Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010406.18ON97297248800.0
Kpol_1032.76.18ON96595723550.0
ZYRO0C07854g6.18ON94495823460.0
NDAI0I022606.18ON96797523310.0
NCAS0D026506.18ON95098523070.0
Suva_15.1806.18ON94895823020.0
KAFR0A050506.18ON94895222840.0
TPHA0M002606.18ON96696722840.0
CAGL0E02695g6.18ON94694622620.0
TDEL0G045106.18ON96996422620.0
Skud_15.1666.18ON94795122480.0
YOR005C (DNL4)6.18ON94495122340.0
Smik_15.1746.18ON94596722310.0
KNAG0F028706.18ON95496022250.0
KLTH0C11286g6.18ON95196820800.0
Kwal_56.224146.18ON96396220710.0
KLLA0D01089g6.18ON90796818870.0
ACR008W6.18ON98195718780.0
NDAI0A019407.343ON7652502836e-25
TPHA0D045707.343ON7364212747e-24
ACL155W7.343ON6972412702e-23
CAGL0I03410g7.343ON7242572683e-23
SAKL0F10912g7.343ON6932702674e-23
TBLA0E020507.343ON7202692612e-22
Skud_4.937.343ON7552672604e-22
Smik_4.747.343ON8452692578e-22
Kpol_2001.717.343ON7262492578e-22
TDEL0C020407.343ON7052442551e-21
YDL164C (CDC9)7.343ON7552692551e-21
Suva_4.827.343ON7552672542e-21
NCAS0A141107.343ON7532672505e-21
KLLA0D12496g7.343ON7002612496e-21
KAFR0B008307.343ON7102662471e-20
KLTH0H01408g7.343ON7232412452e-20
KNAG0C037407.343ON7272472344e-19
ZYRO0F11572g7.343ON7312632344e-19
Kwal_56.246167.343ON7152622263e-18
TPHA0J004706.38ON48990762.0
Kpol_367.97.46ON88068752.9
NDAI0A05500singletonON24893733.2
Skud_5.1473.537ON46566718.7
KAFR0J010805.242ON32690708.8
KAFR0C051907.46ON89698719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01040
         (972 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...  1884   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   911   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   908   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   902   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   893   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   891   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   884   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   884   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   875   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   875   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   870   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   865   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   863   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   861   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   805   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   802   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   731   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   728   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   113   6e-25
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   110   7e-24
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   108   2e-23
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   107   3e-23
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   107   4e-23
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   105   2e-22
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   104   4e-22
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   103   8e-22
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   103   8e-22
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   102   1e-21
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   102   1e-21
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   102   2e-21
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   100   5e-21
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   100   6e-21
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   100   1e-20
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    99   2e-20
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    95   4e-19
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    95   4e-19
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...    92   3e-18
TPHA0J00470 Chr10 (106019..107488) [1470 bp, 489 aa] {ON} Anc_6....    34   2.0  
Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON} ...    33   2.9  
NDAI0A05500 Chr1 complement(1242145..1242891) [747 bp, 248 aa] {...    33   3.2  
Skud_5.147 Chr5 complement(224655..226052) [1398 bp, 465 aa] {ON...    32   8.7  
KAFR0J01080 Chr10 (198475..199455) [981 bp, 326 aa] {ON} Anc_5.2...    32   8.8  
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    32   9.7  

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 1884 bits (4880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/972 (95%), Positives = 928/972 (95%)

Query: 1   MNSSNEVIIPVSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISN 60
           MNSSNEVIIPVSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISN
Sbjct: 1   MNSSNEVIIPVSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISN 60

Query: 61  KPISTRYFDTITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLP 120
           KPISTRYFDTITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLP
Sbjct: 61  KPISTRYFDTITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLP 120

Query: 121 KNSVVERRLIRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVN 180
           KNSVVERRLIRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVN
Sbjct: 121 KNSVVERRLIRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVN 180

Query: 181 RQNWNNKKRSNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKE 240
           RQNWNNKKRSNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKE
Sbjct: 181 RQNWNNKKRSNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKE 240

Query: 241 YLSVVSDLRTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFI 300
           YLSVVSDLRTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFI
Sbjct: 241 YLSVVSDLRTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFI 300

Query: 301 EEKMDGERIQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDG 360
           EEKMDGERIQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDG
Sbjct: 301 EEKMDGERIQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDG 360

Query: 361 EMVTFDSTSKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFK 420
           EMVTFDSTSKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFK
Sbjct: 361 EMVTFDSTSKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFK 420

Query: 421 RKEFLNTVLTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARH 480
           RKEFLNTVLTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARH
Sbjct: 421 RKEFLNTVLTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARH 480

Query: 481 NNWIKVKPEYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXX 540
           NNWIKVKPEYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKR        
Sbjct: 481 NNWIKVKPEYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIIS 540

Query: 541 XXXXXXXXTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFG 600
                   TKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFG
Sbjct: 541 DSGDDDLDTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFG 600

Query: 601 TKKPVEWIYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLH 660
           TKKPVEWIYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLH
Sbjct: 601 TKKPVEWIYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLH 660

Query: 661 DLTYNEIKRHEKKNKNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIIS 720
           DLTYNEIKRHEKKNKNKQTL             PAGMLPNGTDLRLISDLFHGLYFYIIS
Sbjct: 661 DLTYNEIKRHEKKNKNKQTLIRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIIS 720

Query: 721 DYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGY 780
           DYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGY
Sbjct: 721 DYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGY 780

Query: 781 DVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXX 840
           DVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEAT          
Sbjct: 781 DVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLL 840

Query: 841 XXXXXKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGG 900
                KVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGG
Sbjct: 841 DSNINKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGG 900

Query: 901 SLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKA 960
           SLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKA
Sbjct: 901 SLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKA 960

Query: 961 GYQLSPEDYPIL 972
           GYQLSPEDYPIL
Sbjct: 961 GYQLSPEDYPIL 972

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/957 (48%), Positives = 640/957 (66%), Gaps = 29/957 (3%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P NF+PSPDFKWLCDELFVK+D+I  Q + K  N   +KP    Y+D I +FI +WR T+
Sbjct: 31  PHNFSPSPDFKWLCDELFVKLDQI--QFRPKELN--GSKPKYIEYYDIINNFIDIWRRTV 86

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G+DI+PAL L +PYRDRR+YNIK+  LIR +C YLKLPKNS  ERRL+RWK++ADR   L
Sbjct: 87  GNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRL 146

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202
           +TFC+ EI KRK EP+  +  +I+IDKLNE LD+LV+ R  +   K   + + ETFKFC 
Sbjct: 147 STFCVEEIKKRKGEPR--EKIKITIDKLNECLDNLVLER-GYKGSKSQKISESETFKFCF 203

Query: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262
           ENMT++ELKYFFDI++K+KI+G LE+ FL  WHPD+++YLSVVSDL+ +S+KLWNP  ++
Sbjct: 204 ENMTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRL 263

Query: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322
              DL+I + + F P+ AKRL  SYDTI+ RL NDFFIEEKMDGERIQLHYMNYG  +KF
Sbjct: 264 KYDDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKF 323

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
            SR G DY+YLYG++++ G I ++L  HK+VKEC+LDGEMVT+DS    +LPFGLVKSSA
Sbjct: 324 LSRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSA 383

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
              L+  DI+ D +HPL+M FD++YLNGSSL  LPL +RK +L+ +L P  D+VEIL ++
Sbjct: 384 MQSLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPAL 443

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
            C DS  IK  L+ AI +GSEGI+LK++ S+Y+   R ++WIK+KPEYLE+FGENMDLIV
Sbjct: 444 HCNDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIV 503

Query: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISFC 562
           IGRD GKKD L+CG+++T       +N                    KP +  +K+ISFC
Sbjct: 504 IGRDPGKKDSLMCGLILT------GDNEPEEITSLDSNPTDTAESFLKPDK--RKIISFC 555

Query: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622
            IANG+SQ E ++I+R T G W  +++E PP D+ EFGTK P+EWIYP+ SVVLEIKARS
Sbjct: 556 NIANGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARS 615

Query: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKN--KNKQTL 680
           L+  +  + KY TG TL+GGYCRQIR DKDW SC+T ++   +   ++   N   NK  +
Sbjct: 616 LETNESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLI 675

Query: 681 XXXXXXXXXXXXXPAGMLPNGTDLRLISD-LFHGLYFYIISDYIPDSDAQRIDREDICSL 739
                           +  N  D    S+ +F GL+FY+ISDYI ++D  R+ + D+C+L
Sbjct: 676 GRKKRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNL 735

Query: 740 IIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILP 799
           ++++ G++++N I++   +++LRI+S K T E T L+ RGYD+I+  W+ DC+    ++ 
Sbjct: 736 VLEHNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVR 795

Query: 800 LEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLLLINK 859
           L P+HC  VS+ L+ +   R+D++GDSYE +               +V +S S    I +
Sbjct: 796 LLPSHCFNVSSSLMEVTKTRVDRYGDSYETS---LTEKDFEILINRQVLKSESADKRITE 852

Query: 860 DEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQ 919
            E    IPI LF NR+FF I E +       L  +++LYGG LV K+ DCN+IV    + 
Sbjct: 853 GENHLKIPILLFCNRRFF-IPETLPSTPIYELKSKVELYGGKLVNKISDCNVIV-FTNTH 910

Query: 920 LVNKK--LGDLRCKLVKQYVDANFPQ-PI-PRAVNVSWITESIKAGYQLSPEDYPIL 972
             N+K  +  +R  LV   +D N  Q P+ PR V+ +WI   I    Q+  EDYP +
Sbjct: 911 TENRKEVMKKIRRALV--CLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/958 (47%), Positives = 618/958 (64%), Gaps = 20/958 (2%)

Query: 14  TTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITH 73
           +TK      P NFAPSPDFKWLCDELFVKID +++Q ++  A     K ++ +YF+ I+ 
Sbjct: 2   STKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAF----KSLTVKYFEIISF 57

Query: 74  FIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWK 133
           F+KLWR T+GD+I+PAL LILPYRDRR++NIKD TLI+AICS+L+LP NSV E+RL+RWK
Sbjct: 58  FVKLWRKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWK 117

Query: 134 YKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLL 193
            +A R   L+ FC+ EI +R++EP     ERI+IDKLNE LD L   R N   +   +L 
Sbjct: 118 RRAGRGIKLSDFCVEEIRRRRSEP--LNGERITIDKLNECLDQLAEER-NTKGRGFKSLA 174

Query: 194 QVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSN 253
               FK+CLENM+F E+KY+FDII+K++++G  E+ FL  WHPD+++YLSVVSDL+T+++
Sbjct: 175 DSSVFKYCLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVAD 234

Query: 254 KLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHY 313
           KLW+PS ++ N DL + +G  FAP LAKRL +SYD ++ RL +DF+IEEKMDGERIQLHY
Sbjct: 235 KLWDPSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHY 294

Query: 314 MNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVL 373
           M+YG  +K+FSR G DYTYLYG D   GT+AK+L+L   V+ECVLDGEM++FD+    VL
Sbjct: 295 MDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVL 354

Query: 374 PFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYK 433
           PFGLVKSSA   L  + I    + PL+MV D LYLNG SLI++PL  RK++L+ +L P  
Sbjct: 355 PFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCP 414

Query: 434 DYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEE 493
             VEI+ S+ C D   IK  L+ AI +GSEGI+LK + SKY   AR +NWIK+KPEYLE+
Sbjct: 415 HAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQ 474

Query: 494 FGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQ 553
           FGEN+DL+VIGRD GKKD L+CG+ V E  +E      +                 +P +
Sbjct: 475 FGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK------QVVNLDSEEEEEPRK 528

Query: 554 GIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDS 613
            +KK ISFCTIANG+SQ E K+I R T G WKN  +  PP  +LEFG+K P EWIYP+DS
Sbjct: 529 AVKKFISFCTIANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDS 587

Query: 614 VVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHE-K 672
           VVLE+KARSLD T+ +  K+  GCTL+GGYCR+IR+DK+WT CYTL++L     K+    
Sbjct: 588 VVLEVKARSLDNTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLS 647

Query: 673 KNKNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRID 732
           ++ N Q                     +  D    S +F GL FY+ISDY+   D++RI 
Sbjct: 648 EDSNNQKPMKSKKIRRPRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERIS 707

Query: 733 REDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCL 792
           +E +C LI  NGG++ +NVI+       LRI+S K T+EC  L+ RGYD+++  WL DC+
Sbjct: 708 KEQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCV 767

Query: 793 QAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNS 852
             G ++ +EP HC  VS ++  IA  R+D FGDSY+                   + S  
Sbjct: 768 NTGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTG 827

Query: 853 NLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNII 912
           +L +I+    V+ IP+FLF+ R  F I E     D   L  +++LYGG L   +  CN+I
Sbjct: 828 SLDVISD---VEDIPLFLFSRRIVF-IPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLI 883

Query: 913 VGVCGS-QLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDY 969
           +   G   L  + + DLR  L         P  IP  V  +WI  SI+   Q+  ED+
Sbjct: 884 IVPDGKINLRGRIISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDF 941

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/975 (47%), Positives = 629/975 (64%), Gaps = 31/975 (3%)

Query: 13  TTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTIT 72
           T   ++   TP NFAPSP F+WLCDELFVK+++I++   +K +     KPI+ +Y++ I 
Sbjct: 9   TLDNDTRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEF-QKPINVQYYEVIQ 67

Query: 73  HFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRW 132
           HFI LWR T+G+DI+PAL LILPYRDRR+YN++D TLI+AICSYLKLPKNS  E+RL+ W
Sbjct: 68  HFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSW 127

Query: 133 KYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNL 192
           K +A R   L++F + EI KRK+EPQV   E I+IDKLN+ LD L   R +  +     L
Sbjct: 128 KQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGL 187

Query: 193 LQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLS 252
               TF FCLENMTF+EL++FFDII+K++++G  E+ FL +WHPD+++YLSVVSDL+T++
Sbjct: 188 SDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVA 247

Query: 253 NKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLH 312
           NKLW+P++ + N DL+I VG  FAPQ AK+L +SY+ I  +L +DFFIEEKMDGERIQLH
Sbjct: 248 NKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLH 307

Query: 313 YMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKV 372
           Y +YG  + F SR GTDYTYLYG     GT++K+L L  NV+ CVLDGEMVTFD     +
Sbjct: 308 YQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNAL 367

Query: 373 LPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPY 432
           LPFGLVKSSA S + ++ + N+ + PL MVFD++YLNG SL+++PL++RK +L  + TP 
Sbjct: 368 LPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPE 427

Query: 433 KDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLE 492
           +  VE+L S RC+D   IK  L+ AIS+GSEG+VLK Y S+Y   +R+++WIKVKPEYLE
Sbjct: 428 RHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLE 487

Query: 493 EFGENMDLIVIGRDSGKKDCLICGILVTEEKQEL-----SENMKRXXXXXXXXXXXXXXX 547
           +FGENMDLIVIG+D GKKD L+CG+ V EE +       +E +                 
Sbjct: 488 QFGENMDLIVIGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGN 547

Query: 548 XTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEW 607
             +  + IK+ +SFC+IANG+SQ E K I RIT+G WK  +   PP D+LEFG++ P EW
Sbjct: 548 EIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEW 607

Query: 608 IYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEI 667
           I P+DS+V+E+KARSL+  ++   K+ TG TLYGGYCRQIR+DKDW +CYTL +L    +
Sbjct: 608 IDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL--RRM 665

Query: 668 KRHE----KKNKNKQTLXXXXXXXXXXXXXPAGM------LPNGTDLRLISDLFHGLYFY 717
           KR +    K+  N  T                G        P   D    S +F GLYFY
Sbjct: 666 KRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQ---SRIFDGLYFY 722

Query: 718 IISDYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVR 777
           +ISD + D+   R+ RE++   I+  GG +++NVIAK +  ++ RIL  K T EC  L+ 
Sbjct: 723 VISDVV-DATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLID 781

Query: 778 RGYDVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXX 837
           RGYD+I   W+ DC++  ++L LEP +C  VS EL+ IA  R+D FGDS+EA        
Sbjct: 782 RGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFS 841

Query: 838 XXXXXXXXKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKL 897
                    +  +  ++    + + VD++P+FLF  R   L  +D  L  +  L  QI+L
Sbjct: 842 RLIERNVRSLRNAPPSI----QYDMVDTVPLFLFYGRTILLRIKDKALFTK--LKVQIRL 895

Query: 898 YGGSLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITES 957
           YGG     L  CN++V       V K   D+R  L+K   D + P  +P  V   WI  S
Sbjct: 896 YGGKTTGDLASCNLVVIQQNEIAVAK---DVRSSLLKLTSDTDKPPVLPYIVTPEWIDSS 952

Query: 958 IKAGYQLSPEDYPIL 972
           I  G Q+  ED+P++
Sbjct: 953 ISEGCQVPEEDHPVV 967

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/985 (48%), Positives = 636/985 (64%), Gaps = 62/985 (6%)

Query: 11  VSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDT 70
           +  + +  P  TP NF+PSP F+WLCDELFVK+    E I++K       KP++ RY++ 
Sbjct: 5   IQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKL----EDIQSKRDPKNIGKPVTVRYYEV 60

Query: 71  ITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLI 130
           I HFI LWR T+G+DIFPAL LILPYRDRR++NI+D TLI+AIC+YLKLP+NS  E+RL+
Sbjct: 61  INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL 120

Query: 131 RWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRS 190
            WK +A +   L+ FC++EI KRK+EP+  ++E I+ID+LNE LD L   R   N+K R 
Sbjct: 121 SWKARAGKGVKLSQFCVNEIKKRKSEPK-DKIE-ITIDRLNECLDKLAEER---NSKGRG 175

Query: 191 --NLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDL 248
              L    TFKFCLENM+FIEL++FFDI++KN+++G  E+ FL  WHPD+++YLSVVSDL
Sbjct: 176 FKKLADSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDL 235

Query: 249 RTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGER 308
           RT++ +LW+P I++ N+DL I  G+ FAPQLAK+L +SY+ I  +L NDF IEEKMDGER
Sbjct: 236 RTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGER 295

Query: 309 IQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDST 368
           IQLHY +YGE +KFFSR GTDYTYLYG     G I K L+L+K+VK+C+LDGEM+T+D T
Sbjct: 296 IQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKT 355

Query: 369 SKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTV 428
              +LPFGLVKSSA S L K  I N+ + PLFMVFD++++NG+SL ++PL  RKE+LN +
Sbjct: 356 QNMILPFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGI 415

Query: 429 LTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKP 488
            TP    +E+LSS    +   I+K L+ AIS+GSEGIVLK+Y S+Y   +R+++WIKVKP
Sbjct: 416 FTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKP 475

Query: 489 EYLEEFGENMDLIVIGRDSGKKDCLICGILVTE--EKQELSENMKRXXXXXXXXXXXXXX 546
           EYLE+FGENMDLIVIGRD GKKD L+CG+ V E  EK +L+EN                 
Sbjct: 476 EYLEQFGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKADLNEN----NDDNVIILDDDED 531

Query: 547 XXTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPID-VLEFGTKKPV 605
              +  + I K +SFC IANGLSQ E K+I+R TRG W N ++E PP D +L+FGT+ P+
Sbjct: 532 APVEQERTIHKFVSFCVIANGLSQEEFKQIDRKTRGLW-NRSDEIPPPDTLLQFGTRLPI 590

Query: 606 EWIYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTL------ 659
           EWI P+ SVV+E+KARS+D  +    K+ATGCTLYGGYCR IR+DKDW +CYTL      
Sbjct: 591 EWIDPKKSVVIEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRT 650

Query: 660 ---------HDLTYNEIKRHEKKNKNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDL 710
                     D   + +KR +KKN+ K  L               G+L N       +  
Sbjct: 651 KNVKSRRNGSDQVIHGVKR-QKKNRRKYILDQSLEEE-------GGLLKN-------TAF 695

Query: 711 FHGLYFYIISDYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTI 770
           F  LYFY+ISD   D    RI++E +   I + GG +I+N+I+K +    LRI+S K T 
Sbjct: 696 FRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTN 755

Query: 771 ECTDLVRRGYDVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEAT 830
           EC+ L+ RGYDVIN  W+ DC+Q+  +L LEP +C  VS EL  +   R+D FGDSYE  
Sbjct: 756 ECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVP 815

Query: 831 XXXXXXXXXXXXXXXKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDT 890
                           V      L+    DE +  IP+FLF +R            +  T
Sbjct: 816 ITEEQLSTLLETELNLVRV--QGLVTPYADEELIKIPLFLFQDRIMLFPNT-----ESKT 868

Query: 891 LIF---QIKLYGGSLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPR 947
           + F   +IKLYGG L T +  CN+I+   G+Q + ++  DL   L K  +++     IP 
Sbjct: 869 ISFLQEKIKLYGGKLTTDIGKCNLIILPNGNQQLLQRTRDL---LTKNIMNSGEVPTIPY 925

Query: 948 AVNVSWITESIKAGYQLSPEDYPIL 972
            VN  WI  SI+   Q+  EDYP++
Sbjct: 926 IVNPLWIERSIEENSQVPEEDYPVI 950

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/958 (47%), Positives = 632/958 (65%), Gaps = 32/958 (3%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P NFAPSPDF+WLC+ELF K++++   + N TA T   K +S RY++ I++F +LWR T+
Sbjct: 11  PHNFAPSPDFRWLCEELFAKVEEV---LINGTAGT--GKSVSFRYYEIISNFTELWRKTV 65

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G++I+PAL L LPYRDRR+YNIKD  LIR +CSYLKLPKNS  E+RL  WK +  +  +L
Sbjct: 66  GNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSL 125

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202
           ++  + EISKR+ EP     + I++D +N  LD+L     N + +   NL++ + F  CL
Sbjct: 126 SSLLVEEISKRRTEPTR---KSITVDSVNFYLDELS-KEMNASGRGFKNLVKSKPFLHCL 181

Query: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262
           ENMTF+ELK+FFDI++KN+++G  E+  L  WHPD+++YLSVVSDLR +++KL++P I++
Sbjct: 182 ENMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRL 241

Query: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322
            N DLSIKVG+ FAPQLAK++ LSY+ I + L NDFF+EEKMDGERIQ+HYMNYG+++KF
Sbjct: 242 KNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKF 301

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
           FSR G DYTYLYG +  +GTI+++L+   +VKECVLDGEMVTFD+  K +LPFGLVK SA
Sbjct: 302 FSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSA 361

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
              L+  DI+N+ FHPL+MVFD+LYLNG+SL  LPL++RKE+L+++L P K  VEI+   
Sbjct: 362 KEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYS 421

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
           RC D+  +KK L+ AIS+GSEG+VLK Y S Y   +R+NNWIKVKPEYLEEFGEN+DLI+
Sbjct: 422 RCYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLII 481

Query: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISFC 562
           IGRDSGKKD  + G+LV +E++  +    +                T P + ++KV+SFC
Sbjct: 482 IGRDSGKKDSFMLGLLVVDEQE--TGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFC 539

Query: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622
           +IANG+SQ E KEI+R TRG WK  +  +PP  +LEFG+K P EWI P +S+VLEIK+RS
Sbjct: 540 SIANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRS 599

Query: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQT--L 680
           LD T+    KYAT CTLYGGYCR+IR DKDWT CYTL +L  N   R  K N + Q   L
Sbjct: 600 LDNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYEN---RRTKSNPSHQVENL 656

Query: 681 XXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLI 740
                         +       + + IS +F GL+FY++SDYI      RI R ++  +I
Sbjct: 657 QLQLVPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVI 716

Query: 741 IKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPL 800
           +K+GG++I+NVI K + I  +R++  K T EC  L+ RGYD+++  W+ DC     +LP+
Sbjct: 717 VKHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPI 776

Query: 801 EPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLL---LI 857
           EP++C  VS +L A+A  R+D FGDS+E                  + +S  +LL     
Sbjct: 777 EPSYCFSVSGKLRAVARRRVDCFGDSFE--------NDISESKLSSLQKSQPDLLSTRQA 828

Query: 858 NKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCG 917
           +K   +  IP+FLF+NR  ++ +  I   D   L  +I+L+GG +  +    N+I+    
Sbjct: 829 DKSFELQIIPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYA 888

Query: 918 SQLVNKKLGDLRCKLVKQYVDAN----FPQPIPRAVNVSWITESIKAGYQLSPEDYPI 971
             +      +     + ++V A+     P+ IPR V   W+  SI    Q+  ED+P+
Sbjct: 889 DPIWRGDCLEEVHSQINEHVKASNSDTVPR-IPRIVTPEWVDHSISENCQVPEEDFPV 945

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/952 (46%), Positives = 637/952 (66%), Gaps = 20/952 (2%)

Query: 22  TPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTT 81
            P+NFAPSP FKWLC+ELF K++++  Q        ++ K I+ RY++ IT+F+ LWRTT
Sbjct: 10  VPRNFAPSPQFKWLCEELFSKLEEVPNQ------RHLTTKRITLRYYEIITNFVNLWRTT 63

Query: 82  IGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYET 141
           +GDDI+PAL L LPYRDRR+YN+KD TLI+AIC+YLKLPKNS  E+RL+ WK +ADR   
Sbjct: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123

Query: 142 LATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFC 201
           L+  C++E+ KRK+EP   +   I++D+LN +LD L  +R N   +   NL +   F +C
Sbjct: 124 LSVSCVNEMRKRKSEP--VEKSPITLDELNTLLDFLSQDR-NIKGRGYKNLSESSIFTYC 180

Query: 202 LENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIK 261
           +E M+F+EL+YFFDII+K +++G  E+  L  WHPD+++YLSVVSDL+T+  +LWNP+I+
Sbjct: 181 IEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIR 240

Query: 262 INNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVK 321
           + + +LSI +GY FAP LAK+L +SYD I  +L NDFFIEEKMDGERIQ+HYM+YG  +K
Sbjct: 241 LRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIK 300

Query: 322 FFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSS 381
           F SR G DYTYLYG + S GTIA +L+L+++VKECVLDGEMVT+D     +LPFG+VKS+
Sbjct: 301 FLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSA 360

Query: 382 ASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSS 441
           A + L K++I    +HPL MVFD+++LNGSSL++ PL++RK++L +VL PY+  V+I++ 
Sbjct: 361 AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF 420

Query: 442 IRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLI 501
            RC++   I+K L+ AISVGSEGIVLK Y S+Y+  +R+++WIK+KPEYLE+FGENMDLI
Sbjct: 421 TRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLI 480

Query: 502 VIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISF 561
           VIGRDS KKD   CG+ V +E++E                        + ++ IKKV+SF
Sbjct: 481 VIGRDSAKKDSFYCGLTVLDEEEEKLVEEI-DKGVVNLVSDESDYENPENNRHIKKVVSF 539

Query: 562 CTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKAR 621
           C IANG+SQNE KEI R TRG WK      PP +++EFGT+ P+EWI P+ SVVLEIKAR
Sbjct: 540 CMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKAR 599

Query: 622 SLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLX 681
           SLD T+ +  ++  GCTLYGGYCR+IR D DW S ++L +L  +   +H      K TL 
Sbjct: 600 SLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLL 659

Query: 682 XXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLII 741
                       P     N  D++  S +F GL+FYI+SDY   ++  RI ++D+  L++
Sbjct: 660 KSKKRRKKQLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLL 719

Query: 742 KNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLE 801
           +NGG++ +N+++K  + S LRIL  K T EC  L++RGYD+++  W+ DC++   I+ +E
Sbjct: 720 ENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIE 779

Query: 802 PAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLLLINKDE 861
           P+HC  VS++L+A+A  R+DK+GDSYE+                + ++  S  LL   + 
Sbjct: 780 PSHCFSVSDDLMALAMRRVDKYGDSYES-----LLSVSRLSYILRSSKDISPDLLSPANM 834

Query: 862 GVD--SIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGS- 918
            +D   +P FLF  RK F+++ +         I +I+LYGG +V  + +CNI++      
Sbjct: 835 SLDFEKVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEI 894

Query: 919 QLVNKKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDY 969
            ++ + +  +R  L K  V  +   P +PR V+  WI  SI+   Q+  EDY
Sbjct: 895 TVIRESMKFIRNTLAKT-VSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/967 (47%), Positives = 637/967 (65%), Gaps = 34/967 (3%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P+NF+PSPDFKWLC+ELFVK+D++R  +K K+ +T   +P + +Y   I +FI LWR T+
Sbjct: 16  PRNFSPSPDFKWLCNELFVKLDEVR--LKPKSVDT---RPKNIQYDIVINNFIHLWRVTV 70

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G+DI+PALRLILPYRDRR Y I++ TLIR +C YLKL KNSV E+RL RWK KA R   L
Sbjct: 71  GNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINL 130

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQN---WNNKKRSNLLQVETFK 199
           ++FCI EI KR +EP     E+I+IDKLN ILD L + R +    N      L Q+E+ K
Sbjct: 131 SSFCIQEIKKRLSEP--VSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIK 188

Query: 200 FCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPS 259
           +C ENM+FIEL+YFFDI++K +++G LE+ FL  WHPD+ +YLSVVS+L  ++ KLWNP+
Sbjct: 189 YCFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPN 248

Query: 260 IKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGET 319
            ++N+ DL+I +   F PQLAK++ LSY+ +S R+NN F IEEKMDGERIQ+HYM+YG  
Sbjct: 249 FRLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQ 308

Query: 320 VKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVK 379
           +K+FSR G DYTYLYG DKS  TI+K+L+L+++VKEC+LDGEMV++D +   +LPFG+VK
Sbjct: 309 IKYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVK 368

Query: 380 SSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEIL 439
           S A++ L    ++ND   PLF+VFD+L+LNGS L +LPL++RKE+L+ +LTP K ++EIL
Sbjct: 369 SGAANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEIL 428

Query: 440 SSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMD 499
                 DS  I+  L AAISVGSEGIVLK+Y S Y    R+N+WIKVKPEYLE+FGEN+D
Sbjct: 429 KFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLD 488

Query: 500 LIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXX--XTKP--SQGI 555
           LIVIGRD GKKD L+CG+ V E ++   + ++                    KP  ++ I
Sbjct: 489 LIVIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRI 548

Query: 556 KKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVV 615
            K ISFC IANG+S  E KEI+R T G WK +++E PP D LEFGT+ PVEWI P DSVV
Sbjct: 549 TKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVV 608

Query: 616 LEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNK 675
           LE+KARSL+  +  + K+ TG TLYG YCR+IR DKD+  CYT  DL    I  ++K++ 
Sbjct: 609 LEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLV---IATNKKRSS 665

Query: 676 NKQTLXXXXXXXXXXXXXPAGMLPNGT------DLRLISDLFHGLYFYIISDYIPDSDAQ 729
           ++                   ML N T      D    S +F GL F++ISDY+  + + 
Sbjct: 666 SELYGNHSHIKKKRSRTSKVNML-NQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSF 724

Query: 730 RIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLF 789
           R+  +++ ++I  NGG++I+N++++      +RI+S K T EC +L++RGYD+I+  W+ 
Sbjct: 725 RLRIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWIL 784

Query: 790 DCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNR 849
           DC+    +L  EP+HC  VS  L  I+  R+D  GDSY+                 K   
Sbjct: 785 DCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQL 844

Query: 850 SNSNLLLINKDEGVDSIPIFLFTNRKFFLIKE---DILLGDRDTLIFQIKLYGGSLVTKL 906
            ++ L     D+ ++ IPIFLF+N+K +  K+   + LL + +     IKLYGG+ V  +
Sbjct: 845 YSNPLQF---DQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETN---LYIKLYGGTSVNNI 898

Query: 907 EDCN-IIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLS 965
            DCN II+G   S+  N+K+  +R +L    V +N   PIPR V+  WI +SI  G Q+ 
Sbjct: 899 NDCNVIIIGDEHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVV 958

Query: 966 PEDYPIL 972
            ED+PI+
Sbjct: 959 EEDFPII 965

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/946 (45%), Positives = 619/946 (65%), Gaps = 27/946 (2%)

Query: 25  NFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTIGD 84
           NFAPSPDF WLC++LF KID     ++ + AN +  KP++ RY++ I++F  LWRTT+G+
Sbjct: 24  NFAPSPDFLWLCEQLFAKID----HVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGN 79

Query: 85  DIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETLAT 144
           +I+PALRLILPYRDRRV+NIKD TLI+AIC++LKLPK+S  E++LI WK  A R   L+ 
Sbjct: 80  NIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSK 139

Query: 145 FCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCLEN 204
           FC+ EI KR++EPQ+ + ERI+ID LN  LD L + R     +   NL   +    CL +
Sbjct: 140 FCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTE-QGRSFKNLANSDIMNKCLTS 198

Query: 205 MTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKINN 264
           MTF+E++YFFDI++KN+ LG  E+  L  WHPD+++YLSVVSDL T++ +LW+PS ++ N
Sbjct: 199 MTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGN 258

Query: 265 SDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFS 324
            DL I +G  FAPQLA +L +SY  I  +L  DFFIEEKMDGERIQ+HY N+G  +KF+S
Sbjct: 259 QDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYS 318

Query: 325 RHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASS 384
           R  TDYTYLYGN+   GT+A F+ L+KNVK+CVLD E+VTFDS +K VLPFG+VKSSA +
Sbjct: 319 RRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKN 378

Query: 385 QLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRC 444
            L++  ID   FHPL MVFD+LYLNG++L+DLP +KR+E+L  +LTP    +EI+ SIR 
Sbjct: 379 MLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRA 438

Query: 445 TDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIG 504
            D   IKK L+ A+SVGSEGI+LK+Y S+Y+  +R ++WIK+KPEYLE+FGENMDL+++G
Sbjct: 439 NDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMG 498

Query: 505 RDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISFCTI 564
           RD  KKD L+ G+L  EE  + S  M                   + SQ  +  +S C I
Sbjct: 499 RDPSKKDSLMLGLLDYEEVIQDSPIM------------VNSQSSEENSQRFRGFVSLCII 546

Query: 565 ANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARSLD 624
           ANG+S  E KEI+R T+G W N + + PP++ ++FG+K P +WI P+ S++LEIKARSLD
Sbjct: 547 ANGISNEEYKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLD 605

Query: 625 RTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRH-EKKNKNKQTLXXX 683
            T  ++ K+A GCTL+GGYCRQIR+DK+W +CYTL +    +   +  K+  +K      
Sbjct: 606 NTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVIS 665

Query: 684 XXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLIIKN 743
                         L +  +L   SD+F G+YFY++SDY      +RI + +I  +I+ N
Sbjct: 666 KKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVAN 725

Query: 744 GGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLEPA 803
           GG+++ NVI + Y ++ LRI+SS++T+EC  L+ RGYD+I+  W+FDCL +G I+ LEP+
Sbjct: 726 GGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPS 785

Query: 804 HCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLLLINKDEGV 863
           HC   S +L+  A  RID++GD YE                    +   ++     D  +
Sbjct: 786 HCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQF---DNSL 842

Query: 864 DSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQLVNK 923
             +P FLF  R  FL+ ++  +       F +  YGG +  +L   N+++ V G+ +  +
Sbjct: 843 MDVPHFLFHGRIVFLLSDNNNIQKES---FMVDAYGGKVTNELSSANLVI-VVGA-VTQR 897

Query: 924 KLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDY 969
           ++ D+R ++  + +  + P  IP  V+  W+ + IK   Q++ ++Y
Sbjct: 898 RINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/964 (45%), Positives = 623/964 (64%), Gaps = 17/964 (1%)

Query: 11  VSTTTKESPAT--TPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYF 68
           VS   +ES +T   P NFAPSPDF WLC+ELFVK++ ++ Q +      + NKP+S RY+
Sbjct: 13  VSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREH----LGNKPLSVRYY 68

Query: 69  DTITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERR 128
           + I+HFI+LWR T+G++IFPAL L LPYRDRR+YNIKD TL++AICSYL LPK S  E+R
Sbjct: 69  EVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKR 128

Query: 129 LIRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKK 188
           L++WK +A R   L+ FC+ EI KRK+EP   +  RI+IDKLNE LD LV  R      K
Sbjct: 129 LLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGR--RITIDKLNECLDHLVEERNAKGGFK 186

Query: 189 RSNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDL 248
              L    TF FCL+NM+FIEL++FFDI++KN+++G  E+  L  WHPD+ +YLSVVSDL
Sbjct: 187 --GLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDL 244

Query: 249 RTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGER 308
            T++++LW+P  ++   DLSI +GY F PQLAK++ +SY+ I  +LNNDF IEEKMDGER
Sbjct: 245 ETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGER 304

Query: 309 IQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDST 368
           IQ+HYM+YG  ++F SR G DYT LYG +  +GT+A +L    NV++CVLDGEM+TFD+ 
Sbjct: 305 IQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTD 364

Query: 369 SKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTV 428
              VLPFG+VKSSA   L+ + I +    P+ MV D++YLNG SLI LPL++RKEFLN V
Sbjct: 365 RNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRV 424

Query: 429 LTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKP 488
           L P    VEIL  +RC++   I+K L+ +IS+GSEGIVLK Y ++Y   AR++ WIKVKP
Sbjct: 425 LKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKP 484

Query: 489 EYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSE-NMKRXXXXXXXXXXXXXXX 547
           EYLE+FGEN+DL++IGR  GKKD L+CG+ V E +++L+E   KR               
Sbjct: 485 EYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELD 544

Query: 548 XTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEW 607
            T   + IK  ISFC IANG+SQ E KEI+R TRGAW   +   P  D+L FG+K P EW
Sbjct: 545 DTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEW 604

Query: 608 IYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEI 667
           I P++S++LE+KARSLD T+ ++ K+A GCTL+GGYCR+IR DKDWT CY+  +L    +
Sbjct: 605 IDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERL 664

Query: 668 KRHEKKNKNKQTLXXXXXXXXXXXXXP-AGMLPNGTDLRLISDLFHGLYFYIISDYIPDS 726
            +      +                 P +G      D+   +++F GL FY++SDYI  S
Sbjct: 665 HKSSTGVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVS 724

Query: 727 DAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLS 786
              RI + +   LI++N G+++ N+I+K ++ S+ RI+S K T EC  L+ RGYD+++  
Sbjct: 725 RNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQ 784

Query: 787 WLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXK 846
           W+ DC++  +++ LEP HC  VS+EL+ I   R+D++GDS+                   
Sbjct: 785 WILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSF---VNPITEQQLDNLIDTN 841

Query: 847 VNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKL 906
           + ++  NL+     E +D +P+FLF+ R  ++  +     D   L  + KL+GGS+ + +
Sbjct: 842 MKQTEPNLMREANSE-LDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI 900

Query: 907 EDCNIIVGVCGSQ-LVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLS 965
             CN+I+    +Q L  + L ++R  +++     +    IP  V   W+ +SI+   Q+ 
Sbjct: 901 PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP 960

Query: 966 PEDY 969
            ED+
Sbjct: 961 EEDF 964

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/951 (46%), Positives = 628/951 (66%), Gaps = 18/951 (1%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P+NFAPSPDFKWLC+ELFV+ID +R    N TA T   K  S +Y++ I++F++ WR  +
Sbjct: 11  PQNFAPSPDFKWLCEELFVRIDNVR---INGTAGT--GKSASFKYYEIISNFVESWRKGV 65

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G++I+PAL L LPYRDRR+YNIKD  LIR ICSYLKLP+NSV E+RL  WK +  R   L
Sbjct: 66  GNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNL 125

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202
           ++  + EI+KR+ EP     + I+ID +N+ LD+L   R + + +   +L+  + F  CL
Sbjct: 126 SSLLVEEIAKRRPEPNG---KSITIDGVNDYLDELSKER-SISGRGFKDLVNSKPFLSCL 181

Query: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262
           E+M+F+ELKYFFDI++KN+++G  E+ FL  WHPD+++YLSVVSDL+ +++KL++P +++
Sbjct: 182 ESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRL 241

Query: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322
            N DLSIKVG+ FAPQLAK++ L Y+ I   L+NDF IEEKMDGERIQ+HYMNYG+++KF
Sbjct: 242 KNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKF 301

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
           FSR G DYTYLYG   S+GTI+++L+L   VKECVLDGEMVTFDST K +LPFGLVK SA
Sbjct: 302 FSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSA 361

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
              L+  DI+N  F PL+MVFD+LYLN  SL  LPL +RK++L+++LTP+K+ VEI+ S 
Sbjct: 362 KGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQST 421

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
           RC D   +K  L+ AIS+GSEG+VLK Y S Y   +R+ NWIKVKPEYLEEFGEN+DLI+
Sbjct: 422 RCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLII 481

Query: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISFC 562
           IGRDSGKKD  + G+LV +E+ E+ E  +                     + +KKV+SFC
Sbjct: 482 IGRDSGKKDSFMLGLLVIDER-EMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540

Query: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622
           ++ANG+S  E KEINR TRG WK  ++ +PP  +L+FG++ P EWI P DS+VLEIK+RS
Sbjct: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRS 599

Query: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLXX 682
           LD T+ +  +YAT CTLYGGYCR+IR DKDWT CYTL  L Y +     K N+  +    
Sbjct: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQL-YEDRPIKSKPNQQDENFQL 658

Query: 683 XXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLIIK 742
                       +       + +LIS +F GL+FY++SDY+      RI R  +   I+K
Sbjct: 659 QLAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVK 718

Query: 743 NGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLEP 802
           +GG++I+NVI K + I  +R++S K+TIEC  L+ RGYD+++ SW+ DC+    ++ +EP
Sbjct: 719 HGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEP 778

Query: 803 AHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLLLINKDEG 862
           ++C  VS++L  +A  R+D  GDS+E                 K  +  S++  I  D  
Sbjct: 779 SYCFSVSHKLREVAEKRVDCLGDSFENN-----ISERKLSLLFKSRQDLSSIGEIGIDSE 833

Query: 863 VDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQLVN 922
              IP+FLF+NR  ++ +    L +   L  +I+L+GG +  +   CN+I+         
Sbjct: 834 AQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRR 893

Query: 923 KKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDYPIL 972
           K   +   + +K+ + A+   P + R V+  W+  SI    Q+  ED+P++
Sbjct: 894 KDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/951 (46%), Positives = 629/951 (66%), Gaps = 20/951 (2%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P+NFAPSPDFKWLC+ELFVKI ++  QI N TA T   K  S +Y++ I++F+++WR T+
Sbjct: 11  PQNFAPSPDFKWLCEELFVKIHEV--QI-NGTAGT--GKSRSFKYYEIISNFVEMWRKTV 65

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G++I+PAL L LPYRDRR+YNIKD  LIR ICSYLKLPKNS  E+RL  WK +  +   L
Sbjct: 66  GNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNL 125

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202
           ++  + EI+KR+ EP     + I+ID +N  LD L  +R   + +   +L++ + F  C+
Sbjct: 126 SSLLVEEIAKRRAEPSS---KAITIDNVNHYLDSLSGDRFA-SGRGFKSLVKSKPFLHCV 181

Query: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262
           ENM+F+ELKYFFDI++KN+++G  E+  L  WHPD+++YLSV+SDL+ +++KL++P +++
Sbjct: 182 ENMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRL 241

Query: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322
            + DLSIKVG+ FAPQLAK++ LSY+ I   L++DF +EEKMDGERIQ+HYMNYGE++KF
Sbjct: 242 KDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKF 301

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
           FSR G DYTYLYG   S+GTI++ LR   +VKECVLDGEMVTFD+  + +LPFGLVK SA
Sbjct: 302 FSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSA 361

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
              L+   I+N  FHPL+MVFD+LYLNG+SL  LPL +RK++LN++L+P K+ VEI+ S 
Sbjct: 362 KEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSS 421

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
           RC     IKK L+ AIS+GSEG+VLK Y S Y   +R+NNWIKVKPEYLEEFGEN+DLIV
Sbjct: 422 RCYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIV 481

Query: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISFC 562
           IGRDSGKKD  + G+LV +E +E  ++                   ++  + +KK++SFC
Sbjct: 482 IGRDSGKKDSFMLGLLVLDE-EEYKKHQGDSSEIVDHSSQEKHIQNSR--RRVKKILSFC 538

Query: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622
           +IANG+SQ E KEI+R TRG WK  +   PP  +LEFG+K P EWI P +S+VLEIK+RS
Sbjct: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598

Query: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLXX 682
           LD T+    KYAT CTLYGGYC++IR DK+WT CYTL+DL  +   +     + +++   
Sbjct: 599 LDNTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLG 658

Query: 683 XXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLIIK 742
                            N   L  IS++F GL FY++SDY+ +    RI R ++   I++
Sbjct: 659 LIRKKRKRVLISDSFHQNRKQLP-ISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVE 717

Query: 743 NGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLEP 802
           +GG++IYNVI K ++I  +R++S K+T EC  L+ RGYD+++ +W+ DC+    ++ +EP
Sbjct: 718 HGGKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEP 777

Query: 803 AHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLLLINKDEG 862
            +C  VS ++ A+A  R+D  GDS+E                 K   S   +  +  D  
Sbjct: 778 NYCFNVSQKMRAVAEKRVDCLGDSFE-----NDISETKLSSLYKSQLSLPPMGELEIDSE 832

Query: 863 VDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGSQLVN 922
           V   P+FLF+NR  ++ +  I   D D +  +IKL+GG +  +   CN+I+      ++ 
Sbjct: 833 VRRFPLFLFSNRIAYVPRRKISTED-DIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILR 891

Query: 923 KKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDYPIL 972
           K   +   + +K+ + A+   P I R V   W+  SI    Q+  ED+P++
Sbjct: 892 KDCMNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/967 (45%), Positives = 628/967 (64%), Gaps = 51/967 (5%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P+NFAPSPDFKWLC+ELF KID++  Q+K       + K  S +Y++ +++F+++WR T+
Sbjct: 11  PQNFAPSPDFKWLCEELFSKIDEV--QVKGTIG---TGKSRSFKYYEVLSNFVEMWRKTV 65

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G++I+PAL L LPYRDRR+YNIKD  LIR ICSYLKLPKNS  E RL  WK +  + + L
Sbjct: 66  GNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNL 125

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202
           ++  + EI+KR++EP     + I+ID +N  LD+L  +R   + +   NL++   F  CL
Sbjct: 126 SSLLVEEIAKRRSEPNG---KAITIDGINSTLDELSKDRST-SGRGFKNLVKSSPFLHCL 181

Query: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262
           E+M+F+ELKYFFDI++K++++G  E+ FL  WHPD+++YLSVVSDL+ +++KL++P +++
Sbjct: 182 ESMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRL 241

Query: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322
            N DL+IKVG+ FAPQLAK++ L Y+ I   L+NDF +EEKMDGERIQ+HYMNYG++V+F
Sbjct: 242 KNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRF 301

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
           +SR G DYTYLYG   S+GTI+  L    NV+ECVLDGEMVTFD+  K +LPFGLVK SA
Sbjct: 302 YSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSA 361

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
              L+   I+N  FHPL++VFD+LYLNG+SL  LPL +RKE+L ++LTP K+ VE++ + 
Sbjct: 362 KDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTS 421

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
           RC +   IKK L+ AIS+GSEG+VLK Y S Y   +R+NNWIKVKPEYLEEFGEN+DL++
Sbjct: 422 RCYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVI 481

Query: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQ-GIKKVISF 561
           IGRD GKKD  + G+L+  EK    E  KR                   SQ  +KK++SF
Sbjct: 482 IGRDPGKKDSFMLGLLLLNEK----EMDKRDQEVSSGIANNSKNENILYSQKKVKKILSF 537

Query: 562 CTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKAR 621
           C++ANG+SQ E KEI+R TRG WK  +   PP  + EFG+K P EWI P +S+VLEIK+R
Sbjct: 538 CSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSR 597

Query: 622 SLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDL----------TYNEIKRHE 671
           SLD T+    KYAT CTLYGGYC++IR DKDWT C+TL++L          +Y   K H 
Sbjct: 598 SLDNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHL 657

Query: 672 K--KNKNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQ 729
           K  + K ++ L              +      T+    S +F GLYFY++SDY+ ++   
Sbjct: 658 KLVRKKRREVLT-------------SNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEV 704

Query: 730 RIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLF 789
           RI R ++ + I+++GGR+IYN+I K + I  +R++S K+T EC  L+ RGYD+++ SW+ 
Sbjct: 705 RITRGELENAIVRHGGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVI 764

Query: 790 DCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNR 849
           DC+    ++P+EP +C  VS ++ A+A  R+D  GDS+E                  + +
Sbjct: 765 DCVAYKKLIPIEPCYCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSL--------LYK 816

Query: 850 SNSNLLL---INKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKL 906
           S  NL     + +D  V   P+FLF+NR  ++    I +    TL  +I+L+GG +  + 
Sbjct: 817 SQHNLPPPEEVERDAEVQVFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQ 876

Query: 907 EDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLS 965
             CN+++   G     K       + +K+ V A    P IPR V   W+  SI    Q+ 
Sbjct: 877 SLCNLVIIPYGDPTWRKDCIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVP 936

Query: 966 PEDYPIL 972
            ED+P++
Sbjct: 937 EEDFPVV 943

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/960 (45%), Positives = 619/960 (64%), Gaps = 25/960 (2%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P NFAPSPDF+WLCDELFVK D +  Q +      I+ KPI+ RY++ +++F++LWR T+
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRR-----INLKPITVRYYEVVSNFVQLWRKTV 63

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           G++ +P L L LPYRDRR YNIKD+TLI+AIC YL LPK S  E++L+ WK +A R E L
Sbjct: 64  GNNFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERL 123

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFCL 202
           ++FC+ EI KRK+ P  ++ + I++DKLN ILDDL   + +     R+ L     FKFCL
Sbjct: 124 SSFCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRT-LADSSHFKFCL 182

Query: 203 ENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIKI 262
           ENM+FIELKYFFDI++K +I+G  E+  L  WHPD+ +Y SVVSDL +++ KL+ PS+++
Sbjct: 183 ENMSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRL 242

Query: 263 NNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKF 322
            N DL++K+G  FAP LAKRL +SY+ I  +L +DF IEEKMDGERIQ+HYM+YG  +KF
Sbjct: 243 RNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKF 302

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
            SR GTDYTYLYG D S GTIA +L+L++NVKEC+LDGEMVT+D   + +LPFGLVKSSA
Sbjct: 303 LSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSA 362

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
            + L+K+ I N S+HPLFM FD++YLNG+SL+DLPL++RK++L+ +LT    +V+I+S  
Sbjct: 363 KNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFA 422

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
           RC +   I K L AAISVGSEGI+LK+  S+Y+  +R+++WIK+KP+YL++FGENMDLI+
Sbjct: 423 RCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLII 482

Query: 503 IGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVISFC 562
           IGRD GKKD  +C + VT +  +    +++                T  +  I K +SFC
Sbjct: 483 IGRDPGKKDAFMCALGVTIDDPQ-PRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFC 541

Query: 563 TIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKARS 622
           TIANG+S  E KEI++ TRG W+ ++   PP + L+FGTKKPVEWI P++S+VLE+K+RS
Sbjct: 542 TIANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRS 601

Query: 623 LDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLXX 682
           LD T+    KY  G TL+GGYCR +R DKDWT+CYT+ +   +   +  K N  +     
Sbjct: 602 LDNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTS 661

Query: 683 XXXXXXXXXXXPAGML-------PNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDRED 735
                        G++       P G      SD+F  L+F ++SDY+      RIDR  
Sbjct: 662 NKGRKKRNTTSILGVISPRKKRTPEGEH----SDIFQNLHFCVLSDYLDPYTGNRIDRNT 717

Query: 736 ICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAG 795
           +  LII  GG+VIYNV+AK      LRI+     +EC  L++RGYD+++ SW+ DC+++ 
Sbjct: 718 LTQLIIDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESA 777

Query: 796 VILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLL 855
            +L LE  HC  VS EL+ +++ R+D++ DS+E                   N  + +  
Sbjct: 778 RLLKLERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLH--NMPSGSFS 835

Query: 856 LINKDEGVDSIPIFLFTNRKFFLIKEDILLGDR--DTLIFQIKLYGGSLVTKLEDCN-II 912
             N D  +  +P  LF +R  F+   +  L DR    +  + KL+GG +   +EDCN II
Sbjct: 836 GENLDFELRGLPPLLFFDRSVFI--AETKLSDRIYAKISSETKLFGGQVTHTIEDCNLII 893

Query: 913 VGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDYPIL 972
           +     +   + L  +R KL       N  + IP  V+  W+ +SIK   Q+  E+Y +L
Sbjct: 894 IPNTDDEDKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/968 (42%), Positives = 598/968 (61%), Gaps = 35/968 (3%)

Query: 10  PVSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFD 69
           P  T T +     P NFAPSPDF+WLC+ELF ++D I E  +         K ++ +  +
Sbjct: 8   PSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQE------LGKAVTVKRVE 61

Query: 70  TITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRL 129
            IT FIKLWRTT+GDD FPALRL+ PYRD R Y+IKD TLI+A+C  L L ++S+ ERRL
Sbjct: 62  IITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRL 121

Query: 130 IRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKR 189
           + WK  A R  +L+ FC+ EISKR+ EP   +  +++ID LNE LD+L            
Sbjct: 122 LNWKQYAGRGTSLSKFCVQEISKRRKEPLPER--QLTIDGLNEKLDELAKEASGKKAWGT 179

Query: 190 SNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLR 249
           + L +  +F+FCL+N++F+EL+YFFDI++KN+++G LE+ FL  WHPD++ YL VV+DL+
Sbjct: 180 TGLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLK 239

Query: 250 TLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERI 309
            LS KLWNPS++++  DLSI +G+ FAP LAKRL +SY+ I ++L +DF +EEKMDGERI
Sbjct: 240 ILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERI 299

Query: 310 QLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTS 369
           QLHY+N G  +KF SR G D+++LYG + + G I+++L+L  +V++CVLDGEMV++D   
Sbjct: 300 QLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKR 359

Query: 370 KKVLPFGLVKSSASSQLNKKDI--DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNT 427
           K +LPFG+VKS+A  +L   ++  +ND + PL+MVFD++YLNG SL  +PL  RKE+L  
Sbjct: 360 KIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKE 419

Query: 428 VLTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVK 487
           +L+P  D VEIL  IR  D+  IK  +  AI +GSEG+++KQ  S Y   AR+++W+K+K
Sbjct: 420 ILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIK 479

Query: 488 PEYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXX 547
           PEY E+ GE MDL+VIGRD GKKD L+CG+LV++ +  L EN                  
Sbjct: 480 PEYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHIL-ENFG-------------PIE 525

Query: 548 XTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEW 607
             K    I K +SFC +ANG+S  E KEINR TRG+W +Y  + PP+ +LEFG+K PVEW
Sbjct: 526 HGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEW 585

Query: 608 IYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEI 667
           I P++SVV+E+KARS++ ++ +  +Y  G TL+  YCR+IR DKDWT+C ++    Y + 
Sbjct: 586 IDPKNSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSV--AQYQQA 643

Query: 668 KR----HEKKNKNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYI 723
           K     H  K K  Q                AG   +  D    S +F GL+FYI+SDY+
Sbjct: 644 KAAHNYHRYKRKVHQVSPRRKRNVHEIFEYCAGEAKSELDTEG-SSIFEGLHFYILSDYV 702

Query: 724 PDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVI 783
             S  +R +R  + + ++K+GG ++ N+  +   +S LRI+S K+TIEC +LV RGYD+I
Sbjct: 703 -TSQRRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDII 761

Query: 784 NLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXX 843
           +  W+FDC+ AG  L +EP HC   S  LL  +  R+D++GDS+                
Sbjct: 762 DPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFF 821

Query: 844 XXKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLV 903
               +  +S +  + +D+ +D  P+FL    K +++  D++      L  +I+LYGG + 
Sbjct: 822 CSSPSDFSSRISSMLQDD-LDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVS 880

Query: 904 TKLEDCNIIV--GVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAG 961
             LE  N+++      +      + +LR K+       N    IP  V   W+       
Sbjct: 881 ETLEGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQ 940

Query: 962 YQLSPEDY 969
             +  ED+
Sbjct: 941 CLVPEEDF 948

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/962 (43%), Positives = 592/962 (61%), Gaps = 46/962 (4%)

Query: 23  PKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTI 82
           P+NFAPSPDF+WLCDELF K+++I E  +         K ++ +  + I +FIKLWRTT+
Sbjct: 36  PQNFAPSPDFRWLCDELFSKLEEITEDRQK------LGKAVTVKRVEVIMYFIKLWRTTV 89

Query: 83  GDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETL 142
           GD+I+P LRLILPYRD R YNIKD TL++A+C  L LPK+S+ E+RL+ WK  A R  +L
Sbjct: 90  GDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSL 149

Query: 143 ATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLV--VNRQNWNNKKRSNLLQVETFKF 200
           + FC+ EI KR+ EPQ +Q  R++ID LN+ LD+L    + + W     + L +  +F+ 
Sbjct: 150 SKFCVEEIMKRRKEPQGSQ--RLTIDALNKCLDELSKEASAKKWGF---NGLSKSPSFQN 204

Query: 201 CLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSI 260
           CL+NM+F E +YFFDII+K +++G LE+ FL  WHPD+++YL VVSDL+ LS  LWNP++
Sbjct: 205 CLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTM 264

Query: 261 KINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETV 320
           ++  ++LSI +G  FAP LAKRL LSY+ +  +L  DF IEEKMDGERIQLHY+  G  +
Sbjct: 265 RLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKI 324

Query: 321 KFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKS 380
           +F SR GTD+T+LYG+    G I++ L+   +V++CVLDGEMV+FD     VLPFG+VKS
Sbjct: 325 RFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKS 384

Query: 381 SASSQLNKKD--IDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEI 438
           +A  +L   D  +D D + PL+M+FD++YLNG SL  LPL  RK +L ++L+P  + VEI
Sbjct: 385 TAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEI 444

Query: 439 LSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENM 498
           LS +R ++   IK  L+ AI +GSEGI+LKQ+ S Y   AR+++WIK+KPEY EE GE M
Sbjct: 445 LSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETM 504

Query: 499 DLIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKV 558
           DL+VIGRD GKKD L+CG+++ +E    S N+                   +P Q   KV
Sbjct: 505 DLVVIGRDPGKKDSLMCGLILADETDGSSVNL------------ASQDDPLRPKQRNPKV 552

Query: 559 ISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEI 618
           ISFC IANG+S  E KEI R TRG W       PP  +LEFGTK P EWI P+ S+VLE+
Sbjct: 553 ISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEV 612

Query: 619 KARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKR----HEKKN 674
           KARS+D  + +  KY TG TL G YCR +R +KDW++C T+    Y + KR    H+ K 
Sbjct: 613 KARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQ--YEQAKRAHNYHKGKR 670

Query: 675 KNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDRE 734
           K+ Q                  +  +  +    S++F GL FYI+SDYI DS  +R +++
Sbjct: 671 KSHQISPRKQRKLANVSELYPLLADDSRESIFESNIFQGLQFYILSDYI-DSQKKRYEKD 729

Query: 735 DICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQA 794
            I +L+ KN G V++N   +    S+LRI+S K+T+EC  L  +GYD+I+ SW+FDCL  
Sbjct: 730 QIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNY 789

Query: 795 GVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNL 854
           G ++ LEP HC   S +LL  +  R+D+FGDS+                   VN  +   
Sbjct: 790 GSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSF-------CRPLSYTEFDELVNGQSVVS 842

Query: 855 LLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVG 914
             ++  E +D IP+FLF N K +  +        + L   ++L+GG     L+ CN++V 
Sbjct: 843 PHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVV- 901

Query: 915 VCGSQLVNKKL----GDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDYP 970
           V  S    KKL      LR ++      +     IP  V+ +W+   I     +  ED+P
Sbjct: 902 VRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFP 961

Query: 971 IL 972
            L
Sbjct: 962 PL 963

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/968 (41%), Positives = 585/968 (60%), Gaps = 84/968 (8%)

Query: 24  KNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTTIG 83
           +NF+PSP+FKWLCDEL  KI       +  +   +  KP++ RY + IT+FIKLWR+T+G
Sbjct: 5   ENFSPSPEFKWLCDELLGKI------YETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVG 58

Query: 84  DDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYETLA 143
           + I+PALRLI+P+RDRR+YN+K+ TLI+A+C YL+LPK+S  E RL+RWK +A R   L+
Sbjct: 59  NYIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLS 118

Query: 144 TFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRS--NLLQVETFKFC 201
            FC+ EI KR+ + +     RI+ID+LN  LD++    Q  N K+     L     F +C
Sbjct: 119 DFCVEEIRKRQKDYE--GANRITIDELNGYLDEV---SQEGNGKRMGYMALTDSRAFNYC 173

Query: 202 LENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIK 261
           L +MTF+E+K+FFDII+K ++L  LENMFL  WHPD+ +YLSVVSDL  LS +L+NP+ +
Sbjct: 174 LNHMTFMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNER 233

Query: 262 INNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVK 321
           +  +DLSI + + F PQLAKR  LSY+ ++++L +DF IEEKMDGER+Q+HY+NYGE +K
Sbjct: 234 LRQTDLSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIK 293

Query: 322 FFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSS 381
           + SR G D++YLYG + S+G I+  L+LH NVK+C+LDGEM+T+D+    VLPFGLVKSS
Sbjct: 294 YLSRRGVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSS 353

Query: 382 ASSQLNKKDID---NDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEI 438
           A +Q+  +       +S+ PLF+ FD++YLNG SL +L L +RK++L  +LTP +  VEI
Sbjct: 354 AMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEI 413

Query: 439 LSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENM 498
           +  ++  ++  IK  L+ AIS+GSEGIVLK   SKY   +R+ +WIK+KPEYLE+FGENM
Sbjct: 414 IQYMKAINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENM 473

Query: 499 DLIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKV 558
           DL++IGR+ GKKD   CG+ ++ +  E++E                     KP     + 
Sbjct: 474 DLLIIGREQGKKDSFFCGLSIS-DPNEVAE---------------------KP-----RF 506

Query: 559 ISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEI 618
           ISFCTIANGLS  E K+I R T G W  ++ + P  ++L FGTK P EWI+P+DSVVLE+
Sbjct: 507 ISFCTIANGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEV 566

Query: 619 KARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLT--------YNEIKRH 670
           KAR++D  +  + KY +GCTL+ GYC+QIR DKDW +  +  +          YN+ K H
Sbjct: 567 KARAIDTKESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSH 626

Query: 671 EKKNKNKQTLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQR 730
           +  +  K+                A + P       +S+ F    F +ISDY   +  +R
Sbjct: 627 QVTDGKKRASKRAKIGIVNSSEPTALVAP-------VSNTFSNCRFRVISDYFDSTKRRR 679

Query: 731 IDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFD 790
           I +ED+CS+I+++GG ++Y           L I+  K T EC  L+     +I  SW+F 
Sbjct: 680 ISQEDLCSVILEHGGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFS 739

Query: 791 CLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRS 850
           C++ G   P   +    +    L  + D    + D   A+                +   
Sbjct: 740 CIEEGYKTPFTESD---IFRGELESSMDCSQFYTDFNTAS-----LNHLLETANRGIKNP 791

Query: 851 NSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLI----FQIKLYGGSLVTKL 906
           +S+LLL         +P+FLF+N K  ++  + +L   DT I    F IK +GG LV  +
Sbjct: 792 DSDLLL-------PEVPLFLFSNLKLAVLNSENVL---DTSILEVEFAIKCHGGELV-HI 840

Query: 907 EDCNIIVGVCGSQLVNKKLGDLRCKLVKQYV-DANFPQP-IPRAVNVSWITESIKAGYQL 964
           E+ +II+ V    +  + L  LR K+  + V ++    P IPR V++SW  +SIK  Y  
Sbjct: 841 ENASIII-VFNDFISREDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIA 899

Query: 965 SPEDYPIL 972
             E Y  L
Sbjct: 900 ETEHYQCL 907

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/957 (39%), Positives = 576/957 (60%), Gaps = 31/957 (3%)

Query: 22  TPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTT 81
           +P NF+PSPDF WLCDELF+K++++  + K+        KP   R  +  ++F+ LWR T
Sbjct: 50  SPINFSPSPDFCWLCDELFIKLEEVALKKKD------LGKPRKVRNLEITSNFVSLWRKT 103

Query: 82  IGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYET 141
           +G+DI+PAL L LPY DRR Y +KD+TL++A+C ++KLP+NS  ERRL+ WK  A R   
Sbjct: 104 VGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVK 163

Query: 142 LATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFC 201
           L+TFC+ E+ KR+ EP V +  R+SID++N +LD L  +  N       +L +   F +C
Sbjct: 164 LSTFCVEELQKRRREPVVPK--RMSIDEVNGMLDKLE-HESNVGKWSYISLAESPAFNYC 220

Query: 202 LENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIK 261
           LE+M+++EL++FFDI++K  I+  LE++ L  WHPD++ Y  VVSDLR +++ L++P+ +
Sbjct: 221 LEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNER 280

Query: 262 INNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVK 321
           +  +DLS+++GY FAP +A+R+ + Y+ +S +L NDF++EEKMDG+RIQ+HYM+YG ++ 
Sbjct: 281 LEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIA 340

Query: 322 FFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSS 381
           +FSR+G +YTYLYG + S G+I+  L+  + VKEC+LDGEMV++D   + +LPFGL KS 
Sbjct: 341 YFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSG 400

Query: 382 ASSQLNKKDIDND--SFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEIL 439
           AS Q+N +   +   ++ PL+ VFD+LYLNG  L +  + KRKE+L  +L P K+ V +L
Sbjct: 401 ASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLL 460

Query: 440 SSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMD 499
           S  RC+D+  I   L AA++ GSEGIVLK+  SKY    R ++WIK+KPEYLE FGENMD
Sbjct: 461 SGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMD 520

Query: 500 LIVIGRDSGKKDCLICGILVTEEKQELSENMKRXXXXXXXXXXXXXXXXTKPSQGIKKVI 559
           L+VIGRD G+KD  IC + VT++ ++   N                    +P   I+K I
Sbjct: 521 LVVIGRDKGRKDSFICALAVTDDSEK---NNPSSYESGSDSDSDSEPIIVQPK--IEKFI 575

Query: 560 SFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIK 619
           SFC+IANG+S  E KEI+R+TRG W  Y+   PP D +EFGTK P EWI P++SVVLE+K
Sbjct: 576 SFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVK 635

Query: 620 ARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDL-TYNEIKRHEKKNKNKQ 678
           ARS+D  +     Y TG TLY  YC++IR DK+W++  T+ +  T  E + +   ++N +
Sbjct: 636 ARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAK 695

Query: 679 TLXXXXXXXXXXXXXPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICS 738
                            G +      +  +D   G YFY+ S Y      + ID  +I  
Sbjct: 696 FGKDRSSPRKRRTFHLVGDIDVTKPSK--ADFLKGYYFYVTSGYFDLQSKKNIDASEIGE 753

Query: 739 LIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVIL 798
            ++  GG  I+N+  +  ++ KL IL  K T E   L+ RGYD+I+  WL DC++ G +L
Sbjct: 754 AVVSCGGTYIHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTML 812

Query: 799 PLEPAHCLFVSNELLAIATDRIDKFGDSYEATXXXXXXXXXXXXXXXKVNRSNSNLLLIN 858
            +EP +    S EL+  A ++ DK+G+SY+                 +   S      ++
Sbjct: 813 QIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVS 872

Query: 859 KDEGVDSIPIFLFTNRKFFLIKEDILLGD-RDTLIFQIKLYGGSLVTKLEDCNIIVGV-- 915
           + E      + +F    F+++ +        D + + I+  GG +   LE   I+V V  
Sbjct: 873 EYER-----LLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKD 927

Query: 916 CGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDYPIL 972
           C SQL    L  +R  +  +   +N  QPIP+ V   W+   ++A Y +  ++Y  +
Sbjct: 928 CFSQL---SLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 128/250 (51%), Gaps = 13/250 (5%)

Query: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKF 322
           N   S++ G    P LAK    + + I +R   + F  E K DGER Q+H +  G T++ 
Sbjct: 390 NEHCSLRPGIPLKPMLAKPTK-AINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRI 447

Query: 323 FSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSA 382
           +SR+G + T  Y        I  F++     K  +LD E V +D   +K+LPF ++ +  
Sbjct: 448 YSRNGENMTERYPEIH----IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRK 503

Query: 383 SSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSI 442
              +  KD+           FDIL  N + LI+  L +R+E L+ V TP     +  + +
Sbjct: 504 RKDVLAKDV---KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560

Query: 443 RCTDSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMD 499
             ++  +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++D
Sbjct: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620

Query: 500 LIVIGRDSGK 509
           L V+G   G+
Sbjct: 621 LCVLGAYYGR 630

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 103/421 (24%), Positives = 177/421 (42%), Gaps = 74/421 (17%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327
           +++ G    P LAK      + ++     +F  E K DGER Q+H +  GE ++ +SR+G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNG 410

Query: 328 TDYTYLY---------------GNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKV 372
            + T  Y                ND+      +       VK+ +LD E+V +D   KK+
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQ------PVKDIILDCEVVAWDVEQKKI 464

Query: 373 LPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPY 432
           LPF ++ +     ++ KD+           FD+LYLN   +I+  L +R+E L  V    
Sbjct: 465 LPFQVLTTRKRKNVDLKDV---KVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLV 521

Query: 433 KDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPE 489
               +  +S+  +D  +++  LD A+    EG+++K      S Y P+ R  NW+K+K +
Sbjct: 522 PGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKD 581

Query: 490 YLEEFGENMDLIVIGR--DSGKKDCLICGILV---TEEKQELSENMKRXXXXXXXXXXXX 544
           YL+  G+++DL+V+G     GK+     G L+    E+ QE                   
Sbjct: 582 YLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE----------------- 624

Query: 545 XXXXTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKP 604
                          + C I  G S   L  ++ + +        + PP+  +   + +P
Sbjct: 625 ---------------TCCKIGTGFSDEMLGNLHTLLQPT----EIDNPPMTYIYDSSAEP 665

Query: 605 VEWIYPQDSVVLEIKARSLDRT---DQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHD 661
             W   Q  V+ E+    L  +        +Y  G +L      +IR+DKD T   T  D
Sbjct: 666 DVWF--QAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSED 723

Query: 662 L 662
           +
Sbjct: 724 I 724

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 121/241 (50%), Gaps = 11/241 (4%)

Query: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYT 331
           G    P LAK      + +       F  E K DGER Q+H M  G T++ +SR+  + T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388

Query: 332 YLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKDI 391
             Y   +      +FL   +  +  ++D E V +D+  +K+LPF ++ +     +  KD+
Sbjct: 389 ERYPEIQ----FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444

Query: 392 DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQIK 451
                      FD+LYLNG SL+   L  R++ L +VL      ++  + I   +  +++
Sbjct: 445 ---KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501

Query: 452 KGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGRDSG 508
             L+ ++S   EG+++K      S+Y P+ R  NW+K+K +YLE  G+++DL V+G   G
Sbjct: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYG 561

Query: 509 K 509
           +
Sbjct: 562 R 562

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 125/257 (48%), Gaps = 13/257 (5%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327
           +I+ G    P LAK      + +       F  E K DGER Q+H +  G T++ +SR+G
Sbjct: 353 TIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDG-TMRIYSRNG 411

Query: 328 TDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLN 387
            + T  Y   +    I  FL    +    +LD E V +D    K+LPF ++ +     +N
Sbjct: 412 ENMTERYPEIQ----IKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVN 467

Query: 388 KKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDS 447
              I+          FDIL  N   LI+ PL KR+E L+ V  P +   +  + +  ++ 
Sbjct: 468 ---INEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNL 524

Query: 448 IQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIG 504
            +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL V+G
Sbjct: 525 DELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 584

Query: 505 R--DSGKKDCLICGILV 519
                GK+     G L+
Sbjct: 585 AYFGRGKRTGTYGGFLL 601

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 127/270 (47%), Gaps = 13/270 (4%)

Query: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFF 323
           N    +K G    P LAK      + +       F  E K DGER Q+H +  G ++  +
Sbjct: 318 NKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIY 376

Query: 324 SRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSAS 383
           SR+G + T  Y        I  +L   +     +LD E V +D+   K+LPF ++ +   
Sbjct: 377 SRNGENMTERYPELH----IRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKR 432

Query: 384 SQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIR 443
             +  KD+           FD+L  NG SLI+  L +R+E+L  VL P     +  + + 
Sbjct: 433 KGVEAKDV---KVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELN 489

Query: 444 CTDSIQIKKGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDL 500
            ++   ++K L+ ++    EG+   VL+   S Y P+ R  NW+K+K +YL+  G+++DL
Sbjct: 490 SSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDL 549

Query: 501 IVIGR--DSGKKDCLICGILVTEEKQELSE 528
            V+G     GK+     G L+    Q+  E
Sbjct: 550 CVLGAYYGRGKRTGTYGGFLLGCYNQDTGE 579

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 129/269 (47%), Gaps = 13/269 (4%)

Query: 265 SDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFS 324
           S + +  G    P LAK      + +    N  F  E K DGER Q+H +  G +++ +S
Sbjct: 346 SHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYS 404

Query: 325 RHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASS 384
           R+G D T  Y        I  +L       + +LD E V +D   +K+LPF ++ +    
Sbjct: 405 RNGEDMTQRYPE----LNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRK 460

Query: 385 QLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRC 444
            ++ KDI           FDIL  N  SLI+  L +R++ L+++  P     +  + +  
Sbjct: 461 SVDLKDI---KVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTT 517

Query: 445 TDSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLI 501
           ++  +++  LD AI    EG+++K      S Y P+ R  NW+K+K +YL+  G+++DL 
Sbjct: 518 SNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLC 577

Query: 502 VIGR--DSGKKDCLICGILVTEEKQELSE 528
           V+G     GK+     G L+    Q+  E
Sbjct: 578 VLGAYYGRGKRTGTYGGFLLACYNQDTEE 606

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  104 bits (260), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 131/267 (49%), Gaps = 15/267 (5%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326
           +++ G    P LAK    + + + +R   + F  E K DGER Q+H +N G T++ +SR+
Sbjct: 384 TLRPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRN 441

Query: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386
           G + T  Y   K    I  F++   + K  +LD E V +D   KK+LPF ++ +     +
Sbjct: 442 GENMTERYPEIK----ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV 497

Query: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446
              D+           FDIL  N   LI+  L +R+E L  V        +  + I   +
Sbjct: 498 ELHDV---KVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNN 554

Query: 447 SIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503
             +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL V+
Sbjct: 555 LDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 504 GR--DSGKKDCLICGILVTEEKQELSE 528
           G     GK+     G L+    Q+  E
Sbjct: 615 GAYYGRGKRTGTYGGFLLGCYNQDTGE 641

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 135/269 (50%), Gaps = 19/269 (7%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326
           +++ G    P LAK    + + + +R   + F  E K DGER Q+H +N G T++ +SR+
Sbjct: 474 TLRPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRN 531

Query: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386
           G + T  Y   K    I  F++     K  +LD E V +D    K+LPF ++     S  
Sbjct: 532 GENMTERYPEIK----ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVL-----STR 582

Query: 387 NKKDID-ND-SFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRC 444
            +KD++ ND         FDIL  N   LI++ L +R+E+L  V        +  + I  
Sbjct: 583 KRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIIT 642

Query: 445 TDSIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLI 501
            +  +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL 
Sbjct: 643 NNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 702

Query: 502 VIGR--DSGKKDCLICGILVTEEKQELSE 528
           V+G     GK+     G L+    Q+  E
Sbjct: 703 VLGAYYGRGKRTGTYGGFLLGCYNQDTGE 731

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 122/249 (48%), Gaps = 7/249 (2%)

Query: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFF 323
           +++  ++ G    P LAK      + +      +F  E K DGER Q+H ++ GE ++ +
Sbjct: 347 DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIY 405

Query: 324 SRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSAS 383
           SR+G + T  Y        + K           +LD E+V +D+   K+LPF ++ +   
Sbjct: 406 SRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKR 465

Query: 384 SQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIR 443
             +  KD+           FDILY NG  LI   L +R++ L+ V        +  +S+ 
Sbjct: 466 KGVELKDV---KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLI 522

Query: 444 CTDSIQIKKGLDAAISVGSEGIVLK---QYISKYIPNARHNNWIKVKPEYLEEFGENMDL 500
             +  +I+K LD AI    EG+++K      S+Y P+ R  NW+K+K +YL   G+++DL
Sbjct: 523 TAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDL 582

Query: 501 IVIGRDSGK 509
            V+G   GK
Sbjct: 583 CVMGAYYGK 591

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 118/244 (48%), Gaps = 11/244 (4%)

Query: 269 IKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGT 328
           ++ G    P LAK      + +       F  E K DGER Q+H +  G T++ +SR+G 
Sbjct: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGE 394

Query: 329 DYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNK 388
           + T  Y       +I  F+   ++ K  +LD E V +D   +K+LPF ++ +     +  
Sbjct: 395 NMTERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450

Query: 389 KDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSI 448
           KD+           FDI+  NG   I+  L +R+E L  V  P     +    +  +   
Sbjct: 451 KDV---KVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVE 507

Query: 449 QIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGR 505
           +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YL+  G+++DL V+G 
Sbjct: 508 ELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGA 567

Query: 506 DSGK 509
             G+
Sbjct: 568 YYGR 571

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 133/269 (49%), Gaps = 19/269 (7%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326
           +++ G    P LAK    + + + +R   + F  E K DGER Q+H +N G T++ +SR+
Sbjct: 384 TLRPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRN 441

Query: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386
           G + T  Y        I  F++     K  +LD E V +D    K+LPF ++     S  
Sbjct: 442 GENMTERY----PEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVL-----STR 492

Query: 387 NKKDID-ND-SFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRC 444
            +KD++ ND         FDIL  N   LI+  L +R+E+L  V        +  + I  
Sbjct: 493 KRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITT 552

Query: 445 TDSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLI 501
            +  +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL 
Sbjct: 553 NNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 612

Query: 502 VIGR--DSGKKDCLICGILVTEEKQELSE 528
           V+G     GK+     G L+    Q+  E
Sbjct: 613 VLGAYYGRGKRTGTYGGFLLGCYNQDTGE 641

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 130/267 (48%), Gaps = 15/267 (5%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326
           ++K G    P LAK    + + + +R   + F  E K DGER Q+H ++ G T++ +SR+
Sbjct: 384 TLKPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRN 441

Query: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386
           G + T  Y   K    I  F++     K  +LD E V +D    K+LPF ++ +     +
Sbjct: 442 GENMTERYPEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDV 497

Query: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446
              D+           FD+L  NG  LI+  L +R+E L  V        +  + I   +
Sbjct: 498 ELSDV---KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDN 554

Query: 447 SIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503
             +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL V+
Sbjct: 555 LDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 504 GR--DSGKKDCLICGILVTEEKQELSE 528
           G     GK+     G L+    Q+  E
Sbjct: 615 GAYYGRGKRTGTYGGFLLGCYNQDTGE 641

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 130/267 (48%), Gaps = 15/267 (5%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326
           S++ G    P LAK    + + I +R   + F  E K DGER Q+H ++ G T++ +SR+
Sbjct: 383 SLRPGIPLKPMLAKPTK-AINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRN 440

Query: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386
           G + T  Y        IA  L         +LD E V +D+   K+LPF ++ +     +
Sbjct: 441 GENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDV 496

Query: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446
           + KD+           FDIL  N   LI+  L +R++ L  V        +  + +  ++
Sbjct: 497 DLKDV---KVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSN 553

Query: 447 SIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503
             +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL VI
Sbjct: 554 LDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVI 613

Query: 504 GR--DSGKKDCLICGILVTEEKQELSE 528
           G     GK+  +  G L+    Q+  E
Sbjct: 614 GAYYGRGKRTGMYGGFLLGCYNQDTGE 640

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 122/261 (46%), Gaps = 13/261 (4%)

Query: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFF 323
           N  + ++ G    P LAK      + +       F  E K DGER Q+H    G ++K +
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIY 384

Query: 324 SRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSAS 383
           SR+G D T  Y        +  +++     K  ++D E V +D    K+LPF ++ +   
Sbjct: 385 SRNGEDMTERYPEID----VKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 384 SQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIR 443
             +  KD+           FDIL LN   LI+    +R++ L       +   +  + + 
Sbjct: 441 KGVELKDV---KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 444 CTDSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDL 500
            T+  +++K LD ++    EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 501 IVIGR--DSGKKDCLICGILV 519
           +V+G     GK+     G L+
Sbjct: 558 VVLGAYYGRGKRTGTYGGFLL 578

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 124/266 (46%), Gaps = 13/266 (4%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327
           S++ G    P LAK      +      N  F  E K DGER Q+H MN G +++ +SR+G
Sbjct: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNG 397

Query: 328 TDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLN 387
            + T  Y        +  F++     K  ++D E V +D   KK+LPF ++ +     ++
Sbjct: 398 ENMTERY----PEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVD 453

Query: 388 KKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDS 447
            KDI           FDIL  N   LI+  L +R+E L++V             +   + 
Sbjct: 454 IKDI---KVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNL 510

Query: 448 IQIKKGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIG 504
            +++  LD ++    EG+   VL    S Y P+ R  NW+K+K +YL+  G+++DL V+G
Sbjct: 511 DELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 570

Query: 505 R--DSGKKDCLICGILVTEEKQELSE 528
                GK+     G L+    Q+  E
Sbjct: 571 AFYGRGKRTGTYGGFLLGCYNQDTGE 596

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 113/241 (46%), Gaps = 11/241 (4%)

Query: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYT 331
           G    P LAK      + +       F  E K DGER Q+H +  G +++ +SR+G + T
Sbjct: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415

Query: 332 YLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKDI 391
             Y   + +  IA   R H      +LD E V +D     +LPF ++ +     +  +D+
Sbjct: 416 ERYPEIRISDFIADPARTHT----LILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471

Query: 392 DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQIK 451
                      FDIL  N   LI  PL +R+  L   L P    +++ S +      +++
Sbjct: 472 ---KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528

Query: 452 KGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGRDSG 508
             LD A+    EG+   +L+   S Y P+ R  NW+K+K +YL+  G+++DL V+G   G
Sbjct: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 588

Query: 509 K 509
           +
Sbjct: 589 R 589

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 118/247 (47%), Gaps = 15/247 (6%)

Query: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327
           S++      P LAK      +      +  F  E K DGER Q+H +  G T++ +SR+G
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414

Query: 328 TDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLN 387
            + T  Y        I  F+    + K  +LD E V +D    K+LPF ++     S   
Sbjct: 415 ENMTERYPEIH----IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVL-----STRK 465

Query: 388 KKDIDNDSF--HPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCT 445
           +KD+D +          FDIL  N   LI+  L +R++ L+++        +  + +  T
Sbjct: 466 RKDVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTT 525

Query: 446 DSIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLIV 502
           +  +++  LD ++    EG+++K      S Y P+ R  NW+K+K +YL   G+++DL V
Sbjct: 526 NLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCV 585

Query: 503 IGRDSGK 509
           +G   G+
Sbjct: 586 LGAYFGR 592

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 123/263 (46%), Gaps = 16/263 (6%)

Query: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRHGTDY 330
           G    P LAK      + + +R     F+ E K DGER QLH +  G T++ +SR+G + 
Sbjct: 366 GIPLKPMLAKPTKAITEVL-DRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENM 423

Query: 331 TYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKD 390
           T  Y        I  FL    + +  +LD E V +D    K+LPF ++ +     ++ KD
Sbjct: 424 TERYPEID----IRDFLS-DPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKD 478

Query: 391 IDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQI 450
           +           FD+L  NG  LI+  L +R++ L  V  P        + +   +  ++
Sbjct: 479 V---KVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEEL 535

Query: 451 KKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGR-- 505
           +  LD ++    EG+++K      S Y P+ R  NW+K+K +YL   G+++DL V+G   
Sbjct: 536 QHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYY 595

Query: 506 DSGKKDCLICGILVTEEKQELSE 528
             GK+     G L+    Q+  E
Sbjct: 596 GRGKRTGTYGGFLLGCYNQDTGE 618

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 119/262 (45%), Gaps = 13/262 (4%)

Query: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYT 331
           G    P LAK      + +       F  E K DGER Q+H +  G +++ +SR+G + T
Sbjct: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407

Query: 332 YLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKDI 391
             Y        I+ F+         +LD E V +D     +LPF ++ +     +  +D+
Sbjct: 408 ERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463

Query: 392 DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQIK 451
                      FDIL  N   LI+  L +R+ +L  +L P    +++ S +      +++
Sbjct: 464 ---KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520

Query: 452 KGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIGR--D 506
             LD ++    EG+   VL    S Y P+ R  NW+K+K +YL+  G+++DL V+G    
Sbjct: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 580

Query: 507 SGKKDCLICGILVTEEKQELSE 528
            GK+     G L+    Q+  E
Sbjct: 581 RGKRTGTYGGFLLGCYNQDTGE 602

>TPHA0J00470 Chr10 (106019..107488) [1470 bp, 489 aa] {ON} Anc_6.38
           YMR004W
          Length = 489

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 9/90 (10%)

Query: 363 VTFDSTSKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGS-SLIDLPLFKR 421
           V F+   KK++     +S   S +NK   +  + +P+ +   IL +N + S+++  + K 
Sbjct: 281 VIFERQEKKIVQMAHERSILHSMINKLIDNTPNLYPIELDNTILDINNNLSMVNSNVKKT 340

Query: 422 --------KEFLNTVLTPYKDYVEILSSIR 443
                   KEF N+++  +K Y+EILSS++
Sbjct: 341 ISVYDEECKEFANSIIPTFKKYIEILSSLK 370

>Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON}
           complement(31451..34093) [2643 nt, 881 aa]
          Length = 880

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 732 DREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDC 791
           DR  +  LI+ +GG+ ++ + AK    S   I++SK  ++   L    Y V+N  W+ + 
Sbjct: 109 DRLKLHELIVIHGGKFLHFLSAKG---SATHIVASKLPLK-KKLEYANYKVVNPDWIMNS 164

Query: 792 LQAGVILP 799
           + AG +LP
Sbjct: 165 INAGKLLP 172

>NDAI0A05500 Chr1 complement(1242145..1242891) [747 bp, 248 aa] {ON}
           
          Length = 248

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 7/93 (7%)

Query: 315 NYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLP 374
           +Y ++ KFFSR      Y+YG D     + +FLR ++  K  +L+ +   + +T +++LP
Sbjct: 104 SYKDSGKFFSRSTGMEKYVYGED-PIKFVQQFLREYQ--KRNILENKPTIY-TTFRRLLP 159

Query: 375 FGLVKSSASSQLNKKDIDNDSFHPLFMVFDILY 407
             L    A+S   +   D D+    F++ D+L+
Sbjct: 160 AKLTVMCAASDAKE---DPDALIEQFVLTDVLW 189

>Skud_5.147 Chr5 complement(224655..226052) [1398 bp, 465 aa] {ON}
           YER038C (REAL)
          Length = 465

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 11/66 (16%)

Query: 284 MLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTI 343
           M++ +TIS++  + +FI E         HY    E +        D+++L+GN +  G +
Sbjct: 190 MVTKETISDKYKDWYFISE-------NCHY----EELMDLEMRDMDHSFLFGNGECQGNV 238

Query: 344 AKFLRL 349
            +FLRL
Sbjct: 239 PEFLRL 244

>KAFR0J01080 Chr10 (198475..199455) [981 bp, 326 aa] {ON} Anc_5.242
           YJL006C
          Length = 326

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 15/90 (16%)

Query: 98  DRRVYNIKDLTLIRAI---CSYLKLPKNSV------VERRLIRWKYKADRYETLATFCI- 147
           DRR+YN K LT+ + +   C+ L+LP+ ++       +R  +   ++ +   TLAT C+ 
Sbjct: 31  DRRIYNQKKLTVFKLLTDTCAQLRLPRKTLETALYYYQRYHLFNPFETELCYTLATSCLI 90

Query: 148 -----HEISKRKNEPQVTQVERISIDKLNE 172
                 E  K+ N+   T ++  +I KLN+
Sbjct: 91  LSCKQVETLKKVNDICTTSLKLRNITKLNQ 120

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 17/98 (17%)

Query: 705 RLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAK---TYTISKL 761
           +  S+LF  L  YI       +   R  R  +  +I+ NGG+ ++++ AK   T+ I+  
Sbjct: 104 KATSNLFKDLTVYI-------NGYTRPSRFQLHEMIVLNGGKFLHHLSAKRSVTHIIAS- 155

Query: 762 RILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILP 799
             L+ K  IE  +     Y V+   WL D ++   +LP
Sbjct: 156 -TLTLKKKIEFAN-----YKVVKPEWLVDSIKVKKLLP 187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,672,668
Number of extensions: 4834789
Number of successful extensions: 14123
Number of sequences better than 10.0: 64
Number of HSP's gapped: 14332
Number of HSP's successfully gapped: 65
Length of query: 972
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 853
Effective length of database: 39,836,145
Effective search space: 33980231685
Effective search space used: 33980231685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)