Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010305.705ON89894665e-62
Kpol_YGOB_1043.725.705ON88863182e-39
KAFR0H001905.705ON82813017e-37
TDEL0B021505.705ON91813001e-36
ZYRO0B16368g5.705ON85812922e-35
NCAS0A031805.705ON88872913e-35
TPHA0E002005.705ON85742894e-35
Smik_11.3595.705ON88872852e-34
YKR095W-A (PCC1)5.705ON88872826e-34
KLTH0E00990g5.705ON89792773e-33
Suva_11.3325.705ON111832761e-32
Skud_11.3355.705ON94932722e-32
Kwal_YGOB_Anc_5.7055.705ON88862713e-32
KNAG0C066205.705ON101882698e-32
KLLA0A00539g5.705ON87882643e-31
SAKL0E14982g5.705ON89862636e-31
NDAI0E050605.705ON86832523e-29
Ecym_40165.705ON125732266e-25
AFR289W5.705ON81802202e-24
CAGL0G02535g5.705ON140841702e-16
ZYRO0C13772g5.317ON33642586.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01030
         (89 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   184   5e-62
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   127   2e-39
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   120   7e-37
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   120   1e-36
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   117   2e-35
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   116   3e-35
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   115   4e-35
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   114   2e-34
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   113   6e-34
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   111   3e-33
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   110   1e-32
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   109   2e-32
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   108   3e-32
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   108   8e-32
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   106   3e-31
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   105   6e-31
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   101   3e-29
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    92   6e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    89   2e-24
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    70   2e-16
ZYRO0C13772g Chr3 (1084514..1085524) [1011 bp, 336 aa] {ON} weak...    27   6.4  

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  184 bits (466), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%)

Query: 1  MSKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQ 60
          MSKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQ
Sbjct: 1  MSKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQ 60

Query: 61 SIDDRVLRVGVSSVIDSVKTIIETFDELE 89
          SIDDRVLRVGVSSVIDSVKTIIETFDELE
Sbjct: 61 SIDDRVLRVGVSSVIDSVKTIIETFDELE 89

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  127 bits (318), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 72/86 (83%)

Query: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62
          K    ++M+HTL   IPF T++QA+IA QVL+PDPIL+PQDFQV Y+S  N L+M+F+SI
Sbjct: 2  KTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSI 61

Query: 63 DDRVLRVGVSSVIDSVKTIIETFDEL 88
          DDRVLRVGVSSVIDSVKTIIET DEL
Sbjct: 62 DDRVLRVGVSSVIDSVKTIIETMDEL 87

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  120 bits (301), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (82%)

Query: 8  MQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVL 67
          M ++HTL L IPF  +KQA+IA  VL+PDPILRPQDFQV Y ++ N  V EF+SIDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 68 RVGVSSVIDSVKTIIETFDEL 88
          RVGVS+VIDS+KTIIET DEL
Sbjct: 61 RVGVSNVIDSLKTIIETMDEL 81

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/81 (71%), Positives = 67/81 (82%)

Query: 8  MQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVL 67
          M + H+L L IPF T+ QA+IA QVL PDPIL+PQDFQV YT+  N LV+ FQSIDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 68 RVGVSSVIDSVKTIIETFDEL 88
          RVGVSSVIDS+KTI+ET DEL
Sbjct: 61 RVGVSSVIDSIKTIVETIDEL 81

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (83%)

Query: 9  QMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLR 68
           ++H L L IPF   + +++A +VLRPDPILRP+DFQV+Y SKGN L ++F+S+DDRVLR
Sbjct: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62

Query: 69 VGVSSVIDSVKTIIETFDELE 89
          VGVSSVIDSVKTI+ET DEL+
Sbjct: 63 VGVSSVIDSVKTIVETIDELD 83

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  116 bits (291), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%)

Query: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62
          K    M +++ L L IPF TS+QA IA +VL PDPIL+PQDFQV+Y S+ N L + F+ I
Sbjct: 2  KNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGI 61

Query: 63 DDRVLRVGVSSVIDSVKTIIETFDELE 89
          DDRVLRVGVSSVIDS+KTIIET DEL+
Sbjct: 62 DDRVLRVGVSSVIDSIKTIIETIDELD 88

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  115 bits (289), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/74 (72%), Positives = 67/74 (90%)

Query: 16 LNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRVGVSSVI 75
          LNIPF TSKQA IA QVL+PDP LRP++F+V Y+S+G++LV+ FQS+DDRVLRVGVS+VI
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 76 DSVKTIIETFDELE 89
          DS+KTIIET DEL+
Sbjct: 70 DSIKTIIETIDELQ 83

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (81%), Gaps = 2/87 (2%)

Query: 2  SKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQS 61
          SKR+  M + HTL L +PF T +QA IA +VL PDPIL+PQDFQ+ Y+S+ N ++++F+S
Sbjct: 3  SKRE--MPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 62 IDDRVLRVGVSSVIDSVKTIIETFDEL 88
          IDDRVLRVGVSSVIDS+KT++E  DEL
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDEL 87

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  113 bits (282), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (81%), Gaps = 2/87 (2%)

Query: 2  SKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQS 61
          SKR+ ++  +HTL L IPF T +QA IA +VL PDPIL+PQDFQV Y+S+ N ++++F+S
Sbjct: 3  SKREKSL--DHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 62 IDDRVLRVGVSSVIDSVKTIIETFDEL 88
          IDDRVLRVGVSS+IDS+KTI+E  D L
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVL 87

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  111 bits (277), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 65/79 (82%)

Query: 10 MEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRV 69
          + +TL L +PF T+KQA+ A +VL+PDPIL+PQDF V+Y+SK + L + F+ +DDRVLRV
Sbjct: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRV 68

Query: 70 GVSSVIDSVKTIIETFDEL 88
          GVSSVI+S+KTIIET DE 
Sbjct: 69 GVSSVIESIKTIIETIDEF 87

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  110 bits (276), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%)

Query: 6   NNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDR 65
           N    ++T  L IPF T KQA+IA +VL PDPIL+PQDFQ  Y+S+ N ++  F+SIDDR
Sbjct: 28  NYGMFQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDR 87

Query: 66  VLRVGVSSVIDSVKTIIETFDEL 88
           VLRVGVSSVIDS+KTIIET DEL
Sbjct: 88  VLRVGVSSVIDSIKTIIETMDEL 110

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 8/93 (8%)

Query: 2  SKRDNNMQMEHTLT------LNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNEL 55
          SKR+  M +++TL       L IPF T  QA IA +VL PDPIL+PQDFQV Y+S+ N +
Sbjct: 3  SKRE--MSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 56 VMEFQSIDDRVLRVGVSSVIDSVKTIIETFDEL 88
          ++ F+SIDDRVLRVGVSSVIDS+KTI+ET DEL
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%)

Query: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62
          K    + + +TL L +PF   KQA  A QVL+PDPIL+PQDF V+YTS  N L + F+ +
Sbjct: 2  KSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGV 61

Query: 63 DDRVLRVGVSSVIDSVKTIIETFDEL 88
          DDRVLRVGVSSVI+S+KTI+ET DE 
Sbjct: 62 DDRVLRVGVSSVIESIKTIVETIDEF 87

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  108 bits (269), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (73%)

Query: 2  SKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQS 61
          +K      ++HTLTLN+PF T +QA IA QVL+PDPIL+PQDF V Y ++G  L   F  
Sbjct: 3  TKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCG 62

Query: 62 IDDRVLRVGVSSVIDSVKTIIETFDELE 89
           D RVLRVGVSSVIDS+KTIIE+ DEL+
Sbjct: 63 RDARVLRVGVSSVIDSLKTIIESLDELD 90

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  106 bits (264), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/88 (55%), Positives = 72/88 (81%), Gaps = 2/88 (2%)

Query: 1  MSKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQ 60
          M+K D +   EH+L L IPF + KQAD+A +VL PDPI++P+DFQV Y+++  +L+ +F+
Sbjct: 1  MNKGDTSF--EHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFE 58

Query: 61 SIDDRVLRVGVSSVIDSVKTIIETFDEL 88
          S+D+R+LRVGV+SVI+S+KTI+ET DEL
Sbjct: 59 SVDERILRVGVNSVIESIKTIVETIDEL 86

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  105 bits (263), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%)

Query: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62
          K    M ++H L L IP  T  QA IA + L+PDP+L+P+DFQV+Y++   +L + F+SI
Sbjct: 2  KNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSI 61

Query: 63 DDRVLRVGVSSVIDSVKTIIETFDEL 88
          DDRVLRVGVSSVI+SVKTIIET DE 
Sbjct: 62 DDRVLRVGVSSVIESVKTIIETMDEF 87

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  101 bits (252), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 4/83 (4%)

Query: 10 MEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKY----TSKGNELVMEFQSIDDR 65
          +++TL + IPF   + A IA QVL PDPIL+P+DFQV+Y    T   N L+++FQSID+R
Sbjct: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63

Query: 66 VLRVGVSSVIDSVKTIIETFDEL 88
          VLRVGVSSV+DS+KTI+ET DEL
Sbjct: 64 VLRVGVSSVLDSIKTILETMDEL 86

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 91.7 bits (226), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 56/73 (76%)

Query: 16  LNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRVGVSSVI 75
           L +PF   KQA+IA +VL  DP+LRP+DF+V YT +  +L++ F SID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 76  DSVKTIIETFDEL 88
           +S+KT++ET DE 
Sbjct: 111 ESIKTVVETMDEF 123

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 89.4 bits (220), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 59/80 (73%)

Query: 10 MEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRV 69
          M+HTL L++PF +++ ADIA + L PDP+LRP++  V + S G  L ++  +ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 70 GVSSVIDSVKTIIETFDELE 89
            +S+ +++KT++ET DEL+
Sbjct: 61 ATNSIFEALKTVVETADELD 80

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 70.1 bits (170), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (61%), Gaps = 17/84 (20%)

Query: 1  MSKRDNNMQMEHTLTL----------------NIPFATSKQADIACQVLRPDPILRPQDF 44
          MSK +N   + HT TL                ++PF T++ A IA +VL+PDPILRP+DF
Sbjct: 1  MSK-NNTRDLSHTFTLTCITFLICTGYIYRDLHVPFETARDALIAQRVLQPDPILRPEDF 59

Query: 45 QVKYTSKGNELVMEFQSIDDRVLR 68
          QV+Y +K   L + F++IDDRVLR
Sbjct: 60 QVEYEAKATVLDIHFKAIDDRVLR 83

>ZYRO0C13772g Chr3 (1084514..1085524) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P38768 Saccharomyces cerevisiae
           YHR034C PIH1 Protein of unresolved function may function
           in protein folding and/or rRNA processing interacts with
           a chaperone (Hsp82p) two chromatin remodeling factors
           (Rvb1p Rvb2p) and two rRNA processing factors (Rrp43p
           Nop58p)
          Length = 336

 Score = 26.9 bits (58), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 43  DFQVKYTSKGNELVME---FQSIDDRVLRVGVSSVIDSVKTI 81
           D+ V Y +K NELV++    +   ++ L + + ++ DS  T+
Sbjct: 276 DYDVTYDAKNNELVVKNNNLEKFKEKTLNIPLPNIFDSPGTV 317

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,997,896
Number of extensions: 302797
Number of successful extensions: 807
Number of sequences better than 10.0: 24
Number of HSP's gapped: 806
Number of HSP's successfully gapped: 24
Length of query: 89
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 29
Effective length of database: 46,601,439
Effective search space: 1351441731
Effective search space used: 1351441731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)