHSKALLRR 205

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K Y+ A++ Y+ AI+ V    V+Y+NR+A Y S  + ++ ++D  +A+K++P+
Sbjct: 102 GNEFFKNKKYDEAIQYYSWAIE-VKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 160

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 161 YSKCLLR 167

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 52/89 (58%), Gaps = 8/89 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    KDY+ A++ YN A+ +V    V+Y+N +A Y S  + D+ ++++  A++++P+
Sbjct: 108 GNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPD 166

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +SK   R       +  + E+LE Y  A+
Sbjct: 167 YSKALLR-------RASANESLENYADAM 188

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN    +K+++ A++ Y  AI+L P   V+Y+N +A Y S    ++ ++    A++++P+
Sbjct: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191

Query: 170 WSKGYSR 176
            SK   R
Sbjct: 192 HSKALLR 198

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%)

Query: 137 AVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKK 196
           AV   ++   + + + +D+AIK  + AI+++PN    YS +     + G   + +E   K
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 197 ALEVDGDKATDIMKR 211
           ALE+  D +  +++R
Sbjct: 185 ALEIKPDHSKALLRR 199

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 47/82 (57%), Gaps = 5/82 (6%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K Y  AVE Y+ AI+L  T++++++NRA +    + +  A++D   +I+++P 
Sbjct: 19  GNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPK 78

Query: 170 -----WSKGYSRLGFAKFAQGK 186
                  +G S +G  +F++ +
Sbjct: 79  NIKAIHRRGLSYVGLLEFSKAR 100

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 136 KAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYK 195
           KA+ + N+  A+  ++KY EA++    AI+++   S  +S   F++        ALE   
Sbjct: 11  KALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCN 70

Query: 196 KALEVDGDKATDIMKR--------DYETAKKKVEQSLNVE 227
           K++E+D      I +R        ++  A+K ++  L V+
Sbjct: 71  KSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVK 110

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K Y  A++ Y+ A++L     V+Y+NR+A +    K ++ ++D  +A++++P+
Sbjct: 105 GNECFKEKKYEEAIKYYSCALRL-KKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 164 YSKCLLR 170

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN  +  K Y  AVE Y+ AI+L  T+++Y++NRA +    + +  A +D + AI ++P 
Sbjct: 17  GNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPK 76

Query: 170 WSKGYSRLGFA 180
             K   R G +
Sbjct: 77  NIKAIHRRGLS 87

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%)

Query: 136 KAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYK 195
           +A+ + N+  AY  ++KY EA++    AI+++   S  +S   F++        A E   
Sbjct: 9   QALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCD 68

Query: 196 KALEVDGDKATDIMKR 211
           KA+ +D      I +R
Sbjct: 69  KAIALDPKNIKAIHRR 84

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     K++  A++ Y  AI+L P   V+Y+N +A Y S    ++ ++    A++++P+
Sbjct: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190

Query: 170 WSKGYSR 176
            SK   R
Sbjct: 191 HSKALLR 197

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 135 TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAY 194
           T AV   N+   + + + + EAIK  + AI+++PN    YS +     + G   + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 195 KKALEVDGDKATDIMKR 211
            KALE+  D +  +++R
Sbjct: 182 TKALEIKPDHSKALLRR 198

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K +  A++ Y+ AI+ V    V+Y+NR+A Y S  + ++ ++D  +A+K++P+
Sbjct: 103 GNEFFKNKQFEDALKYYSLAIE-VKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 161

Query: 170 WSKGYSRLGFAKFAQGKSQEAL 191
           +SK   R   A  + GK  +A+
Sbjct: 162 YSKCLLRRASANESLGKFADAM 183

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI 164
           GN+     +Y+LA+E+Y   I L PT AV Y+N A AY      DEA    E  +
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGL 96

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+   +KD   A++ Y  A++L     V+Y+N +A Y +  + D+ I+ +  A++++P+
Sbjct: 165 GNQYFKSKDNENAIKYYEYALRL-DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPD 223

Query: 170 WSKGYSRLGFAKFAQGKSQEAL 191
           +SK   R   A  A G ++EAL
Sbjct: 224 YSKALLRRANAYEALGNNKEAL 245

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+      +  A++ Y+ A+KL     +YY+N +A Y+S  +Y++ I+ A  A+K+ P 
Sbjct: 117 GNELFKTSKFEDAIKYYHYALKL-KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175

Query: 170 WSKGYSRLGFAKFAQGKSQEAL 191
           +SK   R   A  A G   +A+
Sbjct: 176 FSKVLMRRALAYEAMGNFGDAM 197

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 8/89 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    KDY+ A++ Y+ A+ L     V+Y+N +A Y S  + D+ ++++  A++++P+
Sbjct: 113 GNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +SK   R       +  + E+LE Y  A+
Sbjct: 172 YSKALLR-------RASANESLENYPDAM 193

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     K +  A+E YN AIKL     V+++N +A Y S    D+ ++ +  A++++P+
Sbjct: 100 GNALFKEKRFEDAIEFYNHAIKL-HEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158

Query: 170 WSKGYSRLGFAKFAQGKSQEAL 191
           +SK   R   A    G+ Q+A+
Sbjct: 159 YSKALLRRASAYENMGRYQDAM 180

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN    A  +  A++ YN AI+L     ++Y+N +A Y S  K +E IK    A++++P+
Sbjct: 118 GNSLFKADKFEEAIKYYNWAIEL-KENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPD 176

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +SK   R       +  + E LE Y  A+
Sbjct: 177 YSKVLLR-------RANANEKLENYADAM 198

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD+  A++ Y  A+ L     VYY+N +A YSS   Y++ I+ A  A+ + P+
Sbjct: 102 GNALFKKKDFENAIKYYTFALSL-KEDPVYYSNISACYSSLLNYEKVIEMATKALALRPD 160

Query: 170 WSK-------GYSRLG 178
           +SK        Y +LG
Sbjct: 161 YSKVLVRRANAYEKLG 176

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KDY  A+  Y  A++L     V+Y+N AA Y S E   EAI+    A+++ P+
Sbjct: 93  GNAYFKVKDYENAINYYKFALQL-KNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151

Query: 170 WSK 172
           +SK
Sbjct: 152 YSK 154

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 142 NRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           NRAA++    K D+A+KDA++ I+VEP+  K Y R G       K +EA   Y + L++
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNYSQGLKM 134

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 49/89 (55%), Gaps = 8/89 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    KDY  A++ Y+ A+ ++    V+Y+N +A Y S  + D+ I+ +  A++++P+
Sbjct: 115 GNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           +SK   R       +  + E LE Y  A+
Sbjct: 174 YSKALLR-------RATANEQLENYSDAM 195

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K ++ A++ YN A++L     V+Y+NR+A Y S  + ++ ++D  +A+K++ +
Sbjct: 109 GNEFFKEKKFDDAIKYYNLALEL-KKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSD 167

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 168 YSKCLLR 174

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL-VPTKAV---YYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN    A+ Y  A E YN  +++     A+    + NRAA     + +   I D + A++
Sbjct: 87  GNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALR 146

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKAT------DIMKRDYE 214
             P   K + R+G A F+  K +EA EA +  L  D + A        I+K+D E
Sbjct: 147 YNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNAALGALLDKIVKKDEE 201

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 11/99 (11%)

Query: 134 PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEA 193
           P   V   NRAA +    K D A+ DA   I V+    KGY R G      G+ +EAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 194 YKKALEVDGD-----------KATDIMKRDYETAKKKVE 221
           Y+  L+  G+           K  DI+ R   T K+ ++
Sbjct: 127 YENGLKQAGEAEKTHAIHAPQKFLDIVYRQRSTIKELLQ 165

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 36/54 (66%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + +++ +D+ I   ESA+KV PN    ++RLG +     +S+EA++AY +AL++
Sbjct: 468 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 521

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 36/54 (66%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + +++ +D+ I   ESA+KV PN    ++RLG +     +S+EA++AY +AL++
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 36/54 (66%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + +++ +D+ I   ESA+KV PN    ++RLG +     +S+EA++AY +AL++
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D++  ++ + +A+K+ P   + +    A+ ++  + +EAI+    A++++P++ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 178 GFAKFAQGKSQEALEAYKKAL---EVDGDKATDI 208
             +    G  +EA       L   EVD  K  D+
Sbjct: 532 AVSSMNIGCYKEAAGYLLTVLSMHEVDTKKKGDL 565

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL----VPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN    AK +  A E YN  I++           YANRAA     + Y   + D ++A++
Sbjct: 85  GNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQ 144

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
             P   K Y R+G A  A    +EA ++ +  L+VD
Sbjct: 145 YNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVD 180

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD+  A+E +  A K+ P  A  Y  +    SS + +D A K    AI  +P 
Sbjct: 558 GNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPR 617

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
               Y  +G      G   EAL  ++KA ++
Sbjct: 618 HYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL-VPTKAV---YYANRAAAYSSQEKYDEAIKDAESAIK 165
            N     K +  A E Y   IK+    K++    +ANRAA     + Y   + D + A++
Sbjct: 92  ANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAME 151

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           + P   K + R+G A  A GK +EA +A    L++D
Sbjct: 152 INPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKID 187

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GNK +  K Y  A E Y  AI+  P   + Y+NRA      + +  ++ DA+ AI+++ N
Sbjct: 20  GNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNN 79

Query: 170 WSKGYSR-----LGFAKFAQGK 186
             K Y R     +G  +F + +
Sbjct: 80  NLKAYHRRAMSYIGLLEFRKAR 101

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKV 166
           GN +     Y+ A+  YN  I + P+  + Y+N+A A    +++DEAI   E  +++
Sbjct: 10  GNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 36/54 (66%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + +++ +D+ I   ESA++V PN    ++RLG +     +S+EA++AY +AL++
Sbjct: 467 FYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 9/80 (11%)

Query: 131 KLVPTKAVYYANRAA---------AYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAK 181
           +LV T+A+    R+          AY  +++  E+++   SA++V+PN  + +  LG A 
Sbjct: 670 RLVKTEAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAY 729

Query: 182 FAQGKSQEALEAYKKALEVD 201
           FA G+ + + + ++KA+E+D
Sbjct: 730 FACGRVEASTKVFEKAIEID 749

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI 164
           GN+     DY  A + Y+  I   PT  + Y+N+A +   QE +D+AI+   + +
Sbjct: 10  GNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD++ A+  +  AI+L P  A  Y  +   YS+ + +D A      A+ +E  
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
                  LG      GK +EAL  ++KA
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEKA 586

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%), Gaps = 8/63 (12%)

Query: 138 VYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKA 197
           ++YAN        +++D  I   ++A+KV PN    ++RLG +     +S+EA++AY +A
Sbjct: 433 LFYAN--------DEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRA 484

Query: 198 LEV 200
           L++
Sbjct: 485 LQL 487

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 48/92 (52%), Gaps = 3/92 (3%)

Query: 115 AAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGY 174
           A  +++  ++ + AA+K+ P   + +    A+ ++  + +EAI+    A++++P++ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 175 SRLGFAKFAQGKSQEALEAYKKAL---EVDGD 203
             L  +    G  +EA E    AL   +V+G+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGE 527

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%)

Query: 140 YANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALE 199
           Y     AY   ++   +I+  +SAI+V+PN  + +  LG A  A G+ + +++ ++KA+E
Sbjct: 672 YRVLGIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAME 731

Query: 200 VDG 202
           +DG
Sbjct: 732 LDG 734

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 41/98 (41%), Gaps = 4/98 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKA----VYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN     K +  A   YN  I++    A    +   NRAA     + Y   I D   A+K
Sbjct: 84  GNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALK 143

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGD 203
           + P   K + R+G A     K +EA EA    L VD +
Sbjct: 144 LNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTE 181

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  + ++P K   +       S Q+ +D AIK  E A +++PN++  Y+  G    +   
Sbjct: 541 NGLMDIMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDS 600

Query: 187 SQEALEAYKKALEVDG 202
           S  A   Y+KAL  D 
Sbjct: 601 SDSAKTCYRKALACDS 616

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 5/117 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAI----KLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN     K +  A E Y+  I    ++       YANRAA     + Y   I D + A++
Sbjct: 88  GNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQ 147

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDG-DKATDIMKRDYETAKKKVE 221
           + P   K Y R+  A  A  +  EALE+ +   ++D  +K+   +K   ET + ++E
Sbjct: 148 LNPKNIKCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEIE 204

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  ++  P K   + +    YS Q  +DEAI+  E A +V+P+++ GY+  G    +   
Sbjct: 499 NELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDS 558

Query: 187 SQEALEAYKKALEVD 201
              A   Y+KA+  D
Sbjct: 559 IDMAKTCYRKAIASD 573

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 136 KAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG--FAKFAQGKSQEALEA 193
           K + Y N A A  SQE    A K    +IK    ++ GYS LG  +AK+ +  ++ A + 
Sbjct: 568 KGLIYKNEAEASQSQELIKIAFKQLIQSIKTSETFAPGYSSLGDIYAKYYKDATR-AFKC 626

Query: 194 YKKALEVDGDKATDIMKRDYETAK 217
           Y KA E+D   A D++   Y T K
Sbjct: 627 YFKAFELD---AGDLVAARYMTEK 647

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 55/128 (42%), Gaps = 15/128 (11%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKA----VYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN     K +  A E Y   I++    A      YANRAA     + +   I D ++A+ 
Sbjct: 85  GNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALT 144

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKAT-----DIMK------RDYE 214
             P   K Y R+G A  A  K + A E+ +   ++D D  +     +I+K      R YE
Sbjct: 145 YNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKEEEIRKYE 204

Query: 215 TAKKKVEQ 222
             K K +Q
Sbjct: 205 EKKLKAQQ 212

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 35/54 (64%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + S + +D+ ++  ++A+K+ PN    ++RLG +     +S+EA++AY KA+ +
Sbjct: 451 HYSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINL 504

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D++  +E +  A+K+ P   + +    A+ ++  + +EAIK    AI ++P++ +    L
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNL 515

Query: 178 GFAKFAQGKSQEA---LEAYKKALEVDGDKATDI 208
             A    G  QEA   L    K  +V G   T +
Sbjct: 516 AVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSV 549

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + S  ++D+ I   ++A+KV PN    ++RLG +     +S+EA++AY KAL +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNL 513

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           +++  ++ + AA+K+ P   + +    A+ ++  + +EAI+    A+ ++P++ +    L
Sbjct: 465 EFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRARYNL 524

Query: 178 GFAKFAQGKSQEALEAYKKAL---EVDGDKAT 206
             +    G  +EA +    AL   EV+G K +
Sbjct: 525 AVSSINIGCYKEAAQYLLTALSMHEVEGLKGS 556

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  +  +P K   +       S Q+ +D AIK  E A +++PN++  Y+  G    +   
Sbjct: 530 NGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDS 589

Query: 187 SQEALEAYKKALEVD 201
           S  A   Y+KAL  D
Sbjct: 590 SDSAKTCYRKALACD 604

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     +D++ A++    A  L P  A  Y  +   YS+ + +D A      A+ + PN
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
               +  LG +    G+  EAL  ++KA  ++
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 536

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  +  +P K   +       S Q+ +D AIK  E A +++PN++  Y+  G    +   
Sbjct: 535 NGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDS 594

Query: 187 SQEALEAYKKALEVD 201
           S  A   Y+KAL  D
Sbjct: 595 SDSAKTCYRKALACD 609

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 40/96 (41%), Gaps = 4/96 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLV----PTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN     K +  A E YN AI +           YANRAA     + Y   I D + A+ 
Sbjct: 81  GNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALS 140

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           + P   K Y R+  A  A  K  +  EA +  L+ D
Sbjct: 141 LNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFD 176

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 38/63 (60%), Gaps = 8/63 (12%)

Query: 138 VYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKA 197
           ++YAN        E YD+ I   ++A+ V+P+    ++RLG +     +S+EA++AY +A
Sbjct: 431 LFYAN--------EDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRA 482

Query: 198 LEV 200
           L++
Sbjct: 483 LQL 485

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 115 AAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGY 174
           A +DY+  ++ + AA+ + P   + +    A+ ++  + +EAI+    A++++P++ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 175 SRLGFAKFAQGKSQEALEAYKKAL---EVDG 202
             L  +    G  +EA E    AL   EV+G
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEG 524

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  +  +P K   +       S Q+ +D AIK  E A +++PN++  Y+  G    +   
Sbjct: 523 NGLMDTMPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDS 582

Query: 187 SQEALEAYKKALEVD 201
           S  A   Y+KAL  D
Sbjct: 583 SDSAKTCYRKALACD 597

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K Y+ A++ YN A++L     V+Y+N +A Y S     + ++ +  A++++P+
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 170 WSKGYSRLGFAKFAQGKSQEAL 191
           +SK   R   A    GK  +A+
Sbjct: 165 YSKVLLRRASANEGLGKFADAM 186

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 143 RAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           R   Y +++ +D+ I+  + ++K+ PN    ++RLG +     K ++A++AY +AL +
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     +D++ A++    A  L P  A  Y  +   YS+ + +D A      A+ + PN
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
               +  LG +    G+  EAL  ++KA  ++
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSIN 555

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 43/99 (43%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD++ A+  ++ A KL P     Y  +   Y S + YD A      AI  + +
Sbjct: 597 GNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLH 656

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDI 208
               Y  +G      G+ ++AL  ++KA  ++   A  I
Sbjct: 657 HYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILI 695

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 122 AVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAK 181
           A+  Y  A ++ PT ++    RA    S  KY +A+   E  IK+ P  +     LG   
Sbjct: 711 ALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLY 770

Query: 182 FAQGKSQEALEAYKKALEVD---GDKATDIMKRDYE 214
              G+ ++A++ Y  A+ +D    +  +D +K+ +E
Sbjct: 771 QIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 4/96 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLV----PTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN     K +  A + YN  I++           +ANRAA     + Y   I D + A+ 
Sbjct: 87  GNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALT 146

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           + P   K Y R+G A +     +EA E+     +VD
Sbjct: 147 LNPKNIKCYYRMGKAFYLLNNIEEAKESVGFGQKVD 182

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 34/54 (62%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + S + YD+ +    +A+ V P+    ++RLG +     +S+EA++AY+KAL++
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 489

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           DY+  V+ + AA+ + P   + +    A+ ++  + +EAI+    A++++P + +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 178 GFAKFAQGKSQEALEAYKKAL---EVDG 202
             +    G  +EA E    AL   EV+G
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMHEVEG 528

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 11/104 (10%)

Query: 134 PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG--FAKFAQGKSQEAL 191
           P   +   NRAA++       +A+ DA+  IKV+    KGY R G    K AQ K  EAL
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDK--EAL 124

Query: 192 EAYKKAL-------EVDGDKATDIMKRDYETAKKKVEQSLNVEK 228
             Y++ L       ++  +K         E  K +V + LN++K
Sbjct: 125 YVYREGLSKAKEAYQLHFEKPPSKFVEIVEHQKNEVIKRLNLQK 168

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 38/64 (59%), Gaps = 8/64 (12%)

Query: 137 AVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKK 196
            ++YAN        +++D+ I   ++A+ V PN    ++RLG +     +S+EA++AY +
Sbjct: 429 VLFYAN--------DEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHR 480

Query: 197 ALEV 200
           A+++
Sbjct: 481 AIQL 484

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD++ A++ +N A +L P  A  Y  +   Y+S E +D A      A+  +  
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKA 197
               Y  LG      G    +L  ++KA
Sbjct: 561 HYNAYYGLGTCDSQNGNHDRSLLFFEKA 588

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 33/76 (43%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  I   P  A  +      +S Q+ +DEAIK    A +++P ++  Y+  G    +   
Sbjct: 484 NELIDNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNES 543

Query: 187 SQEALEAYKKALEVDG 202
              A   Y+KAL  D 
Sbjct: 544 FDTARTFYRKALACDS 559

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 35/54 (64%)

Query: 147 YSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           + S + YD+ +    +A+ V+P+    ++RLG +     +S+EA++AY+KAL++
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 3/88 (3%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           DY+  V+ + AA+ + P   + +    A+ ++  + +EAI+    A++++P + +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 178 GFAKFAQGKSQEALEAYKKAL---EVDG 202
             +    G  +EA E    AL   EV+G
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMHEVEG 521

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K Y+ A++ YN A++L     V+Y+N +A Y S     + ++ +  A++++P+
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 165 YSKVLLR 171

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL-VPTKAV---YYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN+   AK +  A E Y   I +    K++    +ANRAA     + Y   I+D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALT 149

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEA 190
           + P   K Y R   A F+  K +EA
Sbjct: 150 INPKNIKCYYRTSKAFFSLSKLEEA 174

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+      Y +A E Y   + + P   + Y+N+A A     +Y E ++     +   PN
Sbjct: 10  GNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPN 69

Query: 170 WSKG-YSRLGF 179
            +   Y +L +
Sbjct: 70  TTDTVYKKLNY 80

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N  ++ +P K   +      YS Q  +++AIK  E A K++ N++  Y+  G    +   
Sbjct: 472 NELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDS 531

Query: 187 SQEALEAYKKALEVD 201
              A   Y++AL  D
Sbjct: 532 IDTAKNCYRRALACD 546

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 137 AVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKK 196
            ++YAN        E++ + I    +A++V PN    ++RLG +     +S+EA++AY K
Sbjct: 424 TLFYAN--------EEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHK 475

Query: 197 AL 198
           AL
Sbjct: 476 AL 477

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL-VPTKAV---YYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN+   AK +  A E Y+  + +    K++    YANRAA     + Y   I+D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALT 149

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEA 190
           + P   K Y R   A F   K +EA
Sbjct: 150 INPKNVKCYYRTSKAFFQLNKLEEA 174

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 139 YYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           ++      Y  +  Y  AIK  E  I++ P    GYS    A     K+QEA+   +  L
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

Query: 199 E-VDGDKATDIMKRDYETAKKKVEQSLNV 226
           + V  + AT      +ET +KK+E  L +
Sbjct: 65  KRVSKNDAT------HETIQKKLEYRLEL 87

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN+     +Y  A++ Y   I++ P   + Y+N+A A     K  EA++  +  +K
Sbjct: 10  GNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K Y+ A++ YN A++L     V+Y+N +A Y S     + ++ +  A++++P+
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 165 YSKVLLR 171

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    + Y  A++ YN A+ L     V+Y+N +A Y S    ++ ++ +  A++++P+
Sbjct: 106 GNQFFKEQKYEDALKYYNYALDL-KQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 165 YSKALLR 171

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 38/63 (60%), Gaps = 8/63 (12%)

Query: 138 VYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKA 197
           ++YAN        + +++ I   ++A++V PN    ++RLG A     +S+E+++AY +A
Sbjct: 455 LFYAN--------DDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRA 506

Query: 198 LEV 200
           L++
Sbjct: 507 LQL 509

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K Y+ A++ YN A++L     V+Y+N +A Y S     + ++ +  A++++P+
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 165 YSKVLLR 171

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 3/98 (3%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK--VE 167
           G  A+      +A E +     L PT A+ ++N +AAY  Q K  EA    + AI    +
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 168 PNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKA 205
            NW + +           + ++ L A K+ +E+  DK+
Sbjct: 700 KNW-RIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKS 736

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 68/165 (41%), Gaps = 22/165 (13%)

Query: 142 NRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQ--EALEAYKKALE 199
           NRAA +       +A+KDA  A + EP   K Y R G  K  Q      +ALE Y+    
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRG--KILQKLRMDGQALENYE---- 129

Query: 200 VDGDKATDIMKRDYET-AKKKVEQSLNVEKXXXXXXXXXXXXXXXXXXXXXXMLGGGLGS 258
            +G KA   M R Y     KK+ ++L  +K                       L      
Sbjct: 130 -EGVKAIRDMTRKYHLDPPKKLYEALEYQKNLVSRRLKGPKTSVASKSERKRTLL----- 183

Query: 259 FLNNPQIMQAAQQMMS-NPRAMEQMESMMQNP--SIRQMAENLSS 300
               PQ+MQ  ++ M+ + RA+  ++ + Q P   ++++  NL S
Sbjct: 184 ----PQVMQPTEKKMAVDTRAIPILDILGQCPLEILKKILCNLDS 224

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 135 TKAVYYANRAAAYSSQEKYDEA--IKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALE 192
           +K V +A R       E  +EA  I+  +SA++++P   + +  LG A +A G+ + +++
Sbjct: 662 SKEVNWAYRVVGIFYLETQEEASSIEWFQSALRIDPKDVESWVGLGQAYYACGRIEASMK 721

Query: 193 AYKKALEVDGDK 204
            +++ALE+D + 
Sbjct: 722 VFERALELDSEH 733

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 41/92 (44%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD+  +++ +  + +L P+    Y  +   YSS + +D A+     A+   P 
Sbjct: 416 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQ 475

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
               +  LG      G+ +E L  ++KA  ++
Sbjct: 476 HYNAHYGLGMCCLKLGQYEECLLHFEKARSIN 507

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 122 AVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAK 181
           A++ Y+ A +L P  ++    RA    +  KY+ A+++ E  + + P+ +  +  LG   
Sbjct: 530 ALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEATIHFLLGQLY 589

Query: 182 FAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKK 218
              G+ Q+A++    A+ +D  K + ++K   E   +
Sbjct: 590 QIVGRKQDAVKELTIAMNLD-PKGSQLIKSALEKCHQ 625

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 11/130 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLV----PTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN+    K Y  A E Y   I +           YANRAA     + + + I+D + A+ 
Sbjct: 81  GNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALS 140

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKAT------DIMKRDYETAKKK 219
                 K Y R+G A  +  +  E+ E+ +  L++D +  +       I KR  E  ++K
Sbjct: 141 FNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRK 200

Query: 220 -VEQSLNVEK 228
            +E  + +EK
Sbjct: 201 DMEMKIKLEK 210

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 153 YDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           YD+ I   ++A+ V PN    ++RLG +     +S+EA+ AY +AL +
Sbjct: 509 YDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTL 556

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           DY+  ++ +  A+ + P   + +    A+ ++  + +EA+     A+ ++P++ +    L
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNL 567

Query: 178 GFAKFAQGKSQEALEAYKKAL---EVDGDKATDI 208
             +    G  +EA E    AL   E++G   TD+
Sbjct: 568 AVSSINIGCFKEAAEHLLTALSMHEINGILDTDL 601

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     +D+  A++ YN A+ L     V+Y+N +A Y S  + ++ ++ +  A+K++ +
Sbjct: 112 GNDYFKKQDFENALKYYNYALTL-KQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHD 170

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 171 YSKALLR 177

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%)

Query: 155 EAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDK 204
           +AI+  +SA+++EPN  + +  LG +  + G+ + ++  ++KA E+D D 
Sbjct: 686 DAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDH 735

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 59/130 (45%), Gaps = 11/130 (8%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G++ +  K+ + A+E Y  A+ + P     +     AY   + +  ++   + A  ++P 
Sbjct: 494 GHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 553

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATD--IMKR---------DYETAKK 218
             + +  LG   F    +  AL+ YK+AL++      D  I+ +         D E  KK
Sbjct: 554 DKRMWQALGECYFIVDNTDSALKCYKRALQLSDLALQDSIILYKLAILYEKMDDIENCKK 613

Query: 219 KVEQSLNVEK 228
            + Q+L+VE+
Sbjct: 614 MMIQTLDVEE 623

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 35/51 (68%)

Query: 155 EAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKA 205
           E+I+  +SA++V+P+  + +  LG A +A G+ + +++ ++KALEV+   A
Sbjct: 698 ESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSA 748

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 9/92 (9%)

Query: 140 YANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALE 199
           Y N AA     + Y   I     A+K+     K + R+G A    G+ +++LEA +  L 
Sbjct: 111 YLNLAACELEIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLA 170

Query: 200 VDGD---------KATDIMKRDYETAKKKVEQ 222
           VD +         KAT+ +KR  E   + + Q
Sbjct: 171 VDPENGALKSIQSKATEKLKRKKELENRTLAQ 202

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query: 114 MAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKG 173
           +  K+Y   +     A+   P     Y   A A+S+ EKYDE+ +  E  +KV+   S+ 
Sbjct: 123 LEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVD---SRN 179

Query: 174 YSRLGFAKFAQGKSQEALEAYKKALE 199
            S L   K    K QE   AY+  LE
Sbjct: 180 SSLLNLLK-TIIKKQEEKTAYRLKLE 204

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 32/49 (65%)

Query: 152 KYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           ++D+ I   ++A+ V PN    ++RLG +     +S+EA++AY KAL++
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 148 SSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           S Q+ +++AIK  E A +V+PN++  Y+  G    +      A   Y+KAL  D
Sbjct: 546 SLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACD 599

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 8/63 (12%)

Query: 138 VYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKA 197
           ++YAN        E +D+ I    +A+ V P+    ++RLG +     +S+EA++AY +A
Sbjct: 426 LFYAN--------EDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRA 477

Query: 198 LEV 200
           +++
Sbjct: 478 IQL 480

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 31/142 (21%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPT------------------KAVYYANRAAAYSSQE 151
           G+     KDY  +  KY  A+K V T                  K   Y N   A  + +
Sbjct: 241 GSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLALFNLK 300

Query: 152 KYDEAIKDAESAIKVEP----NWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGD---- 203
            YDE++K     ++++     + +K Y R+G + FA+ +  EAL+ Y+   + + D    
Sbjct: 301 DYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYRLCRDHNPDDNVI 360

Query: 204 -----KATDIMKRDYETAKKKV 220
                K  +I++++ E  KK +
Sbjct: 361 GQKIEKTENILEKEKERTKKNI 382

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 10/83 (12%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN      DY  A+  Y  A  L  +  +Y++N A A    E++ EA+   +        
Sbjct: 48  GNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACD-------- 99

Query: 170 WSKGYSRLGFAKFAQGKSQEALE 192
             KG +++ F      K+++ LE
Sbjct: 100 --KGLNKVSFKTGMDSKTKQKLE 120

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 40/92 (43%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD+  +++ +  + +L P+    Y  +   YSS + +D A+     A+     
Sbjct: 417 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQ 476

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
               Y  LG      G+ +E L  ++KA  ++
Sbjct: 477 HYNAYYGLGMCSLKLGQYEECLLHFEKARSIN 508

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 122 AVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAK 181
           A++ Y+ A +L P  ++    RA    +  KY+ A++  E  +K+ P+ +  +  LG   
Sbjct: 531 ALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEATIHFLLGQLY 590

Query: 182 FAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKK 218
              G+ Q+A++    A+ +D  K + ++K   E   +
Sbjct: 591 QIVGRKQDAVKELTIAMNLD-PKGSQLIKSALEKCHQ 626

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 32/48 (66%)

Query: 155 EAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDG 202
           ++I+  +SAI+V+PN  + +  LG A    G+ + +++ ++KA+E+D 
Sbjct: 683 DSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDS 730

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%)

Query: 127 NAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGK 186
           N A KL    A         + S  ++D+ I   ++A+ + P     ++RLG +     +
Sbjct: 421 NIANKLPNADADVQLGLGLLFYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSR 480

Query: 187 SQEALEAYKKALEV 200
            +EA++AY KAL++
Sbjct: 481 PEEAIQAYHKALQL 494

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN      DY  A   Y+  IKL PT  + Y+N+A +   Q  +  A++  +  +K
Sbjct: 10  GNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 126 YNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQG 185
           Y+A ++  P+ A    + A  Y S++ +  A +  E A+ V P  S  ++ LG       
Sbjct: 71  YDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLD 130

Query: 186 KSQEALEAYKKAL 198
             Q A  AY++AL
Sbjct: 131 DLQRAYNAYQQAL 143

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 140 YANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALE 199
           Y N +A Y   +  D+A   ++  I V+P   KGY  +G     Q K + A +AYK  L+
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYKNGLK 134

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKV 166
           GN      DY  AV  Y  AI   P+  + Y+N A      EK+ EA+      +K+
Sbjct: 11  GNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN+    K    A++ Y  A++      V+YAN +A Y S   +++ +++   A++++P+
Sbjct: 113 GNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171

Query: 170 WSKGYSR 176
           +SK   R
Sbjct: 172 YSKVLLR 178

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 20/101 (19%)

Query: 118 DYNLAVEKYNAAIKLVPTKA----VYYANRAAAYSSQEKYDEAIKDAESAIKVEPN---- 169
           DY  AVE+Y  ++  +P K     + Y+N  A+     ++ +++ DA+ A+K+ P     
Sbjct: 377 DYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSL 436

Query: 170 WS---------KGYSRLGFAK--FAQGKSQEALEAYKKALE 199
           W+         + Y+ + + K    Q +S EA+E YK AL+
Sbjct: 437 WTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIEKYKLALD 476

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 142 NRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           NRAA +    + ++A++DA     +EP   K + R G       K ++A   YK AL  +
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 202 GDKATDIMK 210
            + ATD +K
Sbjct: 158 ANFATDSLK 166

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 126 YNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQG 185
           Y+A ++  P+ A    + A  Y S++ +  A +  E A+ V P  S  ++ LG       
Sbjct: 73  YDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLD 132

Query: 186 KSQEALEAYKKAL 198
             Q A  AY++AL
Sbjct: 133 DLQRAYNAYQQAL 145

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 126 YNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQG 185
           Y+A ++  P+ A    + A  Y S++ +  A +  E A+ V P  S  ++ LG       
Sbjct: 63  YDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLD 122

Query: 186 KSQEALEAYKKAL 198
             Q A  AY++AL
Sbjct: 123 DLQRAYNAYQQAL 135

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKL-VPTKAV---YYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN+   AK +  A E Y   + +    K++    +ANRAA     + Y + ++D   A+ 
Sbjct: 90  GNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALT 149

Query: 166 VEPNWSKGYSRLGFAKFAQGKSQEA 190
           + P   K Y R+  + F   K +EA
Sbjct: 150 INPKNIKCYYRISKSFFQLRKLEEA 174

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 126 YNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQG 185
           Y+A ++  P+ A    + A  Y S++ +  A +  E A+ V P  S  ++ LG       
Sbjct: 69  YDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLD 128

Query: 186 KSQEALEAYKKAL 198
             Q A  AY++AL
Sbjct: 129 DLQRAYNAYQQAL 141

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 32/46 (69%)

Query: 155 EAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           E+I+  +SA++VEP   + +  LG A ++ G+ + +++ ++KALEV
Sbjct: 699 ESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEV 744

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D + A   Y+A ++  P+      + A  Y S++ +  A +  E A++V P  S  ++ L
Sbjct: 80  DADRAALAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYERALQVNPELSDVWATL 139

Query: 178 GFAKFAQGKSQEALEAYKKAL 198
           G         Q A  AY++AL
Sbjct: 140 GHCYLMLDDLQRAYNAYQQAL 160

>KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 134 PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAK--FAQGKSQEAL 191
           P   V +   A  Y    K  EA K    +  ++P++  GYS LGFA    A+G+ ++AL
Sbjct: 429 PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSF--GYSWLGFAHTYVAEGEHEQAL 486

Query: 192 EAYKKA 197
            AY  A
Sbjct: 487 SAYSTA 492

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 39/92 (42%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD++ A++ +  A +L P     Y  +   YSS + +D A      A+     
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
                  LG      G+ +E+L  ++KA  ++
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSIN 512

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 39/81 (48%)

Query: 118 DYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRL 177
           D    +  Y++ +   P       + A  Y S + +D+A+   E A+ ++   ++ +S L
Sbjct: 50  DTTTLIRAYHSVLAHDPLSVTALVSLANFYRSTDAFDKAVHYYEKAVALDSTLAEVWSLL 109

Query: 178 GFAKFAQGKSQEALEAYKKAL 198
           G +     + Q+A  AY++AL
Sbjct: 110 GHSYLMLDELQKAYNAYQQAL 130

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 140 YANRAAAYSSQEKYDEA--IKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKA 197
           +  R    +  EK +E+  I+  +SA++V+PN  + +  LG A  A G+ + +++ + KA
Sbjct: 696 WPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKA 755

Query: 198 LEV 200
           +E+
Sbjct: 756 IEL 758

>TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3.5
           YOL145C
          Length = 1077

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 152 KYDEAIKDAESAIKVEPNWSK---GYSRLGFAKFAQGKSQEALEAYKKALE 199
           +Y +AI+  E  +K  PN+SK    Y+ LG   + +G  + +L  YKKAL+
Sbjct: 751 EYVKAIEGYELILKKFPNYSKLAKVYNLLGKTWYERGNKENSLSCYKKALQ 801

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%)

Query: 151 EKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
           +++D+ I   ++A+ V  N    ++RLG +     +S+EA++AY +AL++
Sbjct: 440 DQFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQL 489

>KLLA0E07239g Chr5 complement(655635..658325) [2691 bp, 896 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313C Protein required for cell viability
          Length = 896

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK--VE 167
           G   +     NLA E ++  + L  T ++ ++N +AAY   +K  EA    + AI     
Sbjct: 635 GCIGLECGKMNLAAEAFSRCVALDETHSLSWSNLSAAYVQLDKLKEAHSCLKRAISSDAR 694

Query: 168 PNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDK 204
            NW + +          G+ ++ L A++  +++  DK
Sbjct: 695 KNW-RIWDNYMIVSMKLGEWEDVLLAFRNLVDLRKDK 730

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 140 YANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEA 190
           +AN+AA     + Y   I+D   A+ + P  +K Y R   A F   K +EA
Sbjct: 124 FANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 129 AIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVE--PNW--SKGYSRLGFAKFAQ 184
           ++K    K   Y N +    + +KYD AI  A   +++E  P    +K Y R G    A+
Sbjct: 323 SVKFAELKMKLYLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAK 382

Query: 185 GKSQEALEAYKKALEVDGD 203
            + +EAL+ YK   E + D
Sbjct: 383 NRLEEALKDYKNCKENNPD 401

>TDEL0B05300 Chr2 (932958..934151) [1194 bp, 397 aa] {ON} Anc_1.456
           YJR032W
          Length = 397

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 9/104 (8%)

Query: 130 IKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVE----PNWSKGYSRLGFAKFAQG 185
           +K V  K   Y N + A  + + YD AI+ A   +++E     + +K Y R G +  A+ 
Sbjct: 286 LKFVTLKMKLYLNLSLALFNMQNYDGAIEYATYLLEMENVPDVDQAKAYYRRGNSYLAKK 345

Query: 186 KSQEALEAYKKALEVDGDKATDIMKRDY-----ETAKKKVEQSL 224
             ++AL+ Y+     + D A+   + DY     E  K+K ++SL
Sbjct: 346 NMEKALQNYELCKHKNPDDASVAQRIDYVNDILEKRKEKRKRSL 389

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G++ +  K+ + A+E Y  A+ + P     +     AY   E +  ++   + A  ++P 
Sbjct: 461 GHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQKACSLQPL 520

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATD 207
             + +  LG      G   +AL+ +++AL+  G+   D
Sbjct: 521 DRRMWQALGTCYIKIGYKSDALKCFERALQHSGNIEQD 558

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIK 165
           GN      +Y  AVE Y   I++ P   + Y+N A +     KY EA++   + +K
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLK 65

>NCAS0G00350 Chr7 complement(60735..62831) [2097 bp, 698 aa] {ON}
           Anc_5.689 YOR080W
          Length = 698

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%)

Query: 142 NRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALE 199
           NRAA +    + + A++D++    +EP   K Y R G      GK ++A + YK+AL+
Sbjct: 78  NRAACWEKLGELERALRDSQKMCYIEPYNLKCYLRRGRLLQRLGKDKDAYKNYKEALQ 135

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 148 SSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVD 201
           S Q+ + EAIK  E A +V+P ++  Y+  G    +      A   Y+KA+  D
Sbjct: 539 SLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACD 592

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           GN     KD+  A++ +  A  L    A  Y  +   +++ E YD A      AI  +P 
Sbjct: 528 GNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACDPQ 587

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDI 208
               Y  LG      GK  +AL  ++KA  ++   A  I
Sbjct: 588 HYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILI 626

>TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON}
           Anc_2.665 YKL022C
          Length = 752

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 142 NRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKAL 198
           N A AY    + + AIK  +S +KV    S  Y  LGF      + Q+A++ +  AL
Sbjct: 612 NLAHAYRRLGENERAIKCFKSVLKVSNKSSDTYCSLGFLYLKTKQLQKAIDHFHTAL 668

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 43/91 (47%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPN 169
           G++ +  K+ N A+E Y  A+ + P     +     AY   + +  ++   + A  ++P 
Sbjct: 451 GHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQRACILKPL 510

Query: 170 WSKGYSRLGFAKFAQGKSQEALEAYKKALEV 200
             + +  LG      G   EA++ Y++AL++
Sbjct: 511 DKRMWQALGSCYAKVGNHAEAIKCYERALQL 541

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 140 YANRAAAYSSQEKYDEA--IKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKA 197
           +  R    +  EK +E+  I+  +SA++V+PN  + +  LG A  A G+ + +++ + KA
Sbjct: 703 WPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKA 762

Query: 198 LEV 200
           +++
Sbjct: 763 IQL 765

>ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL313C
          Length = 905

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 50/112 (44%), Gaps = 1/112 (0%)

Query: 115 AAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGY 174
            ++D+NL+++  N +++L P     +           K D A +     + ++   +  +
Sbjct: 616 VSRDFNLSLKHLNDSLRLYPLSFDTWYFYGCIGLECGKVDLAAEAFSRCVALDDTHALSW 675

Query: 175 SRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNV 226
           S L  A   QGK +EA    K+A+  D  +   I + +Y T   K+ +  +V
Sbjct: 676 SNLSAAYTEQGKIKEAHSCLKRAIASDSQRNWRIWE-NYMTVSVKLHEWEDV 726

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 110 GNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEP- 168
           G  A+      +A E ++  + L PT A+ ++N +AAY    K  EA    + +I  +  
Sbjct: 651 GCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKRSIACDSQ 710

Query: 169 -NW 170
            NW
Sbjct: 711 RNW 713

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.123    0.324 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,543,177
Number of extensions: 906513
Number of successful extensions: 4221
Number of sequences better than 10.0: 240
Number of HSP's gapped: 4054
Number of HSP's successfully gapped: 332
Length of query: 350
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 240
Effective length of database: 40,868,139
Effective search space: 9808353360
Effective search space used: 9808353360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)