Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010205.703ON59459429190.0
Kpol_1043.715.703ON58558912581e-167
YIL150C (MCM10)5.703ON57158012411e-164
TDEL0B021705.703ON56757912401e-164
KAFR0D022105.703ON58460112361e-163
Suva_9.385.703ON56958512341e-163
Smik_9.195.703ON57258412271e-162
Skud_9.185.703ON57157712251e-162
NCAS0G002205.703ON59258512251e-161
NDAI0F002805.703ON61060712031e-158
TPHA0E002105.703ON54453711841e-156
ZYRO0G06578g5.703ON56958011601e-152
KLTH0E01034g5.703ON58358411261e-147
CAGL0H06589g5.703ON58359311231e-146
KNAG0L021505.703ON61660911151e-145
SAKL0E14938g5.703ON57458910371e-133
Kwal_55.196915.703ON4664519881e-128
AFR287W5.703ON6115158511e-105
KLLA0A00572g5.703ON5775907672e-93
SAKL0B09504g7.102ON6571521010.002
NDAI0F008605.624ON42981920.016
KNAG0A033608.604ON756128920.019
TBLA0C023403.425ON1116195920.020
TBLA0B031408.824ON1233120900.036
TBLA0H033908.507ON643196880.055
KAFR0L006307.137ON254118850.077
TBLA0E007407.8ON698166860.097
Kpol_1027.182.106ON263145840.11
Kwal_26.93864.238ON1215160860.11
KAFR0G032004.238ON1869152860.11
Smik_4.3768.297ON29694840.12
TBLA0A104705.267ON1999136850.15
TPHA0B008304.238ON2536184850.15
Kpol_534.193.393ON498156840.15
NDAI0D027502.479ON1515147840.19
ZYRO0G07898g4.18ON498160830.20
TBLA0A037605.432ON504181830.20
SAKL0H20944g4.78ON541124830.21
TBLA0A076207.366ON631109830.22
Suva_2.2708.262ON63285830.22
Ecym_60396.372ON1038125820.31
KLLA0A03905g7.68ON1550171820.32
TBLA0E042408.238ON2156171820.33
NCAS0B066302.215ON16195770.43
Ecym_60406.371ON896113800.52
TPHA0C023108.401ON964118800.53
Smik_8.2425.88ON1168140800.54
KAFR0D005301.55ON739183790.67
Ecym_55145.414ON854161790.68
ZYRO0B00484g4.46ON919203790.69
TBLA0B075405.123ON1005232790.70
TPHA0F015902.191ON162551790.74
NCAS0A067605.267ON1876114790.74
NDAI0B013502.596ON687197780.86
KAFR0C047806.371ON786179780.89
YNL102W (POL1)2.176ON1468160780.96
TPHA0A024703.393ON53085771.1
NDAI0A062603.37ON532128771.1
TPHA0C013607.204ON536121771.1
TBLA0J015607.191ON714179771.1
TPHA0C036802.346ON913188771.2
NCAS0B064302.253ON146875771.3
CAGL0M10109g2.494ON463127761.4
KAFR0A035301.284ON595141761.5
TDEL0D005204.364ON665151761.5
CAGL0J11660g6.32ON744100761.5
Kpol_479.38.604ON795143761.5
Smik_15.3828.604ON829202761.5
KAFR0E040105.414ON905183761.6
Kwal_33.135261.110ON1298121761.6
TPHA0M002706.21ON377298751.7
SAKL0G17248g4.318ON159098761.7
Kpol_431.72.482ON253139741.7
AFL125W6.244ON545169751.9
TBLA0D041707.227ON284199741.9
TBLA0A084904.26ON88171752.1
NDAI0F022306.175ON899125752.1
KLTH0H09438g4.46ON92777752.1
TPHA0J007208.259ON1393197752.2
Kpol_2000.661.82ON1930125752.2
TPHA0D038406.326ON189116722.4
TBLA0B060502.303ON762112742.6
KLTH0A03652g7.214ON77288742.6
Skud_15.3628.604ON829171742.7
TPHA0O019302.16ON1081125742.8
Smik_13.3956.278ON1443143742.8
YMR162C (DNF3)2.349ON1656148742.9
TPHA0A029301.203ON413196733.0
YNL248C (RPA49)1.112ON41587733.0
CAGL0K01419g3.147ON42085733.0
SAKL0A00352g6.378ON490101733.1
TBLA0G009305.528ON608109733.3
YGR275W (RTT102)5.24ON15770703.3
TBLA0E018405.719ON297180723.4
YLR451W (LEU3)7.512ON886115733.5
TDEL0G011205.88ON1009171733.6
NDAI0B053001.90ON1235147733.7
ZYRO0G15554g8.765ON1333126733.7
TPHA0E021705.288ON35958723.7
Kpol_1023.625.587ON1507123733.7
Skud_9.195.702ON1680185733.8
AER150W4.342ON41888724.0
TBLA0H007208.416ON618103724.4
KLLA0F23848g2.159ON649123724.4
Kpol_359.33.450ON28895714.4
ZYRO0B04290g3.479ON731140724.5
KLLA0C10879g5.296ON755155724.5
TPHA0D046805.713ON761265724.6
KAFR0F030204.46ON824198724.6
Kwal_33.151845.215ON953151724.7
TBLA0B050706.201ON95983724.7
Suva_6.1047.186ON1170220724.8
ZYRO0D05214g7.74ON1526143724.9
Skud_15.465singletonOFF44567715.3
CAGL0K03949g2.396ON505100715.5
KNAG0G031908.787ON523112715.6
TBLA0B098202.51ON550121715.6
KAFR0B016005.54ON610114715.8
TBLA0H013208.304ON692225715.9
NDAI0I012206.188ON700215715.9
YPR141C (KAR3)3.479ON729135715.9
TPHA0L002404.364ON732158716.0
TPHA0A019708.232ON734146716.0
Ecym_41778.390ON735136716.0
KLLA0E06073g7.460ON778133716.0
Skud_16.886.193ON788102716.0
TBLA0J007205.603ON814153716.1
NCAS0A134107.227ON311141706.1
TPHA0C029602.215ON161101686.2
ZYRO0G20438g2.421ON33089706.3
NDAI0J028204.341aON128341716.4
KAFR0D037601.110ON1301118716.4
CAGL0M00924g4.315ON1303103716.4
TBLA0B032808.844ON1362195716.4
Suva_6.2861.127ON2014103716.6
KLTH0D17006gsingletonON289277716.7
KAFR0C011103.149ON44871707.0
TDEL0B055501.447ON24585697.0
NDAI0A049703.393ON46882707.1
TDEL0C010008.72ON566107707.5
Kwal_55.21164singletonOFF588218707.5
CAGL0E00737g8.372ON274132697.6
KAFR0E043404.364ON616142707.6
TPHA0E014105.302ON621203707.6
Kwal_YGOB_55.211643.479ON657218707.7
NDAI0B056405.430ON66996707.7
Skud_4.3918.297ON29045697.8
KAFR0G034906.150ON75070707.9
CAGL0F08635g4.138ON75798707.9
CAGL0K01617g3.162ON774151707.9
CAGL0F07667g2.346ON79249707.9
KLLA0E14191g8.94ON860144708.0
Suva_8.1662.162ON948277708.1
TBLA0C003908.14ON1077130708.2
TPHA0A018808.248ON1080218708.2
Suva_2.6871.52ON1128166708.3
Suva_14.921.110ON1312142708.4
NDAI0D033404.369ON338156698.4
CAGL0L12188g8.259ON1398105708.4
TBLA0B018102.199ON1504119708.5
Smik_8.2401.96ON347106698.5
SAKL0B10274g7.68ON1554132708.5
Ecym_83978.138ON355205698.6
CAGL0D00924g4.238ON1980147708.6
TDEL0A059908.653ON22977688.9
KAFR0B058208.337ON13763669.0
CAGL0A01606g4.81ON24069689.2
Kwal_26.87278.659ON445137699.2
NCAS0D011602.385ON263171689.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TBLA0G01020
         (1785 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...  1129   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   489   e-167
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   482   e-164
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   482   e-164
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   480   e-163
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   479   e-163
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   477   e-162
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   476   e-162
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   476   e-161
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   468   e-158
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   460   e-156
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   451   e-152
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   438   e-147
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   437   e-146
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   434   e-145
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   404   e-133
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   385   e-128
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   332   e-105
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   300   2e-93
SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {...    44   0.002
NDAI0F00860 Chr6 (210078..211367) [1290 bp, 429 aa] {ON}               40   0.016
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    40   0.019
TBLA0C02340 Chr3 complement(554335..557685) [3351 bp, 1116 aa] {...    40   0.020
TBLA0B03140 Chr2 (732288..735989) [3702 bp, 1233 aa] {ON} Anc_8....    39   0.036
TBLA0H03390 Chr8 complement(830774..832705) [1932 bp, 643 aa] {O...    39   0.055
KAFR0L00630 Chr12 complement(119132..119896) [765 bp, 254 aa] {O...    37   0.077
TBLA0E00740 Chr5 complement(152407..154503) [2097 bp, 698 aa] {O...    38   0.097
Kpol_1027.18 s1027 (42160..42951) [792 bp, 263 aa] {ON} (42160.....    37   0.11 
Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]...    38   0.11 
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    38   0.11 
Smik_4.376 Chr4 complement(676941..677828) [888 bp, 296 aa] {ON}...    37   0.12 
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    37   0.15 
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    37   0.15 
Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..4...    37   0.15 
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    37   0.19 
ZYRO0G07898g Chr7 complement(637442..638938) [1497 bp, 498 aa] {...    37   0.20 
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...    37   0.20 
SAKL0H20944g Chr8 (1828722..1830347) [1626 bp, 541 aa] {ON} simi...    37   0.21 
TBLA0A07620 Chr1 complement(1890451..1892346) [1896 bp, 631 aa] ...    37   0.22 
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...    37   0.22 
Ecym_6039 Chr6 (74519..77635) [3117 bp, 1038 aa] {ON} similar to...    36   0.31 
KLLA0A03905g Chr1 complement(345818..350470) [4653 bp, 1550 aa] ...    36   0.32 
TBLA0E04240 Chr5 complement(1074492..1080962) [6471 bp, 2156 aa]...    36   0.33 
NCAS0B06630 Chr2 (1257281..1257766) [486 bp, 161 aa] {ON} Anc_2....    34   0.43 
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    35   0.52 
TPHA0C02310 Chr3 (521123..524017) [2895 bp, 964 aa] {ON} Anc_8.4...    35   0.53 
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    35   0.54 
KAFR0D00530 Chr4 (86030..88249) [2220 bp, 739 aa] {ON} Anc_1.55 ...    35   0.67 
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    35   0.68 
ZYRO0B00484g Chr2 complement(28527..31286) [2760 bp, 919 aa] {ON...    35   0.69 
TBLA0B07540 Chr2 complement(1792231..1795248) [3018 bp, 1005 aa]...    35   0.70 
TPHA0F01590 Chr6 complement(365642..370519) [4878 bp, 1625 aa] {...    35   0.74 
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    35   0.74 
NDAI0B01350 Chr2 (312621..314684) [2064 bp, 687 aa] {ON} Anc_2.596     35   0.86 
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    35   0.89 
YNL102W Chr14 (430087..434493) [4407 bp, 1468 aa] {ON}  POL1Cata...    35   0.96 
TPHA0A02470 Chr1 (528174..529766) [1593 bp, 530 aa] {ON} Anc_3.3...    34   1.1  
NDAI0A06260 Chr1 complement(1419611..1421209) [1599 bp, 532 aa] ...    34   1.1  
TPHA0C01360 Chr3 (309327..310937) [1611 bp, 536 aa] {ON} Anc_7.2...    34   1.1  
TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7....    34   1.1  
TPHA0C03680 Chr3 (801572..804313) [2742 bp, 913 aa] {ON} Anc_2.3...    34   1.2  
NCAS0B06430 Chr2 (1214203..1218609) [4407 bp, 1468 aa] {ON} Anc_...    34   1.3  
CAGL0M10109g Chr13 (1006975..1008366) [1392 bp, 463 aa] {ON} sim...    34   1.4  
KAFR0A03530 Chr1 (723286..725073) [1788 bp, 595 aa] {ON} Anc_1.2...    34   1.5  
TDEL0D00520 Chr4 (94918..96915) [1998 bp, 665 aa] {ON} Anc_4.364...    34   1.5  
CAGL0J11660g Chr10 (1135618..1137852) [2235 bp, 744 aa] {ON} hig...    34   1.5  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    34   1.5  
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    34   1.5  
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    34   1.6  
Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL25...    34   1.6  
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    33   1.7  
SAKL0G17248g Chr7 (1492432..1497204) [4773 bp, 1590 aa] {ON} sim...    34   1.7  
Kpol_431.7 s431 (17811..18572) [762 bp, 253 aa] {ON} (17811..185...    33   1.7  
AFL125W Chr6 (199903..201540) [1638 bp, 545 aa] {ON} Syntenic ho...    33   1.9  
TBLA0D04170 Chr4 complement(1032961..1033815) [855 bp, 284 aa] {...    33   1.9  
TBLA0A08490 Chr1 complement(2085721..2088366) [2646 bp, 881 aa] ...    33   2.1  
NDAI0F02230 Chr6 (539524..542223) [2700 bp, 899 aa] {ON} Anc_6.1...    33   2.1  
KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} simila...    33   2.1  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    33   2.2  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...    33   2.2  
TPHA0D03840 Chr4 (805962..806531) [570 bp, 189 aa] {ON} Anc_6.32...    32   2.4  
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    33   2.6  
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    33   2.6  
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    33   2.7  
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    33   2.8  
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    33   2.8  
YMR162C Chr13 complement(578951..583921) [4971 bp, 1656 aa] {ON}...    33   2.9  
TPHA0A02930 Chr1 complement(635681..636922) [1242 bp, 413 aa] {O...    33   3.0  
YNL248C Chr14 complement(181361..182608) [1248 bp, 415 aa] {ON} ...    33   3.0  
CAGL0K01419g Chr11 complement(125052..126314) [1263 bp, 420 aa] ...    33   3.0  
SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON...    33   3.1  
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    33   3.3  
YGR275W Chr7 (1043276..1043749) [474 bp, 157 aa] {ON}  RTT102Com...    32   3.3  
TBLA0E01840 Chr5 complement(448479..449372) [894 bp, 297 aa] {ON...    32   3.4  
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    33   3.5  
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    33   3.6  
NDAI0B05300 Chr2 (1294623..1298330) [3708 bp, 1235 aa] {ON} Anc_...    33   3.7  
ZYRO0G15554g Chr7 complement(1262430..1266431) [4002 bp, 1333 aa...    33   3.7  
TPHA0E02170 Chr5 complement(450763..451842) [1080 bp, 359 aa] {O...    32   3.7  
Kpol_1023.62 s1023 complement(138899..143422) [4524 bp, 1507 aa]...    33   3.7  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    33   3.8  
AER150W Chr5 (920133..921389) [1257 bp, 418 aa] {ON} Syntenic ho...    32   4.0  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    32   4.4  
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    32   4.4  
Kpol_359.3 s359 (3084..3950) [867 bp, 288 aa] {ON} (3084..3950) ...    32   4.4  
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    32   4.5  
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    32   4.5  
TPHA0D04680 Chr4 (1021296..1023581) [2286 bp, 761 aa] {ON} Anc_5...    32   4.6  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    32   4.6  
Kwal_33.15184 s33 (1001372..1004233) [2862 bp, 953 aa] {ON} YLL0...    32   4.7  
TBLA0B05070 Chr2 (1194738..1197617) [2880 bp, 959 aa] {ON} Anc_6...    32   4.7  
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    32   4.8  
ZYRO0D05214g Chr4 complement(440628..445208) [4581 bp, 1526 aa] ...    32   4.9  
Skud_15.465 Chr15 (815231..815260,815264..815308,815312..815461,...    32   5.3  
CAGL0K03949g Chr11 complement(365526..367043) [1518 bp, 505 aa] ...    32   5.5  
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...    32   5.6  
TBLA0B09820 Chr2 complement(2339120..2340772) [1653 bp, 550 aa] ...    32   5.6  
KAFR0B01600 Chr2 complement(305501..307333) [1833 bp, 610 aa] {O...    32   5.8  
TBLA0H01320 Chr8 complement(294634..296712) [2079 bp, 692 aa] {O...    32   5.9  
NDAI0I01220 Chr9 complement(293892..295994) [2103 bp, 700 aa] {O...    32   5.9  
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...    32   5.9  
TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.36...    32   6.0  
TPHA0A01970 Chr1 complement(395716..397920) [2205 bp, 734 aa] {O...    32   6.0  
Ecym_4177 Chr4 (372606..374813) [2208 bp, 735 aa] {ON} similar t...    32   6.0  
KLLA0E06073g Chr5 complement(549775..552111) [2337 bp, 778 aa] {...    32   6.0  
Skud_16.88 Chr16 complement(158550..160916) [2367 bp, 788 aa] {O...    32   6.0  
TBLA0J00720 Chr10 (167109..169553) [2445 bp, 814 aa] {ON} Anc_5....    32   6.1  
NCAS0A13410 Chr1 (2638271..2639206) [936 bp, 311 aa] {ON} Anc_7....    32   6.1  
TPHA0C02960 Chr3 complement(647899..648384) [486 bp, 161 aa] {ON...    31   6.2  
ZYRO0G20438g Chr7 complement(1684028..1685020) [993 bp, 330 aa] ...    32   6.3  
NDAI0J02820 Chr10 (698768..702619) [3852 bp, 1283 aa] {ON}             32   6.4  
KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {...    32   6.4  
CAGL0M00924g Chr13 (102735..106646) [3912 bp, 1303 aa] {ON} simi...    32   6.4  
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...    32   6.4  
Suva_6.286 Chr6 (502176..508220) [6045 bp, 2014 aa] {ON} YJL207C...    32   6.6  
KLTH0D17006g Chr4 complement(1403707..1412385) [8679 bp, 2892 aa...    32   6.7  
KAFR0C01110 Chr3 complement(225557..226903) [1347 bp, 448 aa] {O...    32   7.0  
TDEL0B05550 Chr2 (985068..985805) [738 bp, 245 aa] {ON} Anc_1.44...    31   7.0  
NDAI0A04970 Chr1 (1131663..1133069) [1407 bp, 468 aa] {ON} Anc_3...    32   7.1  
TDEL0C01000 Chr3 (167919..169619) [1701 bp, 566 aa] {ON} Anc_8.7...    32   7.5  
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    32   7.5  
CAGL0E00737g Chr5 complement(66978..67802) [825 bp, 274 aa] {ON}...    31   7.6  
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    32   7.6  
TPHA0E01410 Chr5 (285375..287240) [1866 bp, 621 aa] {ON} Anc_5.3...    32   7.6  
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    32   7.7  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...    32   7.7  
Skud_4.391 Chr4 complement(687561..688433) [873 bp, 290 aa] {ON}...    31   7.8  
KAFR0G03490 Chr7 complement(720975..723227) [2253 bp, 750 aa] {O...    32   7.9  
CAGL0F08635g Chr6 (857724..859997) [2274 bp, 757 aa] {ON} simila...    32   7.9  
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    32   7.9  
CAGL0F07667g Chr6 complement(744275..746653) [2379 bp, 792 aa] {...    32   7.9  
KLLA0E14191g Chr5 complement(1254213..1256795) [2583 bp, 860 aa]...    32   8.0  
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    32   8.1  
TBLA0C00390 Chr3 complement(67095..70328) [3234 bp, 1077 aa] {ON...    32   8.2  
TPHA0A01880 Chr1 (379362..382604) [3243 bp, 1080 aa] {ON} Anc_8....    32   8.2  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    32   8.3  
Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250...    32   8.4  
NDAI0D03340 Chr4 complement(790702..791718) [1017 bp, 338 aa] {O...    31   8.4  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...    32   8.4  
TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {...    32   8.5  
Smik_8.240 Chr8 complement(388293..389333) [1041 bp, 347 aa] {ON...    31   8.5  
SAKL0B10274g Chr2 (881660..886324) [4665 bp, 1554 aa] {ON} unipr...    32   8.5  
Ecym_8397 Chr8 (818932..819999) [1068 bp, 355 aa] {ON} similar t...    31   8.6  
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    32   8.6  
TDEL0A05990 Chr1 (1051012..1051701) [690 bp, 229 aa] {ON} Anc_8....    31   8.9  
KAFR0B05820 Chr2 (1203344..1203757) [414 bp, 137 aa] {ON} Anc_8....    30   9.0  
CAGL0A01606g Chr1 complement(159192..159914) [723 bp, 240 aa] {O...    31   9.2  
Kwal_26.8727 s26 (916132..917469) [1338 bp, 445 aa] {ON} YPL146C...    31   9.2  
NCAS0D01160 Chr4 complement(213074..213865) [792 bp, 263 aa] {ON...    31   9.8  

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
            YIL150C
          Length = 594

 Score = 1129 bits (2919), Expect = 0.0
 Identities = 566/594 (95%), Positives = 566/594 (95%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            MNDPREVFENDLFDNISP                RQKRDLQERLEYKRKVSRAVDPNFIS
Sbjct: 1    MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
            TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP
Sbjct: 61   TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
            AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL
Sbjct: 121  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS
Sbjct: 181  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 900
            SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI
Sbjct: 241  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN
Sbjct: 301  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 1260
            AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN
Sbjct: 361  AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 420

Query: 1261 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 1440
            FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG
Sbjct: 421  FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 480

Query: 1441 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 1620
            KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL
Sbjct: 481  KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 540

Query: 1621 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRXXXXXXXXXXXXEIV 1782
            HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNR            EIV
Sbjct: 541  HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
            (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  489 bits (1258), Expect = e-167
 Identities = 258/589 (43%), Positives = 366/589 (62%), Gaps = 12/589 (2%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            MNDPRE  + DL+ N+S                 RQK+DL ERL+ K++    +DPNF+ 
Sbjct: 1    MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNFV- 59

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
                         QVP SP+K +    +  + P+       ++NPNE+ L  + +     
Sbjct: 60   -------------QVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNY-- 104

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
             G+T+YFM  F +SKK   +K+  Y ++MS+RVH+F   T  +KE +  +V+E ++YS L
Sbjct: 105  -GTTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSG-TGSKKEFKPTDVDELDQYSNL 162

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            W+  RY+  + ++ +L DIKILRL KLFAK+RPPKF  PQYSNWV  G+IT K   K TS
Sbjct: 163  WLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTS 222

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG-- 894
            S+ P KYFKFTI DFQ N+ +F+F  + + KYYNLRVGD++ ILNP I PWRPSE +G  
Sbjct: 223  SSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGS 282

Query: 895  --YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRET 1068
               IKSFNL I  K+DCI+EIG SRDLGWC +P  SK    C TPINK+K+  C++HRE 
Sbjct: 283  GSTIKSFNLRISHKFDCILEIGASRDLGWCPIPNASK-NTLCKTPINKSKEDKCQYHREI 341

Query: 1069 EFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK--TNNIYSKNQFNVVRRRNARKEGDS 1242
            +FR   + R+EL+G++ALGAPTK D  P+LY+ +  +NN   +  +N+V   + +K  DS
Sbjct: 342  QFRKTTSNRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDS 401

Query: 1243 ---KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKE 1413
               +    +F + N AKAFF+++FQNPDI++NLDSKRRK+KD+K +  L+K L  T+ KE
Sbjct: 402  NKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKE 461

Query: 1414 DNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDP---SY 1584
               SKN         K ++N T+  +Q G+L+ +G+DPT GK+  +++ SN +      Y
Sbjct: 462  ---SKNF--------KNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKY 510

Query: 1585 TSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKS 1731
               +  A++DL+ F+KD VNLKP K DL+ ++  R   W + FG Q  S
Sbjct: 511  QMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSS 559

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
            MCM10Essential chromatin-associated protein involved in
            the initiation of DNA replication; required for the
            association of the MCM2-7 complex with replication
            origins
          Length = 571

 Score =  482 bits (1241), Expect = e-164
 Identities = 250/580 (43%), Positives = 368/580 (63%), Gaps = 6/580 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            MNDPRE+   D ++NI+                 R+++ L ERL+ K++  +  DPNF  
Sbjct: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNF-- 58

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
                        I+VP SP K + K     AT    K  G   N NE++L    +    P
Sbjct: 59   ----------EAIEVPQSPTKNRVKVGSHNATQQGTKFEG--SNINEVRLSQLQQQPKPP 106

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
            A +T YFM  F ++KK E ++I  +E++M+ARVH+F   T+ +K   II   E E +S L
Sbjct: 107  ASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFS--TDEKKYVPIIT-NELESFSNL 163

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P+Y+NW  VG+I+ KS  K TS
Sbjct: 164  WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 223

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 900
            S  P K+F FTI DFQ  + +++F ++ + +YYNLR+GD+I ILNP + PWRPS    +I
Sbjct: 224  SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 283

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            KSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN +  KCC++HRE +FR 
Sbjct: 284  KSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKKCGSPINISLHKCCDYHREVQFRG 342

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVV---RRRNARKEGDSKLH 1251
             +AKRIELNG +ALGAPTK D+ PSLYK K      +N FN++   R+R + +E   K  
Sbjct: 343  TSAKRIELNGGYALGAPTKVDSQPSLYKAK-----GENGFNIIKGTRKRLSEEEERLKKS 397

Query: 1252 NSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 1431
            + NF ++N AKAFF+++FQNPD+++NLD+KRRK+ + K+ + L +EL K + + +  S  
Sbjct: 398  SHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRE--SSG 455

Query: 1432 LEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSN 1602
            LE KS  + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S +G +P  +    +  
Sbjct: 456  LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 515

Query: 1603 AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQ 1722
             +NDLLH+KK+KV L P K++   K+  R+E+W ++FG +
Sbjct: 516  VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK 555

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
            Anc_5.703 YIL150C
          Length = 567

 Score =  482 bits (1240), Expect = e-164
 Identities = 258/579 (44%), Positives = 368/579 (63%), Gaps = 4/579 (0%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            MNDPREV + D F  ++                 RQKRDL ERL+ KR++ ++ DPNF  
Sbjct: 1    MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQL-KSKDPNF-- 57

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
                        IQV  SP  +K+    +   P   K     +N NE K++++   + +P
Sbjct: 58   ----------DAIQVESSP--VKKPAESIKVEPSRTKRVLDIENLNEKKVESR---SQIP 102

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
            A +T+YF++NF +SKK E +  Q+ + L+S RVH+F       K  + + VEE E+YS L
Sbjct: 103  ANTTSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHK-FKAVAVEEVEEYSDL 161

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            W+ +RY+ ++ + ++L ++KILRL+KLFAKI+PPKF  PQYSNW  +G+I+ K   K +S
Sbjct: 162  WVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSS 221

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 900
            S  P KYFKFT+ DFQ N+ ++VF ++ + +YYNLRVGDI+ ILNP + PWRPSE+  +I
Sbjct: 222  SGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFI 281

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            KSFNL I   + CI+EIG+SRD+ WC    KS+  K CGTPINKTK+KCC+FHRE +FR+
Sbjct: 282  KSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQ-NKACGTPINKTKEKCCDFHREIQFRS 340

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEG-DSKLHNS 1257
              AKRIELNGSFALGAPTK D+ P+LY++K+   +    F V+     +  G +S L   
Sbjct: 341  NHAKRIELNGSFALGAPTKVDSGPALYREKSAGAH--RNFKVLPNHYQKSVGKNSDLRGI 398

Query: 1258 NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLE 1437
            +F + N AKAFFNDEFQNPDI++NLDSKRRK +D K+   L ++L +  ++   +     
Sbjct: 399  HFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIEKG 458

Query: 1438 GKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS---YTSNRSNAV 1608
             K  E++ E    TE  +Q G+++N+G+DPTHG++  ++K++  KD S     + +   V
Sbjct: 459  SKKYEEICE---TTEATLQSGLIQNLGFDPTHGEIGNVLKQA-AKDKSNNGQLNKKQKEV 514

Query: 1609 NDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQS 1725
            + LL FKK+ V LKP K  LL +KR R+  W E FGD+S
Sbjct: 515  SSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKS 553

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
            Anc_5.703 YIL150C
          Length = 584

 Score =  480 bits (1236), Expect = e-163
 Identities = 258/601 (42%), Positives = 371/601 (61%), Gaps = 23/601 (3%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            M+DPRE+  NDL+ NI+P                  KRDL ERL  K+      DPNF  
Sbjct: 1    MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTK-KNTG----IQDNPNELKLKNQIE 345
                        +QVP SP  +K+   QL      K KN        +NPNEL L+ + +
Sbjct: 61   ------------VQVPASP--VKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQ 106

Query: 346  PASVPAG----STAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINV 513
              +        ST YFM  F  +K+ E   I+ +E++M +RVH+F N    + E Q + V
Sbjct: 107  KQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTF-NGIEPKNEYQHVIV 165

Query: 514  EEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVIT 693
            +E E+YS LWI++RY     +  +L ++KILRLNKLFAK+RPPKFE PQYSNWV VG+++
Sbjct: 166  DELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVS 225

Query: 694  EKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPW 873
            +KS  K T+SN P+KY KFT+ DF+  +  ++F +E + +YYNLR+GDII +LNP I PW
Sbjct: 226  DKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPW 285

Query: 874  RPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCE 1053
            RPS +  YIKSFNL I   Y CI+EIGKSRDL  C + V+S   K CG PINK  D+CCE
Sbjct: 286  RPSGKQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRST-SKECGVPINKKVDRCCE 344

Query: 1054 FHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKT-NNI----------YSKNQF 1200
            +HRE E R   +KR++L+G +ALGAPTK ++ P+LY+  T  N+          YS+N  
Sbjct: 345  YHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNP 404

Query: 1201 NVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSEL 1380
            +++ +   +        +  F + N AKAFF+DEFQNPD+ISNLD+KRRK+ + ++ + L
Sbjct: 405  HLIDKYGEK--------SKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVL 456

Query: 1381 IKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMK- 1557
             +EL++ L K+    ++LEGK++E+V++M+  T+  +Q G+ + +G+DPT GK+  ++K 
Sbjct: 457  NRELDRLLRKD----QDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKN 512

Query: 1558 --KSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKS 1731
              +S   +P + S +   V+DL+ FKK+ + L P K DLL KK KR+++W E FG Q+KS
Sbjct: 513  KERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFG-QNKS 571

Query: 1732 N 1734
            N
Sbjct: 572  N 572

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
            YIL150C (REAL)
          Length = 569

 Score =  479 bits (1234), Expect = e-163
 Identities = 253/585 (43%), Positives = 364/585 (62%), Gaps = 11/585 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            M+DPRE+   D ++N++                 R+K+ L ERL+ K+   +  DPNF  
Sbjct: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNF-- 58

Query: 181  TEGNVDATSESRIQVPGSPEK---IKRKHTQL--AATPVTKKNTGIQDNPNELKLKNQIE 345
                        ++VP SP K   +K+    L  A  PV         N NE  L  Q +
Sbjct: 59   ----------EAVEVPQSPAKKSIVKKSQDALKQAIRPVAS-------NINESMLSQQSQ 101

Query: 346  PASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKE 525
             +  P+ +T YFM  F  +K+ E ++I  YE +M+ARVH+FG      KE + I   E E
Sbjct: 102  ES--PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN---KEYKPIITNELE 156

Query: 526  KYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSG 705
             +S LW+ +RY+ EE + + L +IKILRLNKLFAKIRPPKF+ P Y+NW  VG+I+ KS 
Sbjct: 157  SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 216

Query: 706  FKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE 885
             K TSS  P K+F FTI DFQ ++ +++F ++ + +YYNLR+GD+I ILNP + PWRPS 
Sbjct: 217  IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 276

Query: 886  ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 1065
               +IKSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN     CC++HRE
Sbjct: 277  RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKSCGSPINTNVHMCCDYHRE 335

Query: 1066 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR--RRNARKEGD 1239
             +FR   AKRIELNG +ALGAPTK D+ PSLY+ K      +NQFN+VR  R+   +E +
Sbjct: 336  VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAK-----GENQFNIVRSTRKGLSEEEE 390

Query: 1240 SKLHNS-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKED 1416
                NS NF ++N AKAFF+++FQNPD+++NLDSKRRK+ D K+ + L +EL K + ++D
Sbjct: 391  RVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKD 450

Query: 1417 NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS--NGKD-PSYT 1587
              S  LE KS+ + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S   G+  P+  
Sbjct: 451  --SSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRI 508

Query: 1588 SNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQ 1722
            + +   +NDLL +KK+KV L P K++   K+  R+E+W  +FG +
Sbjct: 509  NGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSK 553

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
            YIL150C (REAL)
          Length = 572

 Score =  477 bits (1227), Expect = e-162
 Identities = 248/584 (42%), Positives = 370/584 (63%), Gaps = 7/584 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            M+DPRE+   D +++++                 R+++ L ERL+ K+   +  DPNF  
Sbjct: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNF-- 58

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKH-TQLAATPVTKKNTGIQDNPNELKLKNQIEPASV 357
                        I+VP SP K + K  +Q A   VT+  T    N NE  L    +   +
Sbjct: 59   ----------EAIEVPQSPTKSRVKSGSQNAVKQVTRLETS---NANESNLSQIQKQPEL 105

Query: 358  PAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSG 537
            P  +T YFM  F ++KK E ++I  +E++M ARVH+FG  T+ +K   II   E E +S 
Sbjct: 106  PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPII-ANELEGFSN 162

Query: 538  LWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLT 717
            LW+ +RY+ E+ + + L +IKILRL KLFAK+RPPKF++P+Y+NW  VG+I+ KS  K T
Sbjct: 163  LWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFT 222

Query: 718  SSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGY 897
            SS  P K+F FTI DFQ  + +++F ++ + +YYNLR+GDII ILNP + PWRPS    +
Sbjct: 223  SSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNF 282

Query: 898  IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFR 1077
            IKSFNL I   + CI+EIG SRDLGWC + V +K  K CG+PIN +  KCC++HRE +FR
Sbjct: 283  IKSFNLRISHDFKCILEIGSSRDLGWCPI-VNTKTHKKCGSPINISLHKCCDYHREVQFR 341

Query: 1078 NAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR-RRNARKEGDSKLHN 1254
              +AKRIELNG +ALGAPTK ++ PSLYK K      +N+FN++R  R    E + ++  
Sbjct: 342  GTSAKRIELNGGYALGAPTKVNSQPSLYKAK-----GENRFNIIRDARKGLSEEEERMKK 396

Query: 1255 S--NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 1428
            S  NF ++N AKAFF+++FQNPD+++NLD+KRRK+ D K+   L +EL K + +++  S 
Sbjct: 397  SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKE--SS 454

Query: 1429 NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS--NGKDPSYTSN-RS 1599
             LE KS  + ++M+  TEN +Q G+++ +G+DPTHG++  ++K S   G+  +   N + 
Sbjct: 455  GLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKK 514

Query: 1600 NAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKS 1731
              +NDLLH+KK+KV L P K++   K+  R+E+W  +FG + ++
Sbjct: 515  TVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEA 558

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
            YIL150C (REAL)
          Length = 571

 Score =  476 bits (1225), Expect = e-162
 Identities = 240/577 (41%), Positives = 364/577 (63%), Gaps = 3/577 (0%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            M+DPRE    D ++N++                 R+K+ L ERL+ K++  RA DPNF  
Sbjct: 1    MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNF-- 58

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
                        I+VP SP K   ++   +   + +       N N+LKL    +   +P
Sbjct: 59   ----------EAIEVPQSPAK--NRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELP 106

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
            + +T YFM  F ++K+ E ++   YE +M+ARVH+FG     +KE +     E E++S +
Sbjct: 107  SNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTD---KKEYRATIANELEEFSNI 163

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P Y+NW  VG+I+ KS  K TS
Sbjct: 164  WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTS 223

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 900
            S+ P K+F FTI DFQ  + +++F ++A+ +YYNLR+GD+I ILNP + PWRPS +  +I
Sbjct: 224  SDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFI 283

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            KSFNL I   + CI+EIG SRDLGWC + V  K  + CG+PIN    KCC++HRE +FR 
Sbjct: 284  KSFNLRISHDFKCILEIGSSRDLGWCPI-VNRKKNENCGSPINIALHKCCDYHREVQFRG 342

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 1260
             +AKRIELNG +ALGAPTK D  P+LY+ K  N +  N    +R+  + +E   K ++ N
Sbjct: 343  TSAKRIELNGGYALGAPTKVDAQPTLYRAKGENNF--NLVRSIRKTLSEEEERMKKNSHN 400

Query: 1261 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 1440
            FR++N AKAFF+++FQNPD+++NLDSKRRK+ D+K+ + L +EL K + ++   S  LE 
Sbjct: 401  FRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKG--SSGLED 458

Query: 1441 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSNAVN 1611
            K  E+ ++++  TE+ +Q G+L+ +G+DPTHGK+  ++K S  G +P       +   ++
Sbjct: 459  KCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVID 518

Query: 1612 DLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQ 1722
            DLL++KK+KV L P K++   K+  R+E+W ++FG +
Sbjct: 519  DLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK 555

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
            Anc_5.703 YIL150C
          Length = 592

 Score =  476 bits (1225), Expect = e-161
 Identities = 242/585 (41%), Positives = 371/585 (63%), Gaps = 9/585 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            MNDPREV   D +DN+S                 R+++DL  R++ K++  + +DPNF  
Sbjct: 1    MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNF-- 58

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
                       ++QVP SP K    +  +A    T +     +NPNEL+++ +     +P
Sbjct: 59   ----------QQLQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREK--SGQLP 106

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
            + +T YFM  F  SKK E  KIQ  E +M+ARVH+F +    Q E + I V E E+YS +
Sbjct: 107  SNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQ-EFKPIQVNEIEEYSNI 165

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            W+ +RY+ +  + ++L +IKILRL+KLFAK+RPPKF  PQYSNW A+G+I+ K   K T+
Sbjct: 166  WLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTT 225

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 900
            ++ P+KY KFT+ DFQ  + +++F +  + +YYNLRVGD+I ILNP + PWRPS +  +I
Sbjct: 226  TDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFI 285

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            KSFNL I   + CI+EIG S+DLG+C   V S+ G  C TPIN +K+  C++H+E  FR+
Sbjct: 286  KSFNLRINHDFKCILEIGSSKDLGFCK--VTSRNGTLCNTPINMSKEDRCDYHQEIRFRD 343

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKT----NNIYSKNQFNVVRRRNARKEGDSKL 1248
              +KRIELNGSFALGAPTK + NP+LY+KK     ++  ++  F+V     +  +    L
Sbjct: 344  NNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDL 403

Query: 1249 HNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 1428
             N +F + N AKAFF+++FQNPD+++NL+SKRRK++D K+ + + KEL+K +   +  S 
Sbjct: 404  RNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAI--GNRASD 461

Query: 1429 NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT-----SN 1593
            +L  +S  +VK+M+  TE  +Q G+++ +G+DPTHGK+  +++ ++ K+   T     S 
Sbjct: 462  DLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSG 521

Query: 1594 RSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSK 1728
            + + VNDLLHF+K  V L P +++L+ ++ +R+ IW E FG + K
Sbjct: 522  KKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQKRK 566

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
            Anc_5.703 YIL150C
          Length = 610

 Score =  468 bits (1203), Expect = e-158
 Identities = 261/607 (42%), Positives = 373/607 (61%), Gaps = 35/607 (5%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            MNDPRE    D F ++S                 R+K DL  RL+  ++  +  DPNF  
Sbjct: 1    MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNF-- 58

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVT------KKNTGIQD---------NP 315
                        +Q+PG+PE+   K+T +  +  T      +K   +++         NP
Sbjct: 59   ----------DEVQIPGTPEE---KNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNP 105

Query: 316  NELKLKNQIEPAS-VPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQK 492
            NELK++ + E    +P+ +T+YFM  F   KK E  +    E ++ ARVH F     L K
Sbjct: 106  NELKVREREENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMF---QGLNK 162

Query: 493  ESQIINVE-------EKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFE 651
             S+I  +E       E E+YS L I +RY+ ++ ++ + Q+IKILRLNKLFAK+RPPKFE
Sbjct: 163  SSKIHKIEYQPEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFE 222

Query: 652  SPQYSNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRV 831
             PQYSNWV +G+IT+K   K TSS+ P+KYFKFTI DF+ N+ IF+F++ A+ +YYNLR+
Sbjct: 223  EPQYSNWVTLGIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRI 282

Query: 832  GDIICILNPVIAPWRPS-EENGY-IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGG 1005
            GDII ILNP + PWRPS  +NG  IKSFNL I   Y CIIE+GKS+DLG+C +P K    
Sbjct: 283  GDIIAILNPEVLPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINES 342

Query: 1006 KPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK---TN 1176
              C TPI+ +K+  C +H+E  FRN  +KRIELNGSFALGAP K    P LY+       
Sbjct: 343  GTCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVR 402

Query: 1177 NIYSKNQFNVVRRRNARKEGDSKLHNSN----FRSTNIAKAFFNDEFQNPDIISNLDSKR 1344
             +Y  N+FNVV+    RK  +SKL        F S N AKAFF+++FQNPD+++NLD+KR
Sbjct: 403  GVYHGNRFNVVKGSEIRK-NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKR 461

Query: 1345 RKLKDAKRDSELIKELNKTLTKEDNVSKNLEG-KSKEDVKEMRNITENIMQIGMLKNIGY 1521
            RK+ D KR + L +EL+K +  E+  S  L G K+K++  +M++ TE  +Q G+++ +G+
Sbjct: 462  RKIADDKRSNYLDQELSKAI--ENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGF 519

Query: 1522 DPTHGKMKYLMK--KSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDE 1695
            DPTHGK+  +++  K +GKD  + +++   V DLL FKK KV L P K +L+ +K +R+E
Sbjct: 520  DPTHGKIAKVLQTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREE 579

Query: 1696 IWNEYFG 1716
            +W ++FG
Sbjct: 580  VWQKHFG 586

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
            Anc_5.703 YIL150C
          Length = 544

 Score =  460 bits (1184), Expect = e-156
 Identities = 246/537 (45%), Positives = 349/537 (64%), Gaps = 8/537 (1%)
 Frame = +1

Query: 124  ERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGI 303
            +RL+ K++  + +DPNF              IQ+  SPEK K+ +      P+  K    
Sbjct: 2    KRLKAKKEDQKKLDPNFTD------------IQIQRSPEK-KKSNPNTTVNPIPLKRLVE 48

Query: 304  QDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTN 483
              NPNE K+   +  A++PA +T+YFM NF  +KK E +++++Y+  MS+RVHSF    N
Sbjct: 49   DVNPNEAKV---VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAG-AN 104

Query: 484  LQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQY 663
            L K+ Q I VEE E+YS   IS+RYL +E + + L +IKILRLNKLFAKIRPPKF  P Y
Sbjct: 105  LSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDY 164

Query: 664  SNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDII 843
            +NW   G+I  K   KLTSS TP K+FKFTI +FQ  + IF+F    + KYYNLRVGDII
Sbjct: 165  ANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDII 224

Query: 844  CILNPVIAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTP 1023
             ILNP + PWRP  +   IKSFNL I  K+DCI+EI +S+D+ WC   +  K G  C TP
Sbjct: 225  FILNPEVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQ-QINRKTGAKCNTP 283

Query: 1024 INKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYK-KKTNNIYSKNQF 1200
            INK+K   C++H+E +FR+A AKR+EL+G++ALGAPT+ D+ P+LY+ K T+N+   N F
Sbjct: 284  INKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNF 343

Query: 1201 NVV--RRRNARKEGD---SKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAK 1365
            N+V  RR   +KE D   SK H  +F S+N AKAFF+++FQNPD++ NL++KRRK+KD K
Sbjct: 344  NIVADRRYMKKKENDPINSKRH--HFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDK 401

Query: 1366 RDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMK 1545
            RD  L + L +++    N    L+ KS ++++ MRN T+  +Q G ++ +G+DPT G++K
Sbjct: 402  RDVMLQRALRESV---GNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIK 458

Query: 1546 YLMKKSNGK--DPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEY 1710
             +++KS  K         +SNA+ +L+ FKK  VNLKP +  LL K   R++ + +Y
Sbjct: 459  VVLEKSADKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQY 515

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
            similar to uniprot|P32354 Saccharomyces cerevisiae
            YIL150C MCM10 Essential chromatin-associated protein
            involved in the initiation of DNA replication required
            for the association of the MCM2-7 complex with
            replication origins
          Length = 569

 Score =  451 bits (1160), Expect = e-152
 Identities = 239/580 (41%), Positives = 358/580 (61%), Gaps = 8/580 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            M DPREV  NDL+D ++                 RQK+DL +RL  K+   + +DPN   
Sbjct: 1    MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNL-- 58

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 360
                      S IQV  SP+K+              +     +N NELK ++Q +   +P
Sbjct: 59   ----------SHIQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQ---IP 105

Query: 361  AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 540
            A +T++F+  +++SK+ +  +++  E L+S RVH+F      Q E + I   E E++S L
Sbjct: 106  ANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQG-ARRQDEYKPIPTNELEEFSNL 164

Query: 541  WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 720
            WIS+RY+ +E    +  +IKILRL+KLFAK++PPKF  P YSNW  +G+I+ K   K TS
Sbjct: 165  WISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTS 224

Query: 721  SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 900
            + +P+KYFKFT+ +FQ +I  ++F +E + +YYNLRVGDII ILNP + PWRPS    +I
Sbjct: 225  AASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHI 284

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            KSFNL I  K++CI+EIG SRDLGWC +  KSK  + C  PINK K+ CCE+HRE +FR+
Sbjct: 285  KSFNLRISHKFECILEIGASRDLGWCPMFNKSK-NEICRAPINKDKEDCCEYHRELKFRS 343

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKN-QFNVVRRRNARKEGDSK---- 1245
              AKR+EL+G++ALGAPT+ D  P+LY+  ++    KN  +N++   N    G +K    
Sbjct: 344  TNAKRVELSGTYALGAPTRIDAQPALYRGGSS---QKNLNYNII--TNGADGGSNKEINP 398

Query: 1246 --LHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDN 1419
              ++  +F + N AKAFF++ FQNP+ + NL++KRRKL+D ++ + L +EL K      N
Sbjct: 399  LDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK------N 452

Query: 1420 VSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMK-KSNGKDPSYTSNR 1596
               +++ KS E++ E++  TE+ M  GM+KN+G+DPT GK+  + K + +  D    + +
Sbjct: 453  SELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTEK 512

Query: 1597 SNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFG 1716
             ++V  LL FKKD V LKP K  L+ +KR+R+ +W E+FG
Sbjct: 513  DSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFG 552

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp, 583
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 583

 Score =  438 bits (1126), Expect = e-147
 Identities = 236/584 (40%), Positives = 367/584 (62%), Gaps = 7/584 (1%)
 Frame = +1

Query: 7    DPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFISTE 186
            DPREV + D+ D ++                 RQ+RDL++RLE K    +A         
Sbjct: 6    DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKA--------- 56

Query: 187  GNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNT-GIQDNPNELKLKNQIEPASVPA 363
                  S  R++VP SP++ ++      A+P ++K++ GI    N      ++   + P+
Sbjct: 57   ---QRQSLERVEVPASPKEERKSK----ASPQSQKSSKGITLAANSNNDSIEVPWKNGPS 109

Query: 364  GSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLW 543
             +T+YF+ NF +++KVE QKIQ   +L+S RVH+F    +L K SQ +NV+EKE YSG  
Sbjct: 110  NTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSL-KGSQPVNVDEKELYSGFN 168

Query: 544  ISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSS 723
            ISRRY+    +D+++++IK+LRL KLF+K+RPPKF  P Y+NWVA+G+I+ KS  KLTSS
Sbjct: 169  ISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSS 228

Query: 724  NTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG--- 894
            + P KYFK T+ DF  N+ I++FN + + KYYNLRVGDII ILNP I PWRPS+ N    
Sbjct: 229  SKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEF 288

Query: 895  ---YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 1065
                +KSFNLSI+  +DC++EIG S+DLG+C +P K+   K CG PIN+     CE+H++
Sbjct: 289  SGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKAT-RKACGAPINRAATDRCEYHQD 347

Query: 1066 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSK 1245
              FR+  A+R+ELNGS +L +P K     +LY   T+ +  K Q    +     ++G+S+
Sbjct: 348  VRFRHVNAQRVELNGSTSLRSPVKNGKKQALY--GTSGVKRKLQLLPDKHAPQAQDGESQ 405

Query: 1246 LHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVS 1425
             +   F + N AKAFF+D +QNPD+++NL++KRRKLKD++++  L  +LN  + K    S
Sbjct: 406  -NTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQS 464

Query: 1426 KNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNA 1605
             N   KSKE+ K+M++ TE ++  G+L++IG+DP  GKM+ ++K     + S  +++S+ 
Sbjct: 465  FN--NKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVN-SGLNSKSSQ 521

Query: 1606 VNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNR 1737
            V +++ FKK  V+L P K++   +  +R+++W E+F  +  +N+
Sbjct: 522  VKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQ 565

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar to
            uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  437 bits (1123), Expect = e-146
 Identities = 249/593 (41%), Positives = 357/593 (60%), Gaps = 16/593 (2%)
 Frame = +1

Query: 4    NDPREVFENDLFDNISPXXXXXXXXXXXXXXXX-RQKRDLQERL-EYKRKV-SRAVDPNF 174
            NDPREV   D + ++S                  R+K+DL  RL E KRK+ S+ +DPN 
Sbjct: 7    NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 175  ISTEGNVDATSESRIQVPGSP--EKIKRKHTQLAATPVTKKNTGIQD---NPNELKLKNQ 339
                   +  S  R++VP SP  E +  +       P    N    +   NPNE   ++ 
Sbjct: 67   ------KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNE---EDI 117

Query: 340  IEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEE 519
            +        +T+YF N F +SK  E + +  Y+ +MSAR H+F   T+L  +++ I  +E
Sbjct: 118  VRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLS-DNKTIQCDE 176

Query: 520  KEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEK 699
             E YS   I +RY+ ++ +D+LL  IKILRLNKLFAK+RPP F  PQYSNWVA+G I+ K
Sbjct: 177  LEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSK 236

Query: 700  SGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRP 879
               KLT++  P KYFKFT+ DF+ N+ ++VF ++ + +YYNLRVGDII +LNP I PWRP
Sbjct: 237  EDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRP 296

Query: 880  SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFH 1059
            S     IKSFNL I   ++CI+EIG SRDLGWC + V     K C +PIN   D+CCEFH
Sbjct: 297  SGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQM-VNHGQSKICNSPINTKTDRCCEFH 355

Query: 1060 RETEFRNAAAKRIELNGSFALGAPTKADTNPSLYK---KKTNNIYSKNQFNVVRRRNARK 1230
            RE + R+ A+KRIEL+GS+ALGAPTK  T PS+YK   K  N   +K++   +    ++K
Sbjct: 356  RELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKK 415

Query: 1231 EGDSKLHN---SNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKT 1401
            E + + H     +F +   AKAFF+D FQ+P +++NL+SKRRK+K +K D  L+K LN  
Sbjct: 416  EQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALN-- 473

Query: 1402 LTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNG--KD 1575
               ED      + K+K+ VKE   ITE  +Q G+++ +G+DP+ G++  ++ KS G   D
Sbjct: 474  --GED----ASQSKNKQQVKE---ITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTD 524

Query: 1576 PSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSN 1734
                S +   +NDL+HFKKDK+ LKP +   L K+ +R+ IW ++F D + S+
Sbjct: 525  DPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDSD 577

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
            YIL150C
          Length = 616

 Score =  434 bits (1115), Expect = e-145
 Identities = 235/609 (38%), Positives = 358/609 (58%), Gaps = 39/609 (6%)
 Frame = +1

Query: 7    DPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFISTE 186
            DPR+V   D +DNI+                 R+K+DL++RL+ KR   +  D N     
Sbjct: 4    DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNL---- 59

Query: 187  GNVDATSESRIQVPGSPEK-------IKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIE 345
                   +  +QVP SP+K       + RK  +  A  + K+N  +  N  +    N+  
Sbjct: 60   -------QLDVQVPSSPQKRSVSAIDVARKRRE-EAEAIKKRNLSLALNTAQKVNLNEAR 111

Query: 346  PASVPA--------GSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQ 501
             A +           +T+YF+  F  SKK E  +I+  ET++SARVH+F     + KE Q
Sbjct: 112  FAQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTF---QGVDKEFQ 168

Query: 502  IINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAV 681
            +  V E E++S LWIS+RY+ ++ +++ L+D+K+LRLNKLFAK+RPPKF+ PQYSNW  +
Sbjct: 169  LEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVL 228

Query: 682  GVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPV 861
             +I++KS  K T+S  P+K+ +FT+ +FQQ + +FVF    + +YYNLR GDI+ +LNP 
Sbjct: 229  AIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPE 288

Query: 862  IAPWRP---SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINK 1032
            I PWRP   S++   IKSFNL I  K+ CI+EIGKSRDLG+C V  K    K CG+ IN 
Sbjct: 289  ILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEK-CGSAINL 347

Query: 1033 TKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKT------------- 1173
             +D+ CE+HRE + R  ++KR++LNG FALGAPTK  T P L+++ +             
Sbjct: 348  ARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRD 407

Query: 1174 --NNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRR 1347
                 Y++  +N    +    E +  L    F S+N AKAFF+DEFQNPD++ NLD+KRR
Sbjct: 408  QGKRFYTEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRR 467

Query: 1348 KLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDP 1527
            KL+D+K+  +L ++L + L+K+++  +    K+  ++  ++  TE  +  G+++ +G+DP
Sbjct: 468  KLQDSKKSRQLDRKLKRLLSKDED--RATLDKNTAEMAALKRTTETALHTGLIQRLGFDP 525

Query: 1528 THGKMKYLMKK------SNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKR 1689
            THG+   +MKK      S   +    S + N VN+LL +K+DK NL P ++ L  +K+ R
Sbjct: 526  THGRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHR 585

Query: 1690 DEIWNEYFG 1716
             E+W E FG
Sbjct: 586  REVWRETFG 594

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
            required for the association of the MCM2-7 complex with
            replication origins
          Length = 574

 Score =  404 bits (1037), Expect = e-133
 Identities = 232/589 (39%), Positives = 352/589 (59%), Gaps = 11/589 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            M DPRE  E D+FD +S                 R+K+DL++RL+   +  + +DPNF  
Sbjct: 1    MEDPREPREIDIFDELS--CDEDDDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNF-- 56

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTG----IQDNPNELKLKNQIEP 348
                      S ++VP SP K   KH  +  T  +K +        +N NEL+++ +   
Sbjct: 57   ----------SGVEVPRSPSK--SKHVAVKETSRSKDDRESCFPAHENLNELQVQKK--- 101

Query: 349  ASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEK 528
            AS+ + ST YF  NF+SSKK +  + +    +++ RVH+F    +  +E   I V E+E+
Sbjct: 102  ASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDG-PDFVREYSPIAVNEEEE 160

Query: 529  YSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGF 708
            +SG WIS+RY+  E   ++L++ K+LRL KLFAK+RPP F  PQYSNWV +G+I+ KS  
Sbjct: 161  FSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSV 220

Query: 709  KLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE- 885
            K+T+   P +YF  T+ DF+  I+I++F  + + KYYNL+VGDII +LNP I PWRPS+ 
Sbjct: 221  KMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKV 280

Query: 886  -----ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCC 1050
                     IKSFNL I+  ++ I+EIG SRD G+C++  K + GK CGTPINK+ +  C
Sbjct: 281  EHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQ-GKTCGTPINKSVEDRC 339

Query: 1051 EFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARK 1230
             +H+E +FR   AKR+ELNG+ +L +PTK      LY K  +  Y         +  + K
Sbjct: 340  YYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQS-K 398

Query: 1231 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTK 1410
            +  + L+ SN    N A+AFF+D++QNPD ++NLDSKRRKL+  K++  L K+L + + K
Sbjct: 399  DSQNVLYFSN---PNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGK 455

Query: 1411 ED-NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT 1587
             + N+ KN E  +K+D  E+R  T+N ++ G++K IG+DPT G+M  ++K  N       
Sbjct: 456  SNSNLFKN-ETSTKQD--EIRRATKNALESGLIKKIGFDPTSGRMSSVLK--NNSKGLKE 510

Query: 1588 SNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSN 1734
              +++AV ++L  KK+K+ LKP K  L  K +KR+E+WN +F  +   N
Sbjct: 511  QAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKKEENPN 559

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
            YIL150C (DNA43) - (putative) involved in DNA replication
            [contig 159] FULL
          Length = 466

 Score =  385 bits (988), Expect = e-128
 Identities = 198/451 (43%), Positives = 292/451 (64%), Gaps = 7/451 (1%)
 Frame = +1

Query: 382  MNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRYL 561
            M NFA+S+K E  +I+    ++ +RVH+F       K  + I VEEKE  SGLW+SRRY+
Sbjct: 1    MENFANSRKAEESRIKHRGEMLDSRVHTFRGL-KATKSRKPIAVEEKEPASGLWVSRRYI 59

Query: 562  KEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKY 741
              + + ++L+DIKILRL KLF+K+RPPKF  P Y+NWVAVG++  KS  K+TSS+ P KY
Sbjct: 60   ASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKY 119

Query: 742  FKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE------ENGYIK 903
            FK TI DF  ++ ++VFN   + KYYNLRVGDII ILN  I PWRPS+          +K
Sbjct: 120  FKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVK 179

Query: 904  SFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRNA 1083
            SFNLSI+  YDC++EIG SRDLG+C +  K+K GK CG PIN+     C++H+E  FR  
Sbjct: 180  SFNLSIRGNYDCVLEIGTSRDLGFCQIYNKAK-GKVCGAPINRAAVDRCDYHQEIRFRQV 238

Query: 1084 AAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNS-N 1260
             A+R+ELNGS +L +P K     +LY     +   K + N++  ++A ++ D +  N+  
Sbjct: 239  NAQRVELNGSMSLRSPVKNGKKQALY----GSSGVKRKLNLLPDKHAPQQQDRESQNTLY 294

Query: 1261 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 1440
            F + N AKAFF+D +QNPD++ NLDSKRRK++D + + +L  +L++ L K+    +    
Sbjct: 295  FSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDG--QQRFSE 352

Query: 1441 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 1620
            K+K++ K+M+  TE  +  G+LKNIG+DPT GKM+ ++K       S T  +S  V +++
Sbjct: 353  KTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNS-TDTKSIQVREII 411

Query: 1621 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF 1713
              +K  V+L P K+D   +  +R+++W E+F
Sbjct: 412  ETRKTNVSLAPSKADQKKRLLRREQVWKEHF 442

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  332 bits (851), Expect = e-105
 Identities = 187/515 (36%), Positives = 302/515 (58%), Gaps = 6/515 (1%)
 Frame = +1

Query: 199  ATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVPAGSTAY 378
            A     ++VP SP K K    + A  P T  +T   + P E + +  +  A+ P  +T+Y
Sbjct: 82   AKKSPTVEVPRSPTKAKCVEDEPA--PSTSASTTYVEEPEENENERYLLSANTP--TTSY 137

Query: 379  FMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRY 558
            F   FA ++   A  ++  + L+  RV++F +  +   E     V+E E YS + I++RY
Sbjct: 138  FAEKFARARDSSASTMRRKQELLKRRVYTFSD-RDTAIEYTTFAVDEVETYSNMRINKRY 196

Query: 559  LKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRK 738
            + EE + ++L DIK+LRL KLFAK+RPPKF  P Y+NWV +G I+ KS  K TS   P K
Sbjct: 197  VPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEKPAK 256

Query: 739  YFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEE------NGYI 900
            YF   I DF  ++ I VF ++ + KYY LRVGD+I ILNP I PW+ S +          
Sbjct: 257  YFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETARTTG 316

Query: 901  KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 1080
            +SF LSI+   +CI+EIG S++LG+C    K+KG  PCG PINK K++ C +H+ET  R+
Sbjct: 317  RSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGA-PCGAPINKLKEQVCSYHQETHLRS 375

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 1260
              AKR+ELNG+ +L APT+     + Y   T N +      +      R  G  +    +
Sbjct: 376  VNAKRVELNGNISLRAPTRDGIQQAGY--MTRNSHGTKIGLLPDVYAPRAPGAEQKFREH 433

Query: 1261 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 1440
            F S N  +A+F+ ++ NPD++ NL+SKRRK++ +K+D ++ K+L+  L K  N ++  + 
Sbjct: 434  FASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGK--NHTQVKDR 491

Query: 1441 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 1620
             S+E +++    T+N+M+ G+L++IG+DPT G+M  ++ +  G      + R  +++++L
Sbjct: 492  VSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQ--GDHGPADTVREPSISEIL 549

Query: 1621 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQS 1725
              KK  ++LKP K     + ++R+E++N  F +++
Sbjct: 550  ANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEA 584

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp, 577
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 577

 Score =  300 bits (767), Expect = 2e-93
 Identities = 190/590 (32%), Positives = 309/590 (52%), Gaps = 11/590 (1%)
 Frame = +1

Query: 1    MNDPREVFENDLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRAVDPNFIS 180
            + DPRE+   D ++ +S                  +KRDL  RL    K     DPNF S
Sbjct: 5    LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 181  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQD---NPNELKLKNQIEPA 351
                        I VP SP+K       +           I++   N NE  ++ +++  
Sbjct: 65   ------------IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL 112

Query: 352  SVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKY 531
                G+T+YF     S    E + I+  + L++ RV++F    ++  E + I V+EK+  
Sbjct: 113  ----GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG--DMFDEYEPITVDEKDDL 166

Query: 532  SGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFK 711
            SGL I RRY+    + +  ++IK+LRL KLF+K+R PKF  P Y NW+ +G+I++K+  +
Sbjct: 167  SGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPR 226

Query: 712  LTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEEN 891
            +T+S  P K+F  TI DFQ  +++  F +  + KYY LR+GD+I ILNP I P +  E  
Sbjct: 227  MTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG 286

Query: 892  G--YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 1065
                  +F+L +    + I+E+G S++ G C   +K+K GK CG PINK  D  C +H+E
Sbjct: 287  ASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNK-GKLCGAPINKLHDNYCAYHKE 345

Query: 1066 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNN-----IYSKNQFNVVRRRNARK 1230
             + R  +++R+E++ S A+ AP       ++ K + NN      Y +N      R  A  
Sbjct: 346  AKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAA 405

Query: 1231 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTK 1410
            E +  L    F S N + AFF+D+++NPDI++NLD+KRRK+++ + +  L K+L      
Sbjct: 406  ETNRFL----FSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGL--- 458

Query: 1411 EDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTS 1590
             D +    E +  ++ K  +  T ++ Q G+   IGYDPT GK    M + + ++ +  +
Sbjct: 459  SDKLLSKKEDRVNQEAK--KTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKN 516

Query: 1591 NRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF-GDQSKSNR 1737
            ++  A+ D+ + KKD V+LKP K  L  K  KR+ I+NE   G Q + ++
Sbjct: 517  DKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDK 566

>SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {ON}
            some similarities with uniprot|P31376 Saccharomyces
            cerevisiae YAL011W SWC3 Protein of unknown function
            component of the Swr1p complex that incorporates Htz1p
            into chromatin required for formation of nuclear-
            associated array of smooth endoplasmic reticulum known as
            karmellae
          Length = 657

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 41/152 (26%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 1036 KDKCCEFHRETEFR---NAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNV 1206
            K+K  + +   E     +   K  +L+G   LG P  AD++P L + K    Y+K +  +
Sbjct: 389  KEKGLDLNESPELEKKDDTQVKAEDLSGVTTLGKPAAADSSPKLDQPKPKRKYTKRKNVL 448

Query: 1207 VRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNL--DSKRRKLKDAKR--DS 1374
            V +  + +E   +L     +  N A   F +  +NP+I  NL  D+   +L+D +    S
Sbjct: 449  VAKDESTEEKSMQLTTFQQKYMNNADIVF-EYLENPNIRYNLPKDAIFEQLEDEESYLMS 507

Query: 1375 ELIKELNKTLTKEDNVS-KNLEGKSKEDVKEM 1467
             ++    K + K +N   K LEGK+   V E+
Sbjct: 508  WIVIHNKKDIEKYENKKLKELEGKTSRKVTEV 539

>NDAI0F00860 Chr6 (210078..211367) [1290 bp, 429 aa] {ON}
          Length = 429

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 21/81 (25%), Positives = 39/81 (48%)
 Frame = +1

Query: 226 PGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVPAGSTAYFMNNFASSK 405
           P    ++++  + +A      KN   Q N NELKL + +E ++ P G      NN+  + 
Sbjct: 49  PNYNNELQQFDSTIATDSTANKNQ--QQNKNELKLTDSLEGSTTPLGQLTQVSNNYQLNM 106

Query: 406 KVEAQKIQDYETLMSARVHSF 468
            V  +   + E +M+++ H F
Sbjct: 107 SVPRRSESNIERMMNSKKHCF 127

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
            Anc_8.604 YOR195W
          Length = 756

 Score = 40.0 bits (92), Expect = 0.019
 Identities = 35/128 (27%), Positives = 69/128 (53%), Gaps = 4/128 (3%)
 Frame = +1

Query: 1141 DTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDI 1320
            D+N +L ++K + IYS+ + +       +KE +S L  S   S NI +       +    
Sbjct: 333  DSNQTLLQEKYDQIYSEYEKSQSTTDFMKKEIES-LQKSLEDSANILEELSEHSKELESK 391

Query: 1321 ISNLDSKRRKLKDAKRDSELIKE---LNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIM 1491
            +S ++ +++ +++ K   +L+KE   +   L+ +DN   +LEGK K+ V   RN +++++
Sbjct: 392  LSTVEQEKKNMEEEKL--KLLKENKHVMNQLSGKDNEIVSLEGKIKDLVNSERNHSKSLI 449

Query: 1492 -QIGMLKN 1512
             QI +L N
Sbjct: 450  DQIAVLTN 457

>TBLA0C02340 Chr3 complement(554335..557685) [3351 bp, 1116 aa] {ON}
            Anc_3.425 YGR089W
          Length = 1116

 Score = 40.0 bits (92), Expect = 0.020
 Identities = 44/195 (22%), Positives = 82/195 (42%), Gaps = 10/195 (5%)
 Frame = +1

Query: 1132 TKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIA-KAFFNDEFQ 1308
            T+ +TN S     +NN    NQ N+ +          K     F   + +  ++++ +F 
Sbjct: 849  TENNTNSSSNTNNSNN----NQSNIKK---------DKYSQERFEQLDFSFPSYYHRKFL 895

Query: 1309 NPDII---------SNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVK 1461
            +P +          +NL  +R KLK  K+  E+ K+LN      DN+   +  KS  DVK
Sbjct: 896  SPILTLKHSILTTNANLSEERLKLKKTKK--EISKKLNALKNDIDNIKIKINQKSSNDVK 953

Query: 1462 EMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKV 1641
                I    + +   +         K+KY +++    + +Y  N+   +   L + K K 
Sbjct: 954  MASKIESLRISLNQTETT-ISNLEKKLKYYVEQEVLIEENYLKNKDIHLKRQLEYGKLK- 1011

Query: 1642 NLKPLKSDLLMKKRK 1686
                L++D++  K+K
Sbjct: 1012 --DTLQNDIINNKKK 1024

>TBLA0B03140 Chr2 (732288..735989) [3702 bp, 1233 aa] {ON} Anc_8.824
            YML104C
          Length = 1233

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 33/120 (27%), Positives = 54/120 (45%)
 Frame = +1

Query: 1135 KADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNP 1314
            K  +NP+    +  +++ KN  N + R   RK+  S L +   ++ N  K F      NP
Sbjct: 578  KMVSNPNFNSNELYSLFFKND-NKISRSRTRKDRSSSLVDQKPQNVNAVKIF-----TNP 631

Query: 1315 DIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
            ++   LD+   +  D KR  +  K  N  L  EDN+  N   K  ED +     + NI++
Sbjct: 632  NLNEALDNILHE--DTKRVHKKTKSPNDFLFGEDNLFNNSTPKLFEDERSKVYSSPNILK 689

>TBLA0H03390 Chr8 complement(830774..832705) [1932 bp, 643 aa] {ON}
            Anc_8.507 YBR156C
          Length = 643

 Score = 38.5 bits (88), Expect = 0.055
 Identities = 48/196 (24%), Positives = 84/196 (42%), Gaps = 5/196 (2%)
 Frame = +1

Query: 1105 NGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAK 1284
            N +F   +PTK      + K  T+ I +KN  N+V   + +K     LHNS+++S++ A 
Sbjct: 237  NKNFEFRSPTK---KKKIIKPNTSPINNKNT-NIVSPISRKKSSYKSLHNSSYKSSSSAS 292

Query: 1285 AFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVS-KNLEGKSKEDVK 1461
               +   Q         S+R   KD+   + + + L  T T     S +N++       K
Sbjct: 293  TSTSSSHQ---------SRRITTKDS---ASVFERLAVTTTTRSTPSLRNIKRN-----K 335

Query: 1462 EMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAV----NDLLHFK 1629
            +   IT+    I    N  + P+H  ++  +  +    P   S + N +    + +L+ K
Sbjct: 336  KSFTITKQSSLINNNTNNKHTPSHTSLQNFIPLNESLSPLKESQKINIIPRKDHRVLNSK 395

Query: 1630 KDKVNLKPLKSDLLMK 1677
                NL   KSDLL +
Sbjct: 396  STNNNLLE-KSDLLQE 410

>KAFR0L00630 Chr12 complement(119132..119896) [765 bp, 254 aa] {ON}
            Anc_7.137 YEL005C
          Length = 254

 Score = 37.4 bits (85), Expect = 0.077
 Identities = 31/118 (26%), Positives = 64/118 (54%), Gaps = 1/118 (0%)
 Frame = +1

Query: 1318 IISNLDSKRRKLKDAKRDSELIKELNKT-LTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
            + S  D  +++  D K D   I+++ K+ +  E   ++ LE KSK   +++RN  + +++
Sbjct: 31   LASIFDKVKKEFNDVKADLLNIEKVIKSDIAAEIKQAEALESKSKSSDRKVRNSYKKLIK 90

Query: 1495 IGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDL 1668
            +   ++  YD T G ++ L+++  G      SN  + +N+LL  KK  V++  + S+L
Sbjct: 91   V---RSRAYD-TEGNLRALLEQKRG--VLQISNEVDNINELL--KKILVDIDEIDSNL 140

>TBLA0E00740 Chr5 complement(152407..154503) [2097 bp, 698 aa] {ON}
            Anc_7.8 YOR372C
          Length = 698

 Score = 37.7 bits (86), Expect = 0.097
 Identities = 39/166 (23%), Positives = 67/166 (40%), Gaps = 9/166 (5%)
 Frame = +1

Query: 1192 NQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRD 1371
            N  N+  ++          HN NF S N      N+ F N   +++ +    + KD   D
Sbjct: 165  NNSNIQSQQTNTNNNGLNYHNINFNSIN-THTNTNNNFSNEFFLASPE----QFKDFLLD 219

Query: 1372 SELIKEL-NKTLTKE------DNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPT 1530
            S     L +KT  K       DN + N    +  ++  + N   NI   G+L   G D +
Sbjct: 220  SPAAMNLFHKTPAKTPLRFYTDNTATNSNNNNSSNLLNLNNSNINISTSGLL---GTDGS 276

Query: 1531 HGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKD--KVNLKPLKS 1662
            +      + K+N  + S +SN +N      + +K    +N  PL++
Sbjct: 277  NNLFGTNLNKNNSNNNSSSSNNNNTTTTTNNNEKSLKNMNFTPLRN 322

>Kpol_1027.18 s1027 (42160..42951) [792 bp, 263 aa] {ON}
            (42160..42951) [792 nt, 264 aa]
          Length = 263

 Score = 37.0 bits (84), Expect = 0.11
 Identities = 33/145 (22%), Positives = 71/145 (48%), Gaps = 13/145 (8%)
 Frame = +1

Query: 1342 RRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEM---RNITENIMQIGMLKN 1512
            +++L+D  +D + +KE  K  +  D + K  + K  E+ K++   +N +  ++Q+  LK 
Sbjct: 92   KQQLRDTDKDIKPVKEKIKNKSALDKILKFFQKKKSENYKQVSSRKNSSNKVIQLANLKK 151

Query: 1513 --IGYD--PTHGKMK---YLMKKSNGKDPSYTS---NRSNAVNDLLHFKKDKVNLKPLKS 1662
              IG +  P   +     Y + K N  DP  TS   N++ ++  LL +   ++ +K + +
Sbjct: 152  EAIGDNKIPIANRTYIDCYYVDKGNNDDPKKTSLYTNKTWSIGRLLDYIAIQLKVKNVNN 211

Query: 1663 DLLMKKRKRDEIWNEYFGDQSKSNR 1737
            ++   + +   ++ +  GDQ    R
Sbjct: 212  NVNSDESEILYLYKKVEGDQLSFKR 236

>Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa] {ON}
            YDL058W (USO1) - Integrin analogue gene [contig 72]
            PARTIAL
          Length = 1215

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 37/160 (23%), Positives = 71/160 (44%), Gaps = 3/160 (1%)
 Frame = +1

Query: 1027 NKTKDKCCEFHRETEFRNAAAKRIELNGSFALGA-PTKADTNPSLYKKKTNNIYSKNQFN 1203
            NK KDKC EF +E +  N  +  +  + S  + +   K D+  + Y  K  +    N+ N
Sbjct: 841  NKLKDKCLEFEKERKLLNEGSTSVTEDYSNKVSSLEKKLDSLEAEYSSKRRDF--ANEQN 898

Query: 1204 VVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAK--RDSE 1377
             +R   A+ E  +   ++  +           E +  D+   +++K  ++K+ +  +DSE
Sbjct: 899  ELRALLAKSEKAASKTDAELQLA---------ERKLSDVEKMMETKENEVKELQISKDSE 949

Query: 1378 LIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQI 1497
             + E+NK+L K     K    K +E  K +      I ++
Sbjct: 950  -VAEVNKSLGKLKQTIKEKNSKLQELEKALAEKNHRISEL 988

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 33/152 (21%), Positives = 66/152 (43%), Gaps = 3/152 (1%)
 Frame = +1

Query: 1069 EFRNAAAKRIEL---NGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGD 1239
            EF     K++E    N S  L   TK   N +   KK    ++ N+  +    +     +
Sbjct: 768  EFLEGKHKKVEKSLENVSTRLIEITKDKENLTAANKKITETFASNKKKIEAYESKINTLE 827

Query: 1240 SKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDN 1419
            SKL +   +     +       +    + NL+  +  ++ AK+  E  KELNK L    N
Sbjct: 828  SKLRDITSKKEQAEEGINKMSRE----LFNLEKNKEDIESAKKKVE--KELNKELENMKN 881

Query: 1420 VSKNLEGKSKEDVKEMRNITENIMQIGMLKNI 1515
             +K L+    +  KE++++ E + ++  ++++
Sbjct: 882  ENKKLDNTLAKKEKELQSLDEELQKLRKMQSL 913

>Smik_4.376 Chr4 complement(676941..677828) [888 bp, 296 aa] {ON}
            YDR130C (REAL)
          Length = 296

 Score = 37.0 bits (84), Expect = 0.12
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 11/94 (11%)
 Frame = +1

Query: 1249 HNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRD-SELIKELNKTLTKEDNVS 1425
            HN+NF +T++      D+ +  +++ +L  +   L D     ++   +LN  L KE  V 
Sbjct: 178  HNTNFETTSVENDLSQDKLKKKNLLIDLKKEEEGLGDGIESLTKSNTKLNSMLAKEGKVQ 237

Query: 1426 KNLEGKS----------KEDVKEMRNITENIMQI 1497
            K    K+           ED KE+R+I + I+Q+
Sbjct: 238  KASIQKTVKFKLPDTIVTEDTKELRDIKDLILQM 271

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 34/136 (25%), Positives = 70/136 (51%), Gaps = 1/136 (0%)
 Frame = +1

Query: 1330 LDSKRRKLKD-AKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGML 1506
            +D  R +LK   K +SEL KE++    K + ++K+ E K +E +K+  + TE + ++G  
Sbjct: 1664 IDQLRSQLKQYMKIESELNKEISVLNFKLNTLTKDSEYKIEELLKQTNHYTELVEKLGSE 1723

Query: 1507 KNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRK 1686
            +++  D T   +K L +  + +  + + N  + +N+      +   L+ L  D   K + 
Sbjct: 1724 RDM-LDSTGQNLKQLYENVSTEASTLSDNMKSLINENTMLSGEVERLENLLED---KNKL 1779

Query: 1687 RDEIWNEYFGDQSKSN 1734
             +EI  +Y  + SK++
Sbjct: 1780 LNEI--KYENNDSKNS 1793

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 37.4 bits (85), Expect = 0.15
 Identities = 38/184 (20%), Positives = 75/184 (40%), Gaps = 15/184 (8%)
 Frame = +1

Query: 1189 KNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKR 1368
            +N FN++  +++   GD+   NSN+ +        N+     + +S    +   LK    
Sbjct: 739  QNDFNILSEKHSILSGDNISLNSNYENIK------NELNSISEQLSMASKENENLKATNA 792

Query: 1369 DSEL-IKELNKTLTKED----------NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNI 1515
              E+ +K LNK L +++          N++K  + K++E + +M N    +M      N 
Sbjct: 793  SQEVDVKSLNKELNEKEKSIYELEKQLNLTKTEKDKAQEGINKMNNELRKLMTSIDTLNE 852

Query: 1516 GYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKK----DKVNLKPLKSDLLMKKR 1683
                   ++K    + + K+    S       +  + KK     +  ++ LKS LL+  R
Sbjct: 853  DKSRLQNEIKLQKIELDDKETKINSEMEKTSKEYDNLKKLLALKEEEIEELKSKLLISAR 912

Query: 1684 KRDE 1695
               E
Sbjct: 913  DLKE 916

>Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..46265)
            [1497 nt, 499 aa]
          Length = 498

 Score = 37.0 bits (84), Expect = 0.15
 Identities = 38/156 (24%), Positives = 63/156 (40%), Gaps = 21/156 (13%)
 Frame = +1

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNV 1422
            KL NS  R     +   +   +N ++ + L+ K RKLKD + + E +KE    +T E  V
Sbjct: 116  KLENSQQREGKFMENIASLRHENDNLSTMLNRKTRKLKDTELELEELKEKFDKITTEKKV 175

Query: 1423 ---SKNLEGKSKEDVKEMRNITEN----------------IMQIGMLKNIGYDPTHGKMK 1545
                 N    S+  +KE  ++ EN                + +I  LK    D T  +  
Sbjct: 176  LDDDLNKTSASETKLKEEMSMIENQYNSLIDSHEYYKDKYLQEINQLKRSLEDLTTEQEN 235

Query: 1546 YLMK--KSNGKDPSYTSNRSNAVNDLLHFKKDKVNL 1647
            YL +  ++N        N +N+ N L    +   N+
Sbjct: 236  YLKRTNENNKLVEEKIDNYNNSFNQLKEINESLNNI 271

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
            YKL101W
          Length = 1515

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 23/147 (15%)
 Frame = +1

Query: 1240 SKLHNSNFRSTNIAKAFF----NDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 1407
            +K H++N  + N AKA      N+E  NP I +N+ S ++  +  +R  + + +  K L+
Sbjct: 8    NKYHDTNIAAQNAAKAAMSRKINNENINPKINNNILSSKKSTQHLERVVQSVNDATKRLS 67

Query: 1408 KEDNV------SKNLEGKSKEDVKEMR-------------NITENIMQIGMLKNIGYDPT 1530
            ++D+       +K+ + KS++ V   +              + +N+ + G L  I   P 
Sbjct: 68   QQDSQFTTNTNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNV-ETGQLAAIKIVPK 126

Query: 1531 HGKMKYLMKKSNGKDPSYTSNRSNAVN 1611
              + K++MK SN  + S+ S  S+A N
Sbjct: 127  --RNKFVMKNSN-SNISFMSATSSASN 150

>ZYRO0G07898g Chr7 complement(637442..638938) [1497 bp, 498 aa] {ON}
           similar to uniprot|P32523 Saccharomyces cerevisiae
           YLL036C PRP19 Splicing factor associated with the
           spliceosome contains a U-box a motif found in a class of
           ubiquitin ligases
          Length = 498

 Score = 36.6 bits (83), Expect = 0.20
 Identities = 44/160 (27%), Positives = 63/160 (39%), Gaps = 4/160 (2%)
 Frame = +1

Query: 169 NFISTEGNVDATSESRIQVPGSPEKIKRK--HTQLAATPVTKKNTGI-QDNPNELKLKNQ 339
           N +S    VD   ES  QV G P+ +  +  +       +TKKN  +  D  +EL  +N 
Sbjct: 138 NQLSLHLGVDEAEESEEQVTGLPQDLIEQLLNASKEYVNITKKNKDLFVDEVSELVCRNN 197

Query: 340 IEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQI-INVE 516
              +  P   +   + +  S   V    I D  T+          YT   K SQ  INVE
Sbjct: 198 YNASDSPVLQSGSKLRSGLSKSVVFT--IDDGNTVY---------YTQGDKNSQFEINVE 246

Query: 517 EKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIR 636
           EK +Y  +  +  YL   T D  +    I    K   +IR
Sbjct: 247 EKLEYLTMTPNEEYLIFSTTDGKIGTYNIKESQKHVLEIR 286

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
            Anc_5.432 YOR119C
          Length = 504

 Score = 36.6 bits (83), Expect = 0.20
 Identities = 39/181 (21%), Positives = 71/181 (39%), Gaps = 14/181 (7%)
 Frame = +1

Query: 1072 FRNAAAKRIELNGSFALGAPTKADTNPSLYK------------KKTNNIYSKNQFNVVRR 1215
            + N    R+ +  +  L  P K D    +++            ++  + Y+  +F++++ 
Sbjct: 328  YSNEDDLRMYVKNNLPLKVPGKDDAEDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKS 387

Query: 1216 RNAR--KEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKE 1389
              A   ++  S     NF    ++    ND+  N D ISN D       D+  DS+   +
Sbjct: 388  LIAHDNEKNFSASEQYNFEDNTLS----NDDDDNEDDISNSDPDNSDSDDSDSDSDDNDD 443

Query: 1390 LNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNG 1569
             +K    ED   K L+GK  ED +E +   +   +    K       H K K + K  + 
Sbjct: 444  DDKVDVFEDKKDKVLKGKKYEDKEEKKQRKQEAKESKREKRKTKVKKHIKKKLVNKTKSK 503

Query: 1570 K 1572
            K
Sbjct: 504  K 504

>SAKL0H20944g Chr8 (1828722..1830347) [1626 bp, 541 aa] {ON} similar
            to uniprot|P40357 Saccharomyces cerevisiae YGR009C SEC9
            t-SNARE protein important for fusion of secretory
            vesicles with the plasma membrane
          Length = 541

 Score = 36.6 bits (83), Expect = 0.21
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 6/124 (4%)
 Frame = +1

Query: 1144 TNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFND------EF 1305
            +NP   K++      K +   V+ +  ++E +S LH S  R         ND       +
Sbjct: 398  SNPFNSKRRLREAEDKIRMQRVQDKIMQQEANSTLHQSTRRIEGAMNNAGNDGNTVRERY 457

Query: 1306 QNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITEN 1485
            QN  I+    SKR + ++ + D E+  E+++ L K   VS  L+  +    +E+ +  + 
Sbjct: 458  QNQQILDR--SKRYQFENDEEDDEMELEIDRNLDKIGQVSSRLKKLAVATGEEINSQQDR 515

Query: 1486 IMQI 1497
            I  I
Sbjct: 516  IKSI 519

>TBLA0A07620 Chr1 complement(1890451..1892346) [1896 bp, 631 aa]
           {ON} Anc_7.366 YLR190W
          Length = 631

 Score = 36.6 bits (83), Expect = 0.22
 Identities = 32/109 (29%), Positives = 47/109 (43%)
 Frame = +1

Query: 139 KRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPN 318
           K+K S +   N  S E N+   S S I               + ATP+T  ++ +  NPN
Sbjct: 193 KKKKSNSPKANSKSRE-NLILNSNSNINTNTITNSNTNATPDVIATPLTNPSSNVSANPN 251

Query: 319 ELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHS 465
              LKN +   S+P  S     +N      V  Q+I DY+T   +R+ S
Sbjct: 252 --VLKNSVNKISLPKRSKVPTYSN------VVPQEIPDYQTRFISRMTS 292

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 6/111 (5%)
 Frame = +1

Query: 307 DNPNELKLKNQIEPASVPAGSTAYFMN------NFASSKKVEAQKIQDYETLMSARVHSF 468
           +N ++L + N +E   V         N      +F SS   +     D++      + S 
Sbjct: 313 ENSSDLMISNPVEQFPVDKNGFVKINNPKHNRYSFISSASTDV----DFDWFNQMNLQSN 368

Query: 469 GNYTNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKL 621
            NY NLQ+ S I   +++++   L  +     +  I+QL Q+I  LR   +
Sbjct: 369 NNYLNLQRNSMIQQQQQQQQQPNLSNTTASKIDNRIEQLEQEIANLRAQNM 419

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
            (REAL)
          Length = 632

 Score = 36.6 bits (83), Expect = 0.22
 Identities = 25/85 (29%), Positives = 39/85 (45%)
 Frame = +1

Query: 1231 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTK 1410
            EG+S  +N N  +TNI    F +E Q    ++   +   +  D   DS   +    TLT 
Sbjct: 473  EGESSNNNENLNNTNIGNDNFEEEVQKQFDLTE-QNYIDEYDDLAHDSSEGEYEPSTLTP 531

Query: 1411 EDNVSKNLEGKSKEDVKEMRNITEN 1485
            E+N S N+E +  E   E  ++  N
Sbjct: 532  EENTSHNVEEERIESTSETTDLDGN 556

>Ecym_6039 Chr6 (74519..77635) [3117 bp, 1038 aa] {ON} similar to
            Ashbya gossypii ADR168C
          Length = 1038

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 12/125 (9%)
 Frame = +1

Query: 1171 TNNIYSKNQFNVVRRRNARKEGDSK------LHNSNFRS-----TNIAKAFFNDEFQNPD 1317
            T N  SK Q ++    N+ +E + +      ++ SN  S     T  A  F N +F N D
Sbjct: 44   TVNSDSKLQSSITTAENSVEENEPEADTFVPINESNLESITTPTTMKAHKFTNYKFNNKD 103

Query: 1318 IISNLDSKRRKLKDAKRDSELIKELN-KTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
             ++    K RK    KR  E++++ + +++ +EDN+    +GK+K   ++   +TE   Q
Sbjct: 104  SLNT--DKVRKTGFVKRLDEILQKRSMESMLQEDNLEDVSDGKAKAKKQKSNKLTELDQQ 161

Query: 1495 IGMLK 1509
               LK
Sbjct: 162  FKDLK 166

>KLLA0A03905g Chr1 complement(345818..350470) [4653 bp, 1550 aa] {ON}
            similar to uniprot|P19524 Saccharomyces cerevisiae
            YOR326W MYO2 One of two type V myosins involved in
            polarized distribution of mitochondria required for
            mitochondrion and vacuole inheritance and nuclear spindle
            orientation moves multiple cargo
          Length = 1550

 Score = 36.2 bits (82), Expect = 0.32
 Identities = 40/171 (23%), Positives = 82/171 (47%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1225 RKEGDSKLH-NSNFRSTNIAKAFFNDEFQNPDIISNLDSK---RRKLKDAKRDSELIKEL 1392
            R+ GD+ +    + RS    K+F +++ +   +I +   K   +RKLK  K +++ +  L
Sbjct: 876  RRRGDAAVTIQKSVRSFQPRKSFLHEK-KGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHL 934

Query: 1393 NKTLTKEDN----VSKNLEGKSKED---VKEMRNITENIMQIGMLKNIGYDPTHGKMKYL 1551
             +   K +N    ++++L  K KE+   V  + N+ +++ +   +K+   +   G  K L
Sbjct: 935  QEVSYKLENKVIELTESLASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKAL 994

Query: 1552 MKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRK--RDEI 1698
              + +  +  Y       VND L   K+++     + D L+ K+K  +DEI
Sbjct: 995  ADQKSIHEEEY-----GKVNDQLIAAKEEIISAKAEVDELLNKQKNLKDEI 1040

>TBLA0E04240 Chr5 complement(1074492..1080962) [6471 bp, 2156 aa] {ON}
            Anc_8.238 YER172C
          Length = 2156

 Score = 36.2 bits (82), Expect = 0.33
 Identities = 34/171 (19%), Positives = 74/171 (43%), Gaps = 11/171 (6%)
 Frame = +1

Query: 1231 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTK 1410
            E D+  +N++ ++  I +    +     ++IS  D+   K+K    D   ++   KT+  
Sbjct: 241  EADNTHNNTSTKNHPIREPIIFESSNKDELISLADTSPLKVKIYSVDEYYLERKLKTMLP 300

Query: 1411 EDNVS--KNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSY 1584
            + N +  K+LE      +  +  + ++ ++  +  N+ Y+ T     +L    N ++  +
Sbjct: 301  DLNYNQLKDLENNILLYISNLDKLPKDDLEKKIFDNLDYENT----SFLNTIINNRNEIF 356

Query: 1585 ---------TSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEY 1710
                       NR+  +ND+   +   +    LK D   KKRK + + +EY
Sbjct: 357  WGIKLARASEQNRAEILNDMRKNELSSLVSDYLKEDASQKKRKANSLEDEY 407

>NCAS0B06630 Chr2 (1257281..1257766) [486 bp, 161 aa] {ON} Anc_2.215
            YIL138C
          Length = 161

 Score = 34.3 bits (77), Expect = 0.43
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +1

Query: 1228 KEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 1407
            KE   ++   N    N  K+      Q  + +  L+ +  + K    DS  +K  N   T
Sbjct: 26   KEQFKQVEQDNVEKENQIKSLTTKNQQLDEEVEKLEEELSESKQLAEDSSNLKSNNDNFT 85

Query: 1408 KE----DNVSKNLEGKSKEDVKEMRNITENIMQIG 1500
            K+    +   + ++GK KE ++++R    N  Q+G
Sbjct: 86   KKNEQLEEELEEIDGKLKETIEKLRESDLNAEQLG 120

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 8/113 (7%)
 Frame = +1

Query: 145 KVSRAVDPN---FISTEGNVDATSESRIQVPG--SPEKIKRKHTQ--LAATPVTKKNTGI 303
           KV   V P    F+S + N+DA  +S+ Q P     +K K KH Q        T +NT  
Sbjct: 71  KVDEVVGPGGETFLSIDNNLDAFKDSQDQYPQQLQQDKDKEKHQQQKTQQQQQTDRNTAS 130

Query: 304 QDNPNELKLKNQIEPASVPAGSTAY-FMNNFASSKKVEAQKIQDYETLMSARV 459
              P          P S   G  A+ F N F SSK++     ++ E    +R+
Sbjct: 131 STPPG-------APPLSKENGKLAFRFKNMFKSSKEITGADAEEDENAKGSRM 176

>TPHA0C02310 Chr3 (521123..524017) [2895 bp, 964 aa] {ON} Anc_8.401
            YLR240W
          Length = 964

 Score = 35.4 bits (80), Expect = 0.53
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 8/118 (6%)
 Frame = +1

Query: 1099 ELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNI 1278
            ELN S       K +TN S Y +  + I SKN++N     N     ++   N+N   T  
Sbjct: 287  ELNSSMLQNNYKKNNTNGSNYNRAASKIGSKNEYNTQSVNNTNTGNNTV--NNNTMDTLG 344

Query: 1279 AKAFFND------EFQNPDIISN--LDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 1428
            AK           +F +PD  +   ++ K R+L+   + + L + L     K D ++K
Sbjct: 345  AKISTGTPYKSTLKFYDPDQYNTDPIEEKYRRLERTTKSTSLDRNLKPDAKKRDYLNK 402

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
            YHR158C (REAL)
          Length = 1168

 Score = 35.4 bits (80), Expect = 0.54
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 4/140 (2%)
 Frame = +1

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNP--DIISNLDSKRRKLKDAKRDSELIKELNKTLTKED 1416
            K+ +S+     + K     + QN   + I+++DS  + L  ++R+ E  K LNK L  E 
Sbjct: 1019 KMEHSSLSQDVLVKENEIKKIQNDYKESINSMDSASKALMVSQRELEKYKTLNKKLIDEL 1078

Query: 1417 NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSN- 1593
            +     E K K DV    ++       G   ++    T  + ++ +K ++ K   + +N 
Sbjct: 1079 D-----ELKFKNDVSSKDSVNGFKSTNGNFNDVENSNTIRENQFNIKINDLKAELFITNQ 1133

Query: 1594 -RSNAVNDLLHFKKDKVNLK 1650
             R N  N++L  KK  +NL+
Sbjct: 1134 ERDNLKNEVLELKKKLLNLE 1153

>KAFR0D00530 Chr4 (86030..88249) [2220 bp, 739 aa] {ON} Anc_1.55
            YDR505C
          Length = 739

 Score = 35.0 bits (79), Expect = 0.67
 Identities = 37/183 (20%), Positives = 69/183 (37%), Gaps = 20/183 (10%)
 Frame = +1

Query: 1192 NQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKR- 1368
            N +N ++  N         +N    +T I +    +  Q+  +I   D +    KD ++ 
Sbjct: 290  NYYNYLQNSNPPSHYIKNTNNGTTATTAIIENTNGNNNQDNGLILVGDKQLTSSKDLQKL 349

Query: 1369 ---------DSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGY 1521
                      SEL+ E    +     V+ +   + +E+  + +      +      N+ Y
Sbjct: 350  YQNCGTNYFSSELVFEFTDYIKSMLTVTNSTAEEEQEETSQTKERMLRFLSFLKSCNLNY 409

Query: 1522 DPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHF--------KKDKVNLK--PLKSDLL 1671
            +P         KK     PS T+N+S   +  LH+        K  K+ L   P  S+L+
Sbjct: 410  NPQSDAFISRSKKEQIMSPSSTTNKSKNTSTYLHYKPLLLVALKNGKLELLSIPQNSNLI 469

Query: 1672 MKK 1680
            MK+
Sbjct: 470  MKR 472

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
            Ashbya gossypii AER241W
          Length = 854

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 36/161 (22%), Positives = 73/161 (45%), Gaps = 4/161 (2%)
 Frame = +1

Query: 1228 KEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 1407
            KE +  L  + + S          + +N D  + L+ +R +LK   R    +   N +LT
Sbjct: 566  KEREIALWENKYESLKQTYENMLKQDRNNDFNNILEQRREELKSLMRRYNDLTTENLSLT 625

Query: 1408 KEDNVSKNLEGKSKEDVKEMRN----ITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKD 1575
            KE N  K+ +   KED+K++++    IT+  ++I      G +      K+  K      
Sbjct: 626  KELNKQKSHKESYKEDLKKVQSRLDFITKEFVKIKEANPDGKELDGVNSKWTEK------ 679

Query: 1576 PSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEI 1698
              Y S ++  +N+L   + + + L+  +  L ++K+++  I
Sbjct: 680  --YQSMKTKMLNELKSLQDENLELE--RKFLNLQKQQQQPI 716

>ZYRO0B00484g Chr2 complement(28527..31286) [2760 bp, 919 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 919

 Score = 35.0 bits (79), Expect = 0.69
 Identities = 47/203 (23%), Positives = 76/203 (37%)
 Frame = +1

Query: 1129 PTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQ 1308
            P+    + +  KKK N   S    +         +G  + H         AK        
Sbjct: 286  PSSTSKSSAKRKKKNNKKKSAPNGSNTTEETPVADGGEEEHLEAKYKEVCAKLESTKASL 345

Query: 1309 NPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENI 1488
            N D     D+ + KLK +    +  KE  + L KE    +    KSK+ +KE ++  E  
Sbjct: 346  NADWQGRYDALKAKLKTSVHSKDDFKEKLEKLEKEYGQLEEELSKSKDVIKEKQSEIEET 405

Query: 1489 MQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDL 1668
                M+K IG +    K K  +K+S+G D            D+ H + +   L+  +++L
Sbjct: 406  RD--MMKIIGNELVDAKDK--LKESSGVDK----------EDMAHLEDE---LRKARTEL 448

Query: 1669 LMKKRKRDEIWNEYFGDQSKSNR 1737
                 K  E  NE     S  N+
Sbjct: 449  SSLTEKLAEKENELTSTLSSMNQ 471

>TBLA0B07540 Chr2 complement(1792231..1795248) [3018 bp, 1005 aa] {ON}
            Anc_5.123 YLR045C
          Length = 1005

 Score = 35.0 bits (79), Expect = 0.70
 Identities = 52/232 (22%), Positives = 87/232 (37%), Gaps = 21/232 (9%)
 Frame = +1

Query: 1    MNDPREVFEN-------DLFDNISPXXXXXXXXXXXXXXXXRQKRDLQERLEYKRKVSRA 159
            MN+P E  +N         +D I P                +Q     E +  ++  +  
Sbjct: 546  MNEPLEKLDNLKEKKINQYYDKIIP----------------KQSSKKLEAVPMRKPSNNN 589

Query: 160  VDPNFISTEGNVDATSESRIQVPG--------------SPEKIKRKHTQLAATPVTKKNT 297
             D   IST    ++TS S   VP               SP+  +   T  + +  T  N 
Sbjct: 590  KDTTSISTSTISNSTSNSDSSVPSKRGPTSPLKKNKDYSPKSSRVTLTTQSLSTTTTANN 649

Query: 298  GIQDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNY 477
               +N N L   N I+P++    ST+  +      KK++     D+E L   R ++  N 
Sbjct: 650  NNNNNNNNLLSSNIIQPSTTIPNSTSNNVMENVQFKKIK----NDFEIL--KRQNNDLNI 703

Query: 478  TNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKI 633
               +K S+I N+ E+         R+ +   TI+   ++  IL LN  +  I
Sbjct: 704  ELREKNSKIHNLNEENLQ-----LRKQINNMTINLQDKENSILNLNSKYNNI 750

>TPHA0F01590 Chr6 complement(365642..370519) [4878 bp, 1625 aa] {ON}
           Anc_2.191 YOR093C
          Length = 1625

 Score = 35.0 bits (79), Expect = 0.74
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = +1

Query: 469 GNYTNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKL 621
           G Y + +KE+ II++ EK K S +   + YL+ E +   L+  ++ +++K+
Sbjct: 181 GRYNHYEKETAIISINEKNKESSITWGKLYLRAEKVAHELKKSQLKKMDKV 231

>NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa] {ON}
            Anc_5.267
          Length = 1876

 Score = 35.0 bits (79), Expect = 0.74
 Identities = 24/114 (21%), Positives = 52/114 (45%)
 Frame = +1

Query: 1153 SLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNL 1332
            +L +K++ N+   NQ N+     +R       H     S +  +    +E  N   +S L
Sbjct: 1037 TLSRKESKNL--GNQLNLKEAEISRLRSKMDQHQKEIISVSNQRDELINEQNNA--VSEL 1092

Query: 1333 DSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
            +  +++L   K + + ++E  K L      ++NL+   +ED   +RN+ + + +
Sbjct: 1093 NRTKKELSSIKLEYQKLEEEMKILKSHSEETQNLQKGQQEDTSRVRNLEKRLSE 1146

>NDAI0B01350 Chr2 (312621..314684) [2064 bp, 687 aa] {ON} Anc_2.596
          Length = 687

 Score = 34.7 bits (78), Expect = 0.86
 Identities = 42/197 (21%), Positives = 85/197 (43%), Gaps = 7/197 (3%)
 Frame = +1

Query: 1117 ALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFN 1296
            +LG+P       +++K       +KN  N  R+ N+    + + H  N   ++  ++  +
Sbjct: 25   SLGSPFSQKKKHNIFKNIHVFFKAKNNNNNNRKDNSTGIFNEEYHRQNQPHSSARRSTED 84

Query: 1297 DEFQNPDIIS---NLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEM 1467
            +   N +I+S   N  S + KL+ A  ++E  + +N  +      S      + +D   +
Sbjct: 85   ETLYNDEIVSSSRNSSSLKLKLQTAYDENEK-ENINNGIVSNKLTSIISSENALDDNNIL 143

Query: 1468 RNITENIMQIGMLKNIGYDPT----HGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKD 1635
            R+     +    + NI Y PT    H + K +  K  G   S +S+ ++  N   +    
Sbjct: 144  RSPISKSITTNEI-NILYSPTLQNKHIRTKSISSKV-GTPLSLSSSSNSRRNSFSNINNT 201

Query: 1636 KVNLKPLKSDLLMKKRK 1686
              N++  +SD + K+RK
Sbjct: 202  INNIRIHRSDSIKKERK 218

>KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.371
            YCR091W
          Length = 786

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 38/179 (21%), Positives = 65/179 (36%), Gaps = 13/179 (7%)
 Frame = +1

Query: 1147 NPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIIS 1326
            NP    K  N + SK+        NA   G    H  +  S++    F + +  +PD  S
Sbjct: 15   NPKGRSKSFNKLLSKSWKRSTSSSNASLSGTMSDHKKSNSSSH--NYFEDSKASSPDTNS 72

Query: 1327 NLDSKRRKLKDA------------KRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMR 1470
             L SK  KL+              + +   IK ++     +D    ++   +     +  
Sbjct: 73   PLGSKFSKLRSLFGSEASLRSGSDEINIPKIKHISPLAPADDENFSHIPSTNFPKSPKNA 132

Query: 1471 NITENIMQIGMLKNIGYDPTHGKMKYLMKKSNG-KDPSYTSNRSNAVNDLLHFKKDKVN 1644
            ++ ++       +N  Y+  H    +  + S   K PS TSN S+     LH   D  N
Sbjct: 133  HLEDHYHPYETAQNATYEKQHSSSSHSGQSSTTEKPPSSTSNLSSQFKSFLHVSNDNQN 191

>YNL102W Chr14 (430087..434493) [4407 bp, 1468 aa] {ON}  POL1Catalytic
            subunit of the DNA polymerase I alpha-primase complex,
            required for the initiation of DNA replication during
            mitotic DNA synthesis and premeiotic DNA synthesis
          Length = 1468

 Score = 34.7 bits (78), Expect = 0.96
 Identities = 41/160 (25%), Positives = 68/160 (42%), Gaps = 10/160 (6%)
 Frame = +1

Query: 1171 TNNIYSKNQFNVVRRRNARKEGDSK----LHNSNFRSTNIAKAFFNDEFQNP-----DII 1323
            T N+ SK+     R++N ++E D +    L   + +ST +A A  + +   P     DI+
Sbjct: 88   TGNLASKDS---KRKKNIKREKDHQITDMLRTQHSKSTLLAHAKKSQKKSIPIDNFDDIL 144

Query: 1324 SNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGM 1503
               +S   +  +    S+L + LN + T E           K  +K +    E+    G+
Sbjct: 145  GEFESGEVEKPNILLPSKLRENLNSSPTSE----------FKSSIKRVNGNDESSHDAGI 194

Query: 1504 LKNIGYDPTHGKMKYL-MKKSNGKDPSYTSNRSNAVNDLL 1620
             K +  DP     KYL ++ S  K  S     +N V DLL
Sbjct: 195  SKKVKIDPDSSTDKYLEIESSPLKLQSRKLRYANDVQDLL 234

>TPHA0A02470 Chr1 (528174..529766) [1593 bp, 530 aa] {ON} Anc_3.393
            YBR130C
          Length = 530

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 3/85 (3%)
 Frame = +1

Query: 1240 SKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDN 1419
            SKL  S  +   + +   + + +N +I   L+ K RKLKD + +   + E +KTL  E+ 
Sbjct: 109  SKLEASQLKEIKLQEQITSLKNENENINQILNRKTRKLKDLETEFNSLFEAHKTLKSENT 168

Query: 1420 VSKNLEG---KSKEDVKEMRNITEN 1485
               N  G   K++  +K+   + EN
Sbjct: 169  ELNNNFGSISKNESILKQKFEMVEN 193

>NDAI0A06260 Chr1 complement(1419611..1421209) [1599 bp, 532 aa] {ON}
            Anc_3.37 YNL309W
          Length = 532

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 1/128 (0%)
 Frame = +1

Query: 1066 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSK 1245
            T+ +  +   IEL  S  L +PTK   +  +  K  N   SK     ++ RN        
Sbjct: 79   TDSKKRSGDAIELTTSINLISPTKKHQSEDINNKSKNTSESK-----IKNRNESP----- 128

Query: 1246 LHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSEL-IKELNKTLTKEDNV 1422
               +N   + I+K+  N      DI         K  + K  SEL ++E +K ++++DN+
Sbjct: 129  ---NNLGYSKISKSISNKLLPQIDI---------KTSEDKSTSELTMEEQDKEISEQDNI 176

Query: 1423 SKNLEGKS 1446
             K+ E  S
Sbjct: 177  DKSTETPS 184

>TPHA0C01360 Chr3 (309327..310937) [1611 bp, 536 aa] {ON} Anc_7.204
            YFR037C
          Length = 536

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 4/121 (3%)
 Frame = +1

Query: 1330 LDSKRRKLKDAKRD--SELIKELNKTLTKE-DNVSKNLEGKSKEDVKEMRNITENIMQIG 1500
            LD+K+  L D K    ++ I  L  +L K  D  S   + K+ E +KE + + E +    
Sbjct: 366  LDTKKTPLDDEKLRLITKTINSLKLSLEKNIDEKSARDDEKTNELIKESQPVIEELKNTA 425

Query: 1501 MLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNL-KPLKSDLLMK 1677
            + K    D    K+  L +K      SYT    N  ND +   K  +++ K L +  + K
Sbjct: 426  LSK---IDTEFKKLYELERKLKMSLDSYTKEHENLTNDRMMLSKQILSINKELSNSNVEK 482

Query: 1678 K 1680
            K
Sbjct: 483  K 483

>TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7.191
            YFR034C
          Length = 714

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 25/179 (13%)
 Frame = +1

Query: 1162 KKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISN---- 1329
            +KK NN   + +   + RR+        LH++ +  +   K F  D F+N  + +N    
Sbjct: 476  QKKINNKRDQRKSETIDRRSIN------LHSNGYNHSQNNKLFKTDSFENDKLCNNSINA 529

Query: 1330 -LDSKRRKLKDAK-----RDSELIKELNKTLTKEDNVSKNLEGKSK-------------E 1452
               +K+   K A+     R +  +KELN  L +E     N+  K+               
Sbjct: 530  PTHNKKEVHKVAEQGRRDRMNNALKELNSLLPEELKDEVNVPSKATTVELACTFIKQLLS 589

Query: 1453 DVKEMRNI--TENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLH 1623
            + K  +N+  T+N  QI +     +   H K        NG + +  +N  N  +D+++
Sbjct: 590  ERKLCQNLIQTQNQSQIQIQDQDQHSQQHFKQDDASDDDNGINDNNGNNNGNTNHDIIN 648

>TPHA0C03680 Chr3 (801572..804313) [2742 bp, 913 aa] {ON} Anc_2.346
            YMR164C
          Length = 913

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 42/188 (22%), Positives = 80/188 (42%), Gaps = 15/188 (7%)
 Frame = +1

Query: 1216 RNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRK--LKDAKRDSELIKE 1389
            ++A  +GD+   NSN  ST  +K        N   I ++DS +     K  K   +++KE
Sbjct: 433  KSANNDGDNYNENSNADSTKSSK--------NEKSIGDVDSSQVMDWSKSQKERVKVMKE 484

Query: 1390 LNKTLTKED------NVSKNLEGKSKED--VKEMRNI--TENIMQIGMLKNIGYDPTHGK 1539
              + L ++         + NLE KS+++  VK+  NI   +NI  I    ++     +  
Sbjct: 485  QQQNLIQQHVTQQQRGKNSNLEDKSEKNKAVKDNVNINDNDNINPIQNNSDVDMRNQYMM 544

Query: 1540 MKYLMKKSNGKDPSYTSNR---SNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEY 1710
            M  +M  S G    +   +       N ++  +     L+ L+  + MK+  +D++ N  
Sbjct: 545  MVQMMMMSKGDQQLHQGKQQIPQQMQNSMIPQQLQHFQLQQLQMQMQMKQFSKDQMKNSS 604

Query: 1711 FGDQSKSN 1734
                + +N
Sbjct: 605  TNTNNNNN 612

>NCAS0B06430 Chr2 (1214203..1218609) [4407 bp, 1468 aa] {ON} Anc_2.253
            YIL115C
          Length = 1468

 Score = 34.3 bits (77), Expect = 1.3
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 20/75 (26%)
 Frame = +1

Query: 1291 FNDEFQNPDIISNLDSKRRKLKDAKRDSEL--------------------IKELNKTLTK 1410
            FN E +    I+++DS  + LKD KR SEL                    ++E + + T 
Sbjct: 883  FNKELKEEKQIASVDSSEQPLKDIKRQSELSTASDTEFRIPSNGTDNKEAVEEESASNTS 942

Query: 1411 EDNVSKNLEGKSKED 1455
             DN S + EGK + +
Sbjct: 943  TDNESSDFEGKKENE 957

>CAGL0M10109g Chr13 (1006975..1008366) [1392 bp, 463 aa] {ON} similar
            to uniprot|P36075 Saccharomyces cerevisiae YKL090w
          Length = 463

 Score = 33.9 bits (76), Expect = 1.4
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 4/127 (3%)
 Frame = +1

Query: 1120 LGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIA-KAFFN 1296
            L +  KAD N S + K  NNI +     ++R  N  +E  SK + +N  S  +A  +   
Sbjct: 117  LSSTVKADENTSKWGKTHNNIET-----IIRYTNVDRERASKYYTNNLFSAPLAIISIIR 171

Query: 1297 DEFQNPDIISNLDSKRRKL---KDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEM 1467
            D ++ P IIS  ++  RK    K A R   +         K++     L+ K++   + +
Sbjct: 172  DGYEQP-IISKTNTTNRKTAFRKGAIRGGRVQSSHGIAHRKQN----GLDLKTENSFEHL 226

Query: 1468 RNITENI 1488
             ++T+N+
Sbjct: 227  CDVTDNM 233

>KAFR0A03530 Chr1 (723286..725073) [1788 bp, 595 aa] {ON} Anc_1.284
           YJL083W
          Length = 595

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 32/141 (22%), Positives = 56/141 (39%), Gaps = 26/141 (18%)
 Frame = +1

Query: 235 PEKIKRKHTQLAATPVTKKN-------TGIQDNPNELKLKNQIEPASVPAGSTAYFMNNF 393
           P+K K   TQL  T   K N       T ++ N +   ++N   P S  + S A  + + 
Sbjct: 325 PKKHKNSETQLGITESNKNNHAHNKLKTTLRKNADGFSIENDELP-STDSDSVASDVQSS 383

Query: 394 ASSKKVEAQKIQDYETLMSARVH----SFGNYTNLQKESQI---------------INVE 516
              KK + ++ +  E L             N  ++ K+ +I               IN  
Sbjct: 384 NDKKKKKKKRTKIKEKLKKTNNEIKNIKSNNIDDISKKFRIFNEDKPWKYHRNVDFINEN 443

Query: 517 EKEKYSGLWISRRYLKEETID 579
           E+++Y G+W+S R+     +D
Sbjct: 444 ERKRYEGVWVSNRFRHLNLLD 464

>TDEL0D00520 Chr4 (94918..96915) [1998 bp, 665 aa] {ON} Anc_4.364
            YJR134C
          Length = 665

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 38/151 (25%), Positives = 65/151 (43%), Gaps = 12/151 (7%)
 Frame = +1

Query: 1081 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 1260
            AAAK          G+P ++ T   L  K++N I +    N  +  N   + +SKL  S+
Sbjct: 17   AAAKGKRKTKKQGTGSPAQSPTPIDLTNKQSNEISNAIVLNEPKAENENADDNSKLSQSS 76

Query: 1261 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAK---------RDSELIKELN---KTL 1404
              +T+IA    N E+ N D  + L+S R+    +             EL+K L    K +
Sbjct: 77   --ATDIA---LNGEYYNDDKDTFLNSLRKSKPWSSWLPADIHDLSSVELLKVLEPHIKEM 131

Query: 1405 TKEDNVSKNLEGKSKEDVKEMRNITENIMQI 1497
             K++     ++  +   VK ++   E I Q+
Sbjct: 132  VKQNMQPPKIDNSASSLVKVIKEKEEIISQL 162

>CAGL0J11660g Chr10 (1135618..1137852) [2235 bp, 744 aa] {ON} highly
            similar to uniprot|P04786 Saccharomyces cerevisiae
            YOL006c TOP1 DNA topoisomerase I
          Length = 744

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 2/100 (2%)
 Frame = +1

Query: 1315 DIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
            D +   D K +KLK ++  S   KE  K + K       ++ ++ ED+ E  +++    Q
Sbjct: 33   DPVPKKDEKEKKLKRSRELSSTSKEKTKKVKKIKTEKPAIKSENDEDIDEKMSLS----Q 88

Query: 1495 IGMLK--NIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAV 1608
            +  LK  N  +D    K K+   + N     + S + N V
Sbjct: 89   VAELKRENSTFDDEEEKYKWWENEKNDDTIKWVSLKHNGV 128

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
            [2388 nt, 796 aa]
          Length = 795

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 36/143 (25%), Positives = 64/143 (44%), Gaps = 8/143 (5%)
 Frame = +1

Query: 1189 KNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFN---DEFQNPDIISNLDSKRRKLKD 1359
            +N++  V+ + A++E ++    S  +             DE++  +    LD K      
Sbjct: 389  RNKYEEVQGKMAKQENEANNSASKLQLLEDELEILKNKLDEYEASETKLKLDYKELDELF 448

Query: 1360 AKRDSELIKELNK--TLTKEDNVSKNLEGKSKED-VKEMRNITENIMQIGM-LKNIGYDP 1527
             KR+ EL  + N+  TL +  N   N +  + ED VK++  ++ +  Q+ + L  I  D 
Sbjct: 449  QKREEELFSKANEVNTLQQSLNEIMNSQKSASEDLVKQIEELSTSKSQLEVKLSQISVD- 507

Query: 1528 THGKMK-YLMKKSNGKDPSYTSN 1593
             H K K YL  K NG +   + N
Sbjct: 508  -HSKEKHYLEDKINGMEKDLSEN 529

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 40/202 (19%), Positives = 79/202 (39%), Gaps = 3/202 (1%)
 Frame = +1

Query: 1090 KRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRS 1269
            K IE   +  L        N  L + K       ++F + + +    E ++K+ N+    
Sbjct: 550  KLIENENTLRLKDAEMDSLNNELNELKKQIASKDDEFKIWQSKYENVEDEAKIRNAEV-- 607

Query: 1270 TNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKE-LNKTLTKEDNVSKNLEGKS 1446
            T + +   +    N  +   +     K+ D + + +L KE   KT  + +++        
Sbjct: 608  TELNRDIDDLRESNLHLQETITELENKVHDLENEYDLEKENFEKTSLELESLQLKNSNIQ 667

Query: 1447 KEDVKEMRNITENIMQIGMLKNIGYD--PTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 1620
             E +KE+ N+ EN+M +        D   T  K   ++K+ N  + +  +  +N  +   
Sbjct: 668  AEHIKELENLHENLMSLQNELKFSSDRIATLTKENEILKEQNNSNNNSVTLSNNQKD--- 724

Query: 1621 HFKKDKVNLKPLKSDLLMKKRK 1686
               KD   +K L+  L   K K
Sbjct: 725  ---KDDEQIKLLRKQLQDWKEK 743

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 43/183 (23%), Positives = 81/183 (44%), Gaps = 12/183 (6%)
 Frame = +1

Query: 1186 SKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAK 1365
            SK +FN  R    RK  + K   SN R+T       ND  Q   I    + +  KL+   
Sbjct: 376  SKEKFNKYRGEMERKVFELK--TSNERTTE------NDAEQLDQIKKLYEDRVNKLQS-- 425

Query: 1366 RDSELIKELNKTLTKEDNVS---KNLEGKSKEDVKEM---RNITENIMQIGMLKNIGYDP 1527
            +++ L+KE+ +  TKE NV      LE K  ++ K++   RN  ++   +  ++ +  + 
Sbjct: 426  KNNSLLKEIAQLQTKESNVKSKLSELETKYSKNTKQLTKDRNEAKDRELLAKMEELQKNG 485

Query: 1528 TH-GKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLL-----MKKRKR 1689
                K++  ++++  ++    S       ++    K+   L  + S+LL     +K   R
Sbjct: 486  AELNKVEKKLQETESENNKLNSELFQKSQEISKLSKELDGLSGVNSELLEENKSLKTSVR 545

Query: 1690 DEI 1698
            D+I
Sbjct: 546  DKI 548

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 25/109 (22%), Positives = 55/109 (50%)
 Frame = +1

Query: 1354 KDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTH 1533
            ++ K+++++IK  N    K DN  K+   + +E   + +++T ++ QI   K   Y    
Sbjct: 329  ENLKKNNDVIKNFNTENYKHDNQVKDFISQIEELHDDKKSLTRDL-QISKEKFNKYRGEM 387

Query: 1534 GKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKK 1680
             +  + +K SN +    T N +  ++ +    +D+VN    K++ L+K+
Sbjct: 388  ERKVFELKTSNERT---TENDAEQLDQIKKLYEDRVNKLQSKNNSLLKE 433

>Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL250W
           (RAD50) - Contains a purine-binding domain, two heptad
           repeats and a hydrophobic tail. [contig 116] FULL
          Length = 1298

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 10/121 (8%)
 Frame = +1

Query: 124 ERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAAT-----PVTK 288
           E L+  R  SRA   N  + E  V+       QV    ++I  +  +L  +      V  
Sbjct: 209 EHLKLDRDRSRATKINISTLEKRVEEYKAQAKQVDEQLDEITEQSDRLFKSNQEFQQVLS 268

Query: 289 KNTGIQDNPNELK-----LKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSA 453
           K  G+Q + N LK     +++ IEP  +        +NNF+ + + +  + +D E  + A
Sbjct: 269 KMEGLQHSQNSLKEQITRIESTIEPLDLSRSELETLLNNFSHALEEKKVRSRDLERELHA 328

Query: 454 R 456
           +
Sbjct: 329 K 329

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
            Anc_6.21 YOR007C
          Length = 377

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 72/298 (24%), Positives = 119/298 (39%), Gaps = 21/298 (7%)
 Frame = +1

Query: 904  SFNLSIQTKYDCIIEIGKSRDLGWCNVPVK--SKGGKPCGTPINKTKDKCCEFHRETEFR 1077
            + N+S+QTK         SR+    NVPVK      +   T ++    K  E  +E    
Sbjct: 84   TINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEETKETKVSNDDMKKAEKLKEKGNE 143

Query: 1078 NAAAKRIELNGSFALGAPTKA----DTNPSLYKKKTNNIYSKNQFN-VVRRRNARKEGDS 1242
               AK+     S A+G+ + A     TN + Y  +       N F+  +   N   E DS
Sbjct: 144  EMKAKQY----SKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDS 199

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNV 1422
            K+H +NF      KA++       +I          L   KR  E+ +E N    K D +
Sbjct: 200  KIHPTNF------KAYYRLGLAKYEI----GDYEGSLAAFKRMIEIAQENN----KGDEI 245

Query: 1423 SKNLEG---KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSN 1593
            +K ++    K+KE V+E+       MQI   K+ G            K+ +G   +    
Sbjct: 246  TKQMDADYEKAKEKVQEL-----FFMQI--TKSTG------------KEGSGNSVNDGPK 286

Query: 1594 RSNAVNDLLHFKKDKVNL---KPLKSDLL--------MKKRKRDEIWNEYFGDQSKSN 1734
            R   +ND+L+   + +N+    PL  +++          K++ D + N+    Q K N
Sbjct: 287  RKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKEN 344

>SAKL0G17248g Chr7 (1492432..1497204) [4773 bp, 1590 aa] {ON} similar
            to uniprot|Q04958 Saccharomyces cerevisiae YML059C NTE1
            Serine esterase that deacylates exogenous
            lysophospholipids homolog of human neuropathy target
            esterase (NTE) mammalian NTE1 deacylates
            phosphatidylcholine to glycerophosphocholine
          Length = 1590

 Score = 33.9 bits (76), Expect = 1.7
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 1/98 (1%)
 Frame = +1

Query: 1141 DTNPSLYKKKTNNIYSKNQFNVVRR-RNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPD 1317
            ++N S   KKT++  S    N+    RN+ +E DS       RS+        D+F   D
Sbjct: 481  NSNDSKSTKKTSSRPSIKHTNLKESFRNSPQETDSL----GIRSSRHVVLDSRDQFNPGD 536

Query: 1318 IISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 1431
            ++SN+   R++      +S ++K +N +   E + SKN
Sbjct: 537  LLSNVPLSRKEFTPTTSNSSIVKAINNSKNNESS-SKN 573

>Kpol_431.7 s431 (17811..18572) [762 bp, 253 aa] {ON} (17811..18572)
            [762 nt, 254 aa]
          Length = 253

 Score = 33.1 bits (74), Expect = 1.7
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 3/139 (2%)
 Frame = +1

Query: 1153 SLYKKKTNN---IYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDII 1323
            SL K+  N+   + +KN+    +           LH    R TN        EF + D  
Sbjct: 130  SLNKESDNHKVFVDNKNELKNFKPEVYFNTSKELLHKRENRLTN--DQLLETEFSSFDST 187

Query: 1324 SNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGM 1503
             N   KR+KLK+ K        + ++  K ++  KN+E        +  N+   +M+ G 
Sbjct: 188  VNESLKRKKLKNLK--------IMQSHIKRESELKNIE--------QRMNLQREVMKNGS 231

Query: 1504 LKNIGYDPTHGKMKYLMKK 1560
             K I  DP  GK+ +  KK
Sbjct: 232  KKKI-TDPKTGKISFKWKK 249

>AFL125W Chr6 (199903..201540) [1638 bp, 545 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR173W (DDR48)
          Length = 545

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 36/169 (21%), Positives = 70/169 (41%), Gaps = 11/169 (6%)
 Frame = +1

Query: 1141 DTNPSLYKKKTNNIYSKNQFNVVRRRNARKEG--DSKLHNSNFRSTNIAKAFFNDEFQNP 1314
            D++ + Y+ K ++  +K   N    ++  K+   D   + +   + +  K    DE ++ 
Sbjct: 134  DSSKNTYESKKSDSDNKYDSNKDENKDENKDENKDENKNENKDENKDENKDENKDENKDE 193

Query: 1315 DIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
            +   N D  + K +D  +D +  K+ NK   K  + +KN +       +   + T+N   
Sbjct: 194  NKNENKDENKNKDEDKNKDEDKNKDENKDENKNKDENKNKDENKDSKNENKTDSTKN--S 251

Query: 1495 IGMLKNIGYDPTH-------GKMKYLMKKSNG--KDPSYTSNRSNAVND 1614
             G  K   Y   +        K  Y  K S G  K  SY+S+  N+ ++
Sbjct: 252  YGSSKKNSYGSKNSDDGKDDSKDTYGSKNSYGSSKKDSYSSSNKNSYDN 300

>TBLA0D04170 Chr4 complement(1032961..1033815) [855 bp, 284 aa] {ON}
            Anc_7.227 YIL044C
          Length = 284

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 47/199 (23%), Positives = 72/199 (36%)
 Frame = +1

Query: 1042 KCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRN 1221
            KC   HR      +  K ++L+         K +   SL + K N+I      N +    
Sbjct: 46   KCAGIHRSMGTHISKVKSVDLD-------IWKEENLISLIRMKNNDIA-----NAIYEYG 93

Query: 1222 ARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKT 1401
                G   L++SN             E QN   I N   K+R + D  R  ++++  N  
Sbjct: 94   LGDNGKKVLNDSN-------------EIQN--FIRNKYEKKRWICDDARMEDILRMGNAD 138

Query: 1402 LTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS 1581
            L +E  V KN      E V+E +N+  N        N   D            +N    +
Sbjct: 139  LPQEKKVMKN------EVVRESKNVVNN------TNNNTSD----------NNNNNNSNN 176

Query: 1582 YTSNRSNAVNDLLHFKKDK 1638
            Y +N+S   N LL  +  K
Sbjct: 177  YYNNKSANTNSLLDLQTSK 195

>TBLA0A08490 Chr1 complement(2085721..2088366) [2646 bp, 881 aa] {ON}
            Anc_4.26 YLL032C
          Length = 881

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
 Frame = +1

Query: 1441 KSKEDVKEMRNITENIMQIGMLKNIGYDPTH--GKMKYLMKKSNGKDPSYTSNRSNAVND 1614
            K    +KE RNI + I +    +  G DPT    + K+  + SN +  +Y SN  N   +
Sbjct: 713  KQNNSIKERRNIEDFISRTDTPEKTGDDPTSLLNRNKHDAQNSNNQHNNYMSNNVNNGRN 772

Query: 1615 LLHFKKDKVNL 1647
                 K++VNL
Sbjct: 773  YNSPTKNRVNL 783

>NDAI0F02230 Chr6 (539524..542223) [2700 bp, 899 aa] {ON} Anc_6.175
            YPL180W
          Length = 899

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 29/125 (23%), Positives = 52/125 (41%), Gaps = 11/125 (8%)
 Frame = +1

Query: 1132 TKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNF--RSTNIAKAFFNDEF 1305
            TK+D + SL +K ++++   N F    + +   + DS+     +  R ++I      ++ 
Sbjct: 616  TKSDLSASLNRKTSSSVLKTNNFQAFLKSDDNDDDDSRTQRKLWLQRESSIMDLNLQNDN 675

Query: 1306 QNPDII---SNLDSKR------RKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDV 1458
             NPD I   SN++ KR       +  + KR S  + E    L   +  +K   G S    
Sbjct: 676  NNPDSIFMASNIEVKREFERITHEYINVKRFSNPLNEALAKLESLEKPTKLTRGSSSSPA 735

Query: 1459 KEMRN 1473
                N
Sbjct: 736  ATTNN 740

>KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} similar to
            uniprot|Q06704 Saccharomyces cerevisiae YLR309C IMH1
            Protein involved in vesicular transport mediates
            transport between an endosomal compartment and the Golgi
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 927

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +1

Query: 1204 VVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELI 1383
            V R  +  KE  +  + S+  S  + +A  N       + + L +  +KL++ +  SE I
Sbjct: 755  VARLTSLNKEMQTTRNESSQSSNELKEALAN-------VKAALMTSEKKLREMESSSENI 807

Query: 1384 KELNKTLTKE-DNVSKN 1431
            KELN  LTK+ + +SKN
Sbjct: 808  KELNDDLTKKLERISKN 824

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 44/197 (22%), Positives = 76/197 (38%), Gaps = 12/197 (6%)
 Frame = +1

Query: 1153 SLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFN-DEFQNPDIISN 1329
            S+ +K   N Y+  Q   +  RN  KE + K+         I+K  F  D  +N      
Sbjct: 849  SIREKNYQNAYNTVQEMEIELRNL-KESEPKIE------LEISKLNFEIDSLEN-----E 896

Query: 1330 LDSKRRKLKDAKRDSELIKELNKTLTKEDNV-------SKNLEGKSKEDVKEMRNITENI 1488
               KR++L +      +   ++  +T+ DN         K +E + K     ++ + + I
Sbjct: 897  CSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDRIKELQDKI 956

Query: 1489 MQIGMLK----NIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPL 1656
            M+IG +K    N   D    + K L+KK   +        S+        +K    LK  
Sbjct: 957  MKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDV-------RKLSKKLKES 1009

Query: 1657 KSDLLMKKRKRDEIWNE 1707
            +SD      K+  + NE
Sbjct: 1010 ESDNTKLNEKKIALENE 1026

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930
           aa] {ON} (137817..142124,142127..143611) [5793 nt, 1931
           aa]
          Length = 1930

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 19/125 (15%)
 Frame = +1

Query: 175 ISTEGNVDATSESRIQVPGSPEK--IKRKHTQLAATPVTKKNT-----------GI---Q 306
           I+   +  +TS ++  +  SP+K  + ++ T     P+ KK+T           G    Q
Sbjct: 29  ITNSSSNSSTSINKADI-SSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQ 87

Query: 307 DNPNELKLKNQIEP---ASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNY 477
           DNPN L   N       +S  A   +Y   +  ++  ++  + Q  ++L S+ V S G+Y
Sbjct: 88  DNPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTATGPIKLSRQQTTQSLGSSSVLSQGSY 147

Query: 478 TNLQK 492
           TNL K
Sbjct: 148 TNLLK 152

>TPHA0D03840 Chr4 (805962..806531) [570 bp, 189 aa] {ON} Anc_6.326
           YNR024W
          Length = 189

 Score = 32.3 bits (72), Expect = 2.4
 Identities = 27/116 (23%), Positives = 48/116 (41%)
 Frame = +1

Query: 274 TPVTKKNTGIQDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSA 453
           TPVT K T    N   +K  N  E  + P G+ +  +NN  ++ K             SA
Sbjct: 5   TPVTGKLTSRVMNMKFMKFANNGEELTDPRGNASGALNNANANHKGRD----------SA 54

Query: 454 RVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKL 621
               F   +  + E   IN E  +K     ++R+ +K +    ++ ++ +  L +L
Sbjct: 55  ITKKFNEASEWKLERMKINPESSDKSVNTTLTRKIIKIKKTPTVVSNVGVASLQRL 110

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2.303
            YNL027W
          Length = 762

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 6/112 (5%)
 Frame = +1

Query: 1159 YKKKTNNIYSKNQ-FNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDII--SN 1329
            Y + T+NI   N  FN+ R        +S L   NF +TN  +   +D +  P+++   N
Sbjct: 7    YMEDTSNITPTNDSFNITR-----DTANSSLQGGNFTTTNNIENLMSDIYSEPEMLDDQN 61

Query: 1330 LDSKRRKLKDAKRDS---ELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNI 1476
              +K   L ++ R +    +    N TL  + N++ N   +S  D+ +  N+
Sbjct: 62   KYNKNGNLNNSIRTTPKLNIYNSNNITLNSQPNITMNETRQS--DINDYLNL 111

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 23/88 (26%), Positives = 44/88 (50%)
 Frame = +1

Query: 220 QVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVPAGSTAYFMNNFAS 399
           ++PGS  +IK++     ATP  + +T I  + N +   + ++PA+VPA          A+
Sbjct: 361 KLPGS--QIKQQTISREATPELQGHTHIHQSLNGITTTSTLKPATVPARPVGDLRWAAAA 418

Query: 400 SKKVEAQKIQDYETLMSARVHSFGNYTN 483
           S+  E +K  ++    +A+  S  +  N
Sbjct: 419 SQAAEKEKKAEHLNHQAAKSQSTSSSVN 446

>Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 36/171 (21%), Positives = 74/171 (43%), Gaps = 24/171 (14%)
 Frame = +1

Query: 1171 TNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFND--------EFQNPDIIS 1326
            TNNI  +N+ N+   +NA  E   K  ++     + ++   ND          +  D  S
Sbjct: 426  TNNILQRNEKNL-NEKNAELEKIKKELSTTLEKLSESQTTLNDLNSCIAQLNSKVGDTNS 484

Query: 1327 NLDSKRRKLKDAK-------------RDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEM 1467
             L SK  +L + K              DS+LI +LN+ ++ ++++ + L+  S  +   +
Sbjct: 485  VLISKESELNNLKISLKETLSISKDSNDSDLIAQLNELISAKNSLQQKLDDLSNLNDDNL 544

Query: 1468 RNITENIMQIGML---KNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVN 1611
            + + E +M+       K+   +  + +++ L K    KD  + + +S   N
Sbjct: 545  KKLQEKLMEDETALRRKDAEINSLNSELEELKKHVISKDNEFETWKSKYEN 595

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 41/185 (22%), Positives = 74/185 (40%), Gaps = 3/185 (1%)
 Frame = +1

Query: 1147 NPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRS-TNIAKAFFNDEFQNPDII 1323
            N  L + K + I   N+F   + +    E ++K+ N+     T         +    + I
Sbjct: 569  NSELEELKKHVISKDNEFETWKSKYENVEDEAKIRNAEVTELTRDIDDLKESKVHLQETI 628

Query: 1324 SNLDSKRRKLKDAKRDSELIKE-LNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIG 1500
            + L++   KL++   D +L KE   KT  + +++         E +KE+ N+ EN++ + 
Sbjct: 629  TELENHVHKLEN---DYDLEKEKFEKTSLELESLQLKNSNIQAEHIKELENLHENLLSLQ 685

Query: 1501 MLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFK-KDKVNLKPLKSDLLMK 1677
                I  +         + K N        N + +V    H K KD   +K L+  L   
Sbjct: 686  DELKISSERVTA-----LTKENETLKQNNDNNNKSVTLSNHQKDKDGELIKSLEKQLKDW 740

Query: 1678 KRKRD 1692
            K K D
Sbjct: 741  KEKYD 745

>TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2.16
            YNL225C
          Length = 1081

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 29/125 (23%), Positives = 57/125 (45%), Gaps = 12/125 (9%)
 Frame = +1

Query: 1141 DTNPSLYKKKTNNIYSKNQ----------FNVVRRRNARKEGDSKLHNSNFRSTNIAKAF 1290
            DT  +  K K N++ SK++            + ++ N   EG  ++ +   ++T +    
Sbjct: 793  DTIDTELKTKINDLTSKSRDLEIETKELKTEIEKKNNRIDEGICEIRDLKTQTTQLMNER 852

Query: 1291 FNDEFQNPDIISNLDSKRRKLKDAK--RDSELIKELNKTLTKEDNVSKNLEGKSKEDVKE 1464
                 +N D+ + L + +  + D    +  EL + LNK  T+ D++   L  K +E V+ 
Sbjct: 853  KLLTQKNIDLSTELTTVKGNIIDNHEIKLQELAESLNKISTRSDSLQNQLSTKDEEIVEL 912

Query: 1465 MRNIT 1479
             +NIT
Sbjct: 913  KKNIT 917

>Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] {ON}
            YMR190C (REAL)
          Length = 1443

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 42/143 (29%), Positives = 68/143 (47%), Gaps = 18/143 (12%)
 Frame = +1

Query: 1219 NARKEGDSKLHNSNFRSTNIAKAFF-NDEFQNPDIISN----LDSK------RRKLKDAK 1365
            N R   DSK HNS      IA +F  N+  +N D  +N     DSK      RR+L    
Sbjct: 119  NPRTPSDSKFHNSGTYRPPIASSFVENNSSRNLDCKNNNKTANDSKLIEKNLRRELLQL- 177

Query: 1366 RDSEL--IKELNKTLTKEDNV----SKNLEGKSKEDVKEMRNITENI-MQIGMLKNIGYD 1524
            +DS +  +KE +K L ++ N+    S + + K  +  +++R    NI ++IG L++    
Sbjct: 178  QDSLIAALKEQSKLLLQKCNLIESTSLSEDAKRLQLSRDIRPQLSNISIRIGFLESEITK 237

Query: 1525 PTHGKMKYLMKKSNGKDPSYTSN 1593
               G+M  +  K + + PS   N
Sbjct: 238  AKKGRMPKVPNKDHSQFPSQDDN 260

 Score = 32.3 bits (72), Expect = 4.9
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 6/117 (5%)
 Frame = +1

Query: 1255 SNFRSTNIAKAF--FNDEFQNPDIISN---LDSKRRKLKDAKRDSELI-KELNKTLTKED 1416
            ++FR T  A+     +D+ +   I+ +   L    ++L  +  D ELI  E       ED
Sbjct: 497  ASFRKTTGAEHIDLLDDDLEKDAILDDSMSLSFGHQRLPMSHSDIELIDSEKESGNYDED 556

Query: 1417 NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT 1587
            N + NLE  S  D+++     EN  Q+  +  +  D      + LM ++N + PS++
Sbjct: 557  NNNNNLEYLSDSDLEKFDEERENRTQVADIHELDNDLKIITERKLMDENNHRSPSWS 613

>YMR162C Chr13 complement(578951..583921) [4971 bp, 1656 aa] {ON}
            DNF3Aminophospholipid translocase (flippase) that
            maintains membrane lipid asymmetry in post-Golgi
            secretory vesicles; localizes to the trans-Golgi network;
            likely involved in protein transport; type 4 P-type
            ATPase
          Length = 1656

 Score = 33.1 bits (74), Expect = 2.9
 Identities = 33/148 (22%), Positives = 63/148 (42%), Gaps = 3/148 (2%)
 Frame = +1

Query: 1063 ETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDS 1242
            E E ++   K++EL     +      D +PS + + T+ + S+ + N            +
Sbjct: 1511 ELEQKSDIRKKLELGAYSEMRQGWTWDKDPSTFTRYTDKVLSRPRTN--------SRASA 1562

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELN-KTLTKEDN 1419
            K HNS+  S +       D     +   N   K  +  +     +LIK  + KT + +D+
Sbjct: 1563 KTHNSSIYSMSNGNV---DHSSKKNFFGNSSKKSSERYEVLPSGKLIKRPSLKTQSSKDS 1619

Query: 1420 VSKNLEGKSKEDVK-EMRNI-TENIMQI 1497
            +  N+  K  + +K   RN+  E++ QI
Sbjct: 1620 IGGNITTKLTKKLKLPSRNVEDEDVNQI 1647

>TPHA0A02930 Chr1 complement(635681..636922) [1242 bp, 413 aa] {ON}
            Anc_1.203 YJL147C
          Length = 413

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 46/196 (23%), Positives = 85/196 (43%), Gaps = 20/196 (10%)
 Frame = +1

Query: 1192 NQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRD 1371
            N  N++ +   R + D++   +  +   I  A  ND  + P   +N + K+ ++K  +  
Sbjct: 17   NSGNILNKNKNRVKDDNEELKNTIKYL-IQNANTNDSIKFP-YKNNSNIKKEQIKHIETI 74

Query: 1372 SELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKM--K 1545
            S +   LN++L + D   KN+E   +    +++NI E  +       I  +     +  +
Sbjct: 75   SNV---LNRSLPEVDVKKKNVEQHYQVLFSQLKNIVEKSISNTNSNTISNEDKTSTLYNE 131

Query: 1546 YLMKKSNGKDPSYTSNRSNA-VNDLLH--FKK---------------DKVNLKPLKSDLL 1671
             ++ K N + P   +NR N  +  LLH  FK+               D+VN+    S LL
Sbjct: 132  LMLLKYNNRTP---ANRVNTLIKILLHKDFKEYPKVWNNITFFDNRLDRVNI----SLLL 184

Query: 1672 MKKRKRDEIWNEYFGD 1719
              K    +I++ YF D
Sbjct: 185  FYKTHNQQIYDAYFDD 200

>YNL248C Chr14 complement(181361..182608) [1248 bp, 415 aa] {ON}
            RPA49RNA polymerase I subunit A49
          Length = 415

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 6/87 (6%)
 Frame = +1

Query: 1108 GSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKA 1287
            GSF  G    +DT   LYKKK +    K++F V+   N R E +    +S+  S      
Sbjct: 24   GSFFKGFRAPSDTTFDLYKKKKS---EKDEF-VLHGENERLEYEGYTDSSSQASNQYVVG 79

Query: 1288 FFNDE------FQNPDIISNLDSKRRK 1350
             FN E      ++ P ++S + SK  K
Sbjct: 80   LFNPEKKSIQLYKAPVLVSKVVSKSSK 106

>CAGL0K01419g Chr11 complement(125052..126314) [1263 bp, 420 aa] {ON}
            similar to uniprot|P10849 Saccharomyces cerevisiae
            YDL044c
          Length = 420

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +1

Query: 1177 NIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFF--NDEFQNPDIISNLDSKRRK 1350
            N+Y+     V +++N RK+  S        S+ I   FF  N+E QNP II   +SK + 
Sbjct: 54   NLYNSVFERVKQKQNLRKKQAS--------SSFILDHFFSGNEEKQNPHIIFGGESKAK- 104

Query: 1351 LKDAKRDSELIKELNKTLTKEDNVS 1425
               AK D  L+  L   +  E N+S
Sbjct: 105  ---AKSDQNLVDYLTGRIDSESNLS 126

>SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON}
            some similarities with uniprot|P53741 YNR051C
            Saccharomyces cerevisiae BRE5 Ubiquitin protease cofactor
          Length = 490

 Score = 32.7 bits (73), Expect = 3.1
 Identities = 19/101 (18%), Positives = 44/101 (43%)
 Frame = +1

Query: 1162 KKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSK 1341
            KK+      K +    ++   ++E   + +    +   + K    +E +  +     +SK
Sbjct: 210  KKEEKKEEKKEEKKEEKKEEKKEEKKEEKNEERKKEEELKKQAKKEELKKQE--KKEESK 267

Query: 1342 RRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKE 1464
            + + K+  +  E  +E+ K   KE+ V +  +G  K+D K+
Sbjct: 268  KEEKKEESKKQEKKEEIKKDDRKEEQVDEKFQGAKKDDAKK 308

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
            YDR423C
          Length = 608

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 8/109 (7%)
 Frame = +1

Query: 1189 KNQFNVVRRRNARKEGDSKLHNSNFRSTNIAK----AFFNDEFQNPDIISNLDS----KR 1344
            KN+ N+     ++   +SKL NSN   T +A      F +      DI +NL +      
Sbjct: 396  KNEQNIANNAASKSTNNSKLRNSNITITPLADDNNIPFIDTSLAFNDIPTNLSNDNEFNM 455

Query: 1345 RKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIM 1491
            +  K  ++ S+   +  K L  EDN   N    S E+ ++  +I  N++
Sbjct: 456  QLFKTNRKSSD--DDFFKFLMDEDNDILNGNNNSTENNEDNNSILNNLI 502

>YGR275W Chr7 (1043276..1043749) [474 bp, 157 aa] {ON}
            RTT102Component of both the SWI/SNF and RSC chromatin
            remodeling complexes, suggested role in chromosome
            maintenance; possible weak regulator of Ty1 transposition
          Length = 157

 Score = 31.6 bits (70), Expect = 3.3
 Identities = 16/70 (22%), Positives = 35/70 (50%)
 Frame = +1

Query: 1297 DEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNI 1476
            D +Q   + SN+   +++L D + + E      KT  +     KNL+ +S ED+ +++  
Sbjct: 28   DWYQPSKVSSNVQQPQQQLGDMENNLEKYPFRYKTWLRNQEDEKNLQRESCEDILDLKEF 87

Query: 1477 TENIMQIGML 1506
               I++  ++
Sbjct: 88   DRRILKKSLM 97

>TBLA0E01840 Chr5 complement(448479..449372) [894 bp, 297 aa] {ON}
            Anc_5.719 YIL161W
          Length = 297

 Score = 32.3 bits (72), Expect = 3.4
 Identities = 38/180 (21%), Positives = 76/180 (42%), Gaps = 15/180 (8%)
 Frame = +1

Query: 1135 KADTNPSLYKKKTNNIYSKNQF------NVVRRRNARKEGDSKLHNSNFRSTNIAKAFFN 1296
            K     ++Y++K NN  +KN+       + + + N+R    S+  N   R++N  +   N
Sbjct: 19   KRGNKKNIYRRKNNNNRTKNETSNEDSNSSLNKPNSRTNSRSRSRNRP-RNSNGNRQSRN 77

Query: 1297 DEFQNPDII--------SNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKE 1452
            DE  N DI         SN ++  R    ++         +K+ ++ ++  K+ + + K 
Sbjct: 78   DEKSNVDISESNHERSNSNGNNSNRSNNRSRNSRRKNDNYDKSNSRSNSNFKSYQPRDKL 137

Query: 1453 DVKEMRNITENIMQIGMLKNIGYDPTHGK-MKYLMKKSNGKDPSYTSNRSNAVNDLLHFK 1629
              + ++ + +N  +I     I       K  K   K S+     YT +  N ++D+  FK
Sbjct: 138  SAERLKILGDNQNKINKELEICSRVLGSKSFKLFKKNSDSISYGYTIHNIN-ISDISKFK 196

>YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}
            LEU3Zinc-knuckle transcription factor, repressor and
            activator; regulates genes involved in branched chain
            amino acid biosynthesis and ammonia assimilation; acts as
            a repressor in leucine-replete conditions and as an
            activator in the presence of alpha-isopropylmalate, an
            intermediate in leucine biosynthesis that accumulates
            during leucine starvation
          Length = 886

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 4/115 (3%)
 Frame = +1

Query: 1342 RRKLKDAKRDS--ELIKELNKTLTK--EDNVSKNLEGKSKEDVKEMRNITENIMQIGMLK 1509
            RR  K A+ ++  +  KEL +TLT    D + K +E + +E V +  N T+   ++  L+
Sbjct: 74   RRTYKRARNEAIEKRFKELTRTLTNLTSDEILKKIE-EEQEIVLDNSNFTKE--KVKQLR 130

Query: 1510 NIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLM 1674
               ++ T  + +   K   G+  SY++NR +  +  L       N  P+ S  +M
Sbjct: 131  KSAFETTEIEPRSY-KTLRGEPISYSTNRRHTDSSPLTLLSSSTNFDPVHSTNVM 184

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
            YGR238C
          Length = 1009

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 34/171 (19%), Positives = 76/171 (44%), Gaps = 9/171 (5%)
 Frame = +1

Query: 109  KRDLQERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTK 288
            K D++   + +++V RA +P+ +     +    E +  +P    +     ++ A T    
Sbjct: 584  KGDIKYDSQVQQQVMRAPEPSNLKEAVTIKKIDEPQSPIPNKEAEPANTKSEHAVTKSIS 643

Query: 289  KNTGIQDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSF 468
            +    +D    L+  +++E   +   S A   + +    + E QK+    T  +++  + 
Sbjct: 644  RENVSKDVLAHLR--SELEQLKLATESKATEASAYIKQLEGEVQKL----TSGASKDENG 697

Query: 469  GNYTNLQKESQII---------NVEEKEKYSGLWISRRYLKEETIDQLLQD 594
             N  +LQ    I+         +V+E EK     +S R+L+ ET+++++QD
Sbjct: 698  TNLVSLQSRYDILEADHNSMKDHVKEMEKL----LSSRFLEVETLNKIVQD 744

>NDAI0B05300 Chr2 (1294623..1298330) [3708 bp, 1235 aa] {ON} Anc_1.90
            YGL140C
          Length = 1235

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 32/147 (21%), Positives = 57/147 (38%), Gaps = 14/147 (9%)
 Frame = +1

Query: 382  MNNFASSKKVEAQKIQDYETL-----------MSARVHSFGNYTNLQKESQIINVEEKEK 528
            +NN  S +K E+++  DY              ++ R   +     +  +  ++    +EK
Sbjct: 976  LNNEKSKRKDESKEDSDYSDSDDISPMNSVEGLTLRTKGYNEAIKMTTQEHLL----EEK 1031

Query: 529  YSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKF---ESPQYSNWVAVGVITEK 699
            +   W +     EE ++ + +   +LRL KL   +   K+     P Y +W A  V    
Sbjct: 1032 FLS-WNASSSATEEIVEYMEE---LLRLTKLLVGVNEFKYGFLSRPLYEDWAAEAVTGFD 1087

Query: 700  SGFKLTSSNTPRKYFKFTIGDFQQNIS 780
            +   +TSSN          GD    IS
Sbjct: 1088 AFINVTSSNKKSSLSPSPFGDVTSTIS 1114

>ZYRO0G15554g Chr7 complement(1262430..1266431) [4002 bp, 1333 aa]
            {ON} similar to uniprot|Q08748 Saccharomyces cerevisiae
            YOR296W Hypothetical ORF
          Length = 1333

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 5/126 (3%)
 Frame = +1

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIK-ELNKTLTKEDN 1419
            K+ N N R + +   F+ND F NP + S LD   R  +     ++    ELNK +    N
Sbjct: 139  KISNENLRRSLLK--FYNDVFLNPSMRSTLDYMERFEELVVHFTKAANGELNKLVI--GN 194

Query: 1420 VSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGY----DPTHGKMKYLMKKSNGKDPSYT 1587
            V K L  +    +  + NI++N+    ++K   Y     P   + + +   SN    S  
Sbjct: 195  VQKELHAQVSFFIDLVINISKNLPTELVIKLQRYKESSTPQRHRFREVRTPSNDTSTSTA 254

Query: 1588 SNRSNA 1605
            S+ S+A
Sbjct: 255  SSSSSA 260

>TPHA0E02170 Chr5 complement(450763..451842) [1080 bp, 359 aa] {ON}
            Anc_5.288 YDR279W
          Length = 359

 Score = 32.3 bits (72), Expect = 3.7
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +1

Query: 1546 YLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGD 1719
            Y +K       S  +N ++  ND+ H+  D V   PLKS +L  ++ R + W    GD
Sbjct: 57   YSLKSHTFSKGSKINNSTDLANDIYHYTDDGV---PLKSFILTNEKARSDAWILESGD 111

>Kpol_1023.62 s1023 complement(138899..143422) [4524 bp, 1507 aa] {ON}
            complement(138899..143422) [4524 nt, 1508 aa]
          Length = 1507

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 38/123 (30%), Positives = 56/123 (45%), Gaps = 16/123 (13%)
 Frame = +1

Query: 1324 SNLDSK--RRKLKDAKRDSELIK-----ELNKTLTK--EDNVSKNLEGKSKEDVKEMRNI 1476
            SN+DS     KL+D +  SE+IK     E  KT  +  ++N S++L+ K    V    NI
Sbjct: 1117 SNIDSHSINNKLQDIEISSEIIKIDDEKETPKTTLEFQDNNTSESLKNKRSNHVG---NI 1173

Query: 1477 TENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKD-------PSYTSNRSNAVNDLLHFKKD 1635
             E ++                 K  + KSN KD       PS+T+  SNA+ +LL    D
Sbjct: 1174 IETLV-----------------KQEIDKSNTKDEDNISLPPSFTNIISNAITNLLPTIND 1216

Query: 1636 KVN 1644
             V+
Sbjct: 1217 TVS 1219

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 32.7 bits (73), Expect = 3.8
 Identities = 42/185 (22%), Positives = 83/185 (44%), Gaps = 10/185 (5%)
 Frame = +1

Query: 1210 RRRNARKEGDSKLHNS----NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDA--KRD 1371
            +++   K    KLHN       +  N+  A  N + +N    + L  +  +  DA  K+ 
Sbjct: 1250 QQKLTHKNETEKLHNVIGDLEVKLLNVQNA--NADLENK--FNRLKKQAHEKLDASKKQQ 1305

Query: 1372 SELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLK----NIGYDPTHGK 1539
            + L  ELN+    +D + +NL  +  + V     + E+ +Q+G +     +I + P   +
Sbjct: 1306 TALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEE 1365

Query: 1540 MKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGD 1719
            ++ L K+            +N  +D   F+K K N++  K+ ++ +K K  E   +   +
Sbjct: 1366 IESLKKELQ------VFRNANDASDA--FEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVN 1417

Query: 1720 QSKSN 1734
            +SKSN
Sbjct: 1418 KSKSN 1422

>AER150W Chr5 (920133..921389) [1257 bp, 418 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YML074C (FPR3) and YLR449W
            (FPR4)
          Length = 418

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 8/88 (9%)
 Frame = +1

Query: 1333 DSKRRKLKDAKRDSELIKELNKTLTKEDNV--SKNLE---GKSKEDVKEMRNITENIMQI 1497
            D+KR   KDAK+D +  K+  K   KE  V   K+LE    K K+D  + + +   ++  
Sbjct: 260  DTKRDAKKDAKKDQKDQKDAKKDAKKEKKVEFKKDLEEGPSKKKDDKPKTKILEGGVVIE 319

Query: 1498 GMLKNIGYDPTHGK---MKYLMKKSNGK 1572
              +   G     G    M+Y+ K  NGK
Sbjct: 320  DRVVGSGKAAKKGARVGMRYIGKLKNGK 347

>TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.416
            YDR207C
          Length = 618

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 7/103 (6%)
 Frame = +1

Query: 1132 TKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQN 1311
            T   T  S  KK+T+N  S+N   + R R  +K  + + +  N +  N+   +   +   
Sbjct: 457  TTTATPTSSDKKQTHNTRSRNGCWICRLRK-KKCTEERPNCYNCQRLNLNCYY---DINK 512

Query: 1312 PDIISNLDSKRRKL-------KDAKRDSELIKELNKTLTKEDN 1419
            PD IS+   K  KL       K+AKR++   K +NK   K++N
Sbjct: 513  PDFISDPIKKENKLLEIKQKTKEAKRNAMRKKPMNKGTFKKEN 555

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
            to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
            SH3 domain protein implicated in the regulation of actin
            polymerization able to recruit actin polymerization
            machinery through its SH3 domains colocalizes with
            cortical actin patches and Las17p interacts with type I
            myosins
          Length = 649

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 8/123 (6%)
 Frame = +1

Query: 1186 SKNQFNVVRRRNARKEGDSKLHNSNFRST-NIA-----KAFFNDEFQNPDIISNLDSKRR 1347
            SK+     +RR A KE +  +  +++ +  N A     K FF D  +  DI+ +++  R 
Sbjct: 172  SKSSSEKAQRRQAEKEHEMNISKNDYLTKINQANRVKDKYFFQDVPEILDILQDINESRA 231

Query: 1348 KLKDA--KRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGY 1521
             + +    +   L +ELNKT+    + + ++  K+K  +     I  N+      K+  Y
Sbjct: 232  AMLNIIWNKAGVLERELNKTIDSRLDAADSVIAKNKPYLDTSMFIKHNMKSWKEPKDFLY 291

Query: 1522 DPT 1530
            +P+
Sbjct: 292  EPS 294

>Kpol_359.3 s359 (3084..3950) [867 bp, 288 aa] {ON} (3084..3950) [867
            nt, 289 aa]
          Length = 288

 Score = 32.0 bits (71), Expect = 4.4
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 22/95 (23%)
 Frame = +1

Query: 1288 FFNDEFQ---------NPDIISNLDSKRR-KLKDAKRDSELIKELNKTLTKEDNVSKNLE 1437
            FF DE+          +P+I  N++SK+    K+ + + E  KE  KT T+E+ V+ N E
Sbjct: 155  FFLDEYLPQTKVLAIISPEI--NVNSKKSISKKEEEEEEEAEKEDYKTETEEEYVNDNSE 212

Query: 1438 ------------GKSKEDVKEMRNITENIMQIGML 1506
                        GK+KED +E  +I   I   G+L
Sbjct: 213  EDKDEVEAQDKKGKNKEDKEEDSDILSTIWTEGLL 247

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 731

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 27/140 (19%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = +1

Query: 1093 RIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRST 1272
            R+  +GS ++ +P    ++P  YK++ ++      ++ V ++N     +   +N+N ++ 
Sbjct: 10   RVRSSGS-SIPSPKLNGSSPKSYKRRNDSTTPPGSYSPVEQQNNHDNNNDNNNNNNSKNQ 68

Query: 1273 NIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKE-----LNKTLTKEDNVSKNLE 1437
             I++      +++   +++   +  +  +  +DS   K+     L   L++ +   KN+E
Sbjct: 69   TISRGATGTSYRSNFHLTSFYKENIRDLNQLQDSLFQKKAQMDVLLDELSECNGKYKNIE 128

Query: 1438 GKSKEDVKEMRNITENIMQI 1497
             K  ED+KE R++    M +
Sbjct: 129  FK-WEDLKEERSLKNQQMNL 147

>KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly
            similar to uniprot|P31111 Saccharomyces cerevisiae
            YDR285W ZIP1 Synaptonemal complex (SC) protein that
            connects homologous chromosomes partially during zygotene
            and entirely during pachytene potential Cdc28p substrate
            synaptonemal complex protein
          Length = 755

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 34/155 (21%), Positives = 73/155 (47%), Gaps = 12/155 (7%)
 Frame = +1

Query: 1306 QNPDIISNLDSK-----------RRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKE 1452
            +N + I++LDSK           ++ + D K++ + +K+ +     E+N  K+   K + 
Sbjct: 526  ENEEAITSLDSKLTAQTEISSILQKDMNDTKKEIDSLKKKHTQALDENNSIKH---KYEN 582

Query: 1453 DVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLH-FK 1629
              ++   I   ++Q    K + +   +  ++   ++      ++TSN    VND +H  +
Sbjct: 583  LQQQFHKINVELVQ-SKAKELEFGEINRNLREQFEELESAS-NHTSNSFKRVNDKVHALE 640

Query: 1630 KDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSN 1734
            K+K  L   K DL+ K  + ++   E   +Q++SN
Sbjct: 641  KEKSALNLEKLDLMDKIEELEDKLKE-ANNQNRSN 674

>TPHA0D04680 Chr4 (1021296..1023581) [2286 bp, 761 aa] {ON} Anc_5.713
            YKR099W
          Length = 761

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 65/265 (24%), Positives = 101/265 (38%), Gaps = 1/265 (0%)
 Frame = +1

Query: 871  WRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCC 1050
            W PSE+N  +K+FN                    W N+  +  G         +T+D+C 
Sbjct: 129  WVPSEDNKLLKAFN---------------KHGRHWLNIAAEIPG---------RTEDQCA 164

Query: 1051 EFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFN-VVRRRNAR 1227
            + + E   R   A+R+     +AL    K      +Y  K   I S+      +  RN  
Sbjct: 165  KRYLEV-LRPDNARRLR---DWALEEDLKLIQKVGIYGTKWRKISSEMDCRPSLTCRNRW 220

Query: 1228 KEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 1407
            ++  + +  SN     I KA    E +N D IS  DS     K+     +  K  N T T
Sbjct: 221  RKIITMVVRSN-APQQIMKAV--KENKNID-ISKSDSNISLNKNKHNAKDNKKITNGTKT 276

Query: 1408 KEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT 1587
            + DN S N +  S  D  E  N  EN  +  ++    YD +  +   +        P+  
Sbjct: 277  QADNKSLNHKYASDNDGNEHGN-AENDDENEIIDK--YDESESEDLLVESYEEQTSPNLN 333

Query: 1588 SNRSNAVNDLLHFKKDKVNLKPLKS 1662
                N  N L   +KD+++ KP  S
Sbjct: 334  ITSPNDTNIL--NEKDEISDKPTDS 356

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 41/198 (20%), Positives = 75/198 (37%), Gaps = 2/198 (1%)
 Frame = +1

Query: 1063 ETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDS 1242
            E + +NA AK   L         T ++T  +  KKK                  +K+ + 
Sbjct: 198  EDKLKNAIAKTEALEEISKSDPATVSNTTTTSNKKKN-----------------KKKNNK 240

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNV 1422
            K +N+N           N+   N D  +  +    K      D E + E +   ++    
Sbjct: 241  KKNNNN----------HNNNATNADTNTTDNDMSEKYDKLIADFEKLTEEHANCSETQGS 290

Query: 1423 SKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYD--PTHGKMKYLMKKSNGKDPSYTSNR 1596
             +N       +V+E+R+         ML+++G +      K+K   + SN  D   + N 
Sbjct: 291  LQNQLNTKSSEVEEVRD---------MLRDVGNELVEAKDKIKEFNQSSNANDELISKN- 340

Query: 1597 SNAVNDLLHFKKDKVNLK 1650
            SN  N++   K++  N+K
Sbjct: 341  SNLENEITRIKEENDNVK 358

>Kwal_33.15184 s33 (1001372..1004233) [2862 bp, 953 aa] {ON} YLL003W
            (SFI1) - Product of gene unknown [contig 94] FULL
          Length = 953

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 38/151 (25%), Positives = 67/151 (44%), Gaps = 7/151 (4%)
 Frame = +1

Query: 400  SKKVEA-QKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLW-----ISRRYL 561
            + KVEA +K++    L    VH+       +K ++   ++ K KY  LW     I RR  
Sbjct: 580  NSKVEAFRKVKVIMQLKKVCVHTADLEELTRKHTEAKALKYKRKYMSLWQSSLEIQRRLK 639

Query: 562  KEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKY 741
             E  +DQ L   +   L +LF   R  +F    Y N V      ++  F+  ++ T RK 
Sbjct: 640  HEVVLDQYLSFRENTTLARLFTTWRTRRF----YYN-VQCTDAAKRQEFETVTAVTLRKM 694

Query: 742  F-KFTIGDFQQNISIFVFNREAIAKYYNLRV 831
              K  + +    +S+ + ++  +A Y+ L +
Sbjct: 695  LEKQRLHEHWYVVSMRLDDQSKLAAYFGLLI 725

>TBLA0B05070 Chr2 (1194738..1197617) [2880 bp, 959 aa] {ON} Anc_6.201
            YPL195W
          Length = 959

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 5/83 (6%)
 Frame = +1

Query: 1261 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKL-----KDAKRDSELIKELNKTLTKEDNVS 1425
            F S+    A  N+   N D   N  S  + L      DA   S+   + NK+L  ED+V+
Sbjct: 672  FLSSEEMGAIINESLLNTDTSDNQVSLLKSLDYDWDSDADSHSDFEIQSNKSLNAEDHVT 731

Query: 1426 KNLEGKSKEDVKEMRNITENIMQ 1494
            +NL      DVK+  N  E +++
Sbjct: 732  ENL-----LDVKDSNNHAEKVVK 749

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 44/220 (20%), Positives = 91/220 (41%), Gaps = 10/220 (4%)
 Frame = +1

Query: 1015 GTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKN 1194
            G+ +N+ K++      ++  +N   +  E  G + L    + +T     +  +N    +N
Sbjct: 790  GSKLNELKNEL-----KSLAKNLEEQESESEGKYDLFQNLELETEQLSSELDSNKTLLQN 844

Query: 1195 QFNVVRR-RNARKEGDSKLHNSNFRSTNIAKAFFNDEFQN----PDIISNLDSKRRKLKD 1359
                +   ++   E + K+ +       I +A  N+E +      D ++ L++  +K ++
Sbjct: 845  YLKSIESLKSENTELEEKIRSIEDNLATI-QAKLNEEKKRLMDIDDELTELETLMKKKQE 903

Query: 1360 AKRDSEL-----IKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYD 1524
             K+ SEL     I +LNK  +  DN+ K +E        E+R   E +    ++ +I   
Sbjct: 904  KKKSSELELQKLIHDLNKYKSNTDNIEKKIE--------ELRQKHEFLEDFDLVTSI--- 952

Query: 1525 PTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVN 1644
                     +K++ G +      RS  +ND     + KVN
Sbjct: 953  ---------VKQNEGINLETYRERSKQLNDKFQELRKKVN 983

>ZYRO0D05214g Chr4 complement(440628..445208) [4581 bp, 1526 aa] {ON}
            similar to uniprot|P07866 Saccharomyces cerevisiae
            YAL024C LTE1 Putative GDP/GTP exchange factor required
            for mitotic exit at low temperatures acts as a guanine
            nucleotide exchange factor (GEF) for Tem1p which is a key
            regulator of mitotic exit physically associates with
            Ras2p- GTP
          Length = 1526

 Score = 32.3 bits (72), Expect = 4.9
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 10/143 (6%)
 Frame = +1

Query: 1117 ALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFN 1296
            A+G  +K   N + YK    +  S + F+   + +  ++G+ K    NF    I+ +   
Sbjct: 405  AMGLLSKWRKNHAYYKHNDMDGASLSSFS---KDDTLRDGNGKKEMDNFVKYVISISSLE 461

Query: 1297 DEFQNPDIISNLDSKRRKLKDAKR----------DSELIKELNKTLTKEDNVSKNLEGKS 1446
            D    P  + NL S +  L  A+           ++ LIKELN T+ +  ++   +    
Sbjct: 462  DRNFAPREMENLVSTKFDLLSARTIEEVEFLVTLENNLIKELNDTVVETTDIPSAVRRNG 521

Query: 1447 KEDVKEMRNITENIMQIGMLKNI 1515
            ++D  ++     +IMQ   + N+
Sbjct: 522  QDDQTKI----TDIMQFSAMDNL 540

>Skud_15.465 Chr15
           (815231..815260,815264..815308,815312..815461,
           815468..815500,815591..816670) [1338 bp, 445 aa] {OFF}
           YOR298W (PSEUDO)
          Length = 445

 Score = 32.0 bits (71), Expect = 5.3
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = +1

Query: 466 FGNYTNLQKE-SQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPP 642
           F N+T L    S I N++ K+ ++ +    RYL    ID+++     +  +K+  KI PP
Sbjct: 249 FKNFTGLMAAFSSIKNIKRKKNHNNIIKEARYLLHREIDKMVHKSITMEPSKMSNKIIPP 308

Query: 643 KFESPQY 663
                 Y
Sbjct: 309 MIIDNSY 315

>CAGL0K03949g Chr11 complement(365526..367043) [1518 bp, 505 aa] {ON}
            similar to uniprot|P40208 Saccharomyces cerevisiae
            YMR135c
          Length = 505

 Score = 32.0 bits (71), Expect = 5.5
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +1

Query: 1225 RKEGDSKLHNSNFRSTNIAKAF--FNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNK 1398
            + E    L+N + R  N  K F  + +EFQN D  +N  S           +E+++  + 
Sbjct: 372  KDEFKDDLYNDD-RYKNNTKTFEKYKNEFQNEDGSNN--SLTGSNSYWAETTEMLRRQSN 428

Query: 1399 TLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIG 1518
            T +  DN   +       D K  +  T N  + G+LK  G
Sbjct: 429  TTSSSDNDQSSYSENDNNDSKNKKQTTHNASKNGLLKEDG 468

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
            Anc_8.787 YOR310C
          Length = 523

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 2/112 (1%)
 Frame = +1

Query: 1408 KEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT 1587
            K +N    LEG+   D++    +     ++ M +   Y+     +  + +KS+  D   +
Sbjct: 393  KVENRLSQLEGR---DLRTTPKVVREAKKVEMTEARAYNADADTVADVAEKSDDSDDESS 449

Query: 1588 SNRSNAVNDLLHFKKDKVNLKPL--KSDLLMKKRKRDEIWNEYFGDQSKSNR 1737
                  V +    KK+K   K    K +   KKRKRDE  +E    QSK ++
Sbjct: 450  DEEEEEVKEEKKEKKEKKEKKEKKEKKEKKDKKRKRDEDEDEEKLKQSKKDK 501

>TBLA0B09820 Chr2 complement(2339120..2340772) [1653 bp, 550 aa] {ON}
            Anc_2.51 YDL225W
          Length = 550

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 32/121 (26%), Positives = 53/121 (43%), Gaps = 4/121 (3%)
 Frame = +1

Query: 1138 ADTNPSL--YKKKTNNIYSKNQFNVVRRRNARKEGD--SKLHNSNFRSTNIAKAFFNDEF 1305
            A TN S   Y + + N  + N   + R+  A    +  S ++   F+S+N      N+EF
Sbjct: 346  AVTNDSTNGYAESSTNPLNSNDKALKRQSAAPSLSNFASLVNTGKFKSSNDLSMTMNEEF 405

Query: 1306 QNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITEN 1485
             N   +SN     +      +DSE+           +N++ N    S E +K +RNI+E 
Sbjct: 406  SNDQNVSN--ETPQATPKISQDSEI----------NENINPNTIASSPERIK-LRNISET 452

Query: 1486 I 1488
            I
Sbjct: 453  I 453

>KAFR0B01600 Chr2 complement(305501..307333) [1833 bp, 610 aa] {ON}
            Anc_5.54 YHR184W
          Length = 610

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 29/114 (25%), Positives = 48/114 (42%), Gaps = 12/114 (10%)
 Frame = +1

Query: 1351 LKDAKRDSE-LIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDP 1527
            +KD   D+E ++KE+N   TK+  +   +  K K+  K +  I    +Q G L  +G   
Sbjct: 233  IKDDSGDTESVLKEINDLFTKDQQLQFEISNKIKDLSKNLEYIA---LQEGELIKVGKHL 289

Query: 1528 THGKMKYLMKKSNGKDP-----------SYTSNRSNAVNDLLHFKKDKVNLKPL 1656
                 KYL  K    D            SY++   NA+       K ++N++ L
Sbjct: 290  VRDHKKYLYIKERKGDNFTQINFLLDKISYSATSYNAIRTCFQ-DKIRINMREL 342

>TBLA0H01320 Chr8 complement(294634..296712) [2079 bp, 692 aa] {ON}
            Anc_8.304 YDR137W
          Length = 692

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 55/225 (24%), Positives = 88/225 (39%), Gaps = 20/225 (8%)
 Frame = +1

Query: 895  YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRET-- 1068
            Y KS +LSI    D  +    + D+    V V    G       NK K+  C   RE   
Sbjct: 314  YTKSQSLSISYSLDFGVTKLSNDDMEKFQVKVPISIGPFVN---NKGKEYTCIIDREPLI 370

Query: 1069 ----EFRNAAAKRIELNGSFA--LGAPTKADTNPSLYK-KKTNNIYSKNQFNVVRRRNAR 1227
                  +N  + +++   S A  + +   A  N  L   ++ N+   + + N ++   + 
Sbjct: 371  MEPGYIKNIKSPQVQRKVSIASTISSVPAARRNSFLVNAREANDNLERLKTNFIKLVESN 430

Query: 1228 KEGDSKLHNSNFRSTNIAKAF-----FNDEFQNPDIISNLDSKRRKLKDAKRDSELIKEL 1392
            K  D+  H        I   F     F D+ +     +N  SKR+K K+  RD+  I  +
Sbjct: 431  K--DNSHHIEELVDKQIELQFGSLDSFEDDSEGDLNGTNFQSKRKKKKNTVRDN--ISNI 486

Query: 1393 NKTL------TKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLK 1509
            + TL      T+E N  K+       D++ M  I  N M I  LK
Sbjct: 487  SVTLGDGTITTQEGNNFKDKLIPQLNDLQRMYKINNNGMSIATLK 531

>NDAI0I01220 Chr9 complement(293892..295994) [2103 bp, 700 aa] {ON}
            Anc_6.188 YGL086W
          Length = 700

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 46/215 (21%), Positives = 86/215 (40%), Gaps = 17/215 (7%)
 Frame = +1

Query: 1141 DTNPSLYKKKTN-----NIYSKNQFNVVRRRNAR---KEGDSKLHNSNFRSTNIAKAFFN 1296
            +TN SL+ + TN     +   K Q N +    +    K  + +    +F +  I+K    
Sbjct: 103  ETNDSLHDEVTNLRKSLDTVKKEQQNRIDELESEVNLKHNEVEKLKIDFEN-EISKISHE 161

Query: 1297 DEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGK---------SK 1449
             E  N +  +N    +R  ++  R S+ IKELNK  +++D+   +L+ K         S 
Sbjct: 162  LENVNMENANNKTMLQRYEEELARQSQEIKELNKLNSEKDDEISDLKTKNMMKPQQLDST 221

Query: 1450 EDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFK 1629
            ED   + N+ ++ ++              ++K L    N  D  Y         ++   K
Sbjct: 222  EDFTTINNMFQDQVKFCKQLEEANIKQANELKQLRNFQNSND-FYKLENKKLQGEITTLK 280

Query: 1630 KDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSN 1734
                + K ++ D +  + K    W E+F D  + N
Sbjct: 281  DSLASFKTMELDFVQLQSKLAS-W-EFFDDDGEIN 313

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
            KAR3Minus-end-directed microtubule motor that functions
            in mitosis and meiosis, localizes to the spindle pole
            body and localization is dependent on functional Cik1p,
            required for nuclear fusion during mating; potential
            Cdc28p substrate
          Length = 729

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 6/135 (4%)
 Frame = +1

Query: 1066 TEFRNAAAKRIELNGSF-----ALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARK 1230
            TE+++   K IELN        ++    +    P L +KK      +N +  ++ +   K
Sbjct: 261  TEYQSQWKKDIELNNKHMQEIESIKKEIENTLKPELAEKKKLLTEKRNAYEAIKVKVKEK 320

Query: 1231 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSEL-IKELNKTLT 1407
            E ++    +  R     K   N E            K ++L++  +D+EL +KELN+ L 
Sbjct: 321  EEET----TRLRDEVALKQKTNLETLE---------KIKELEEYIKDTELGMKELNEILI 367

Query: 1408 KEDNVSKNLEGKSKE 1452
            KE+ V + L  + +E
Sbjct: 368  KEETVRRTLHNELQE 382

>TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.364
            YJR134C
          Length = 732

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 39/158 (24%), Positives = 75/158 (47%), Gaps = 20/158 (12%)
 Frame = +1

Query: 1237 DSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKED 1416
            ++KL   N+   ++     N E +N  + +   S   +L   K++S ++KE +   T+ +
Sbjct: 261  ETKLDTMNYELNSLKDKVDNLEKENEIVKTKNISLDTELNKLKQESYILKEGSSRATEME 320

Query: 1417 ----NVSKNLEGKS---KEDVKEM--------RNITENIMQIGM-LKNIGYDPTH---GK 1539
                N+SK LE K    KE  KEM         ++   I Q+ + L N  YD ++   GK
Sbjct: 321  EQVKNLSKALEEKENLFKEKNKEMILNHNTQVTHLESKIEQLRISLDNPNYDSSNVGFGK 380

Query: 1540 MKYLMKKSNGKDPSYTSNRSNAVND-LLHFKKDKVNLK 1650
                 + S+G +  +T+ + N + + L+  KK+  +++
Sbjct: 381  ----TESSSGNENEFTTEQYNMLQEQLISSKKNWTSIE 414

>TPHA0A01970 Chr1 complement(395716..397920) [2205 bp, 734 aa] {ON}
           Anc_8.232 YER167W
          Length = 734

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 34/146 (23%), Positives = 61/146 (41%)
 Frame = +1

Query: 169 NFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEP 348
           NFIS  G+    SES +    +    + K  Q + + +  ++ G+  N     L N +E 
Sbjct: 433 NFISVPGSELNISESYLDHKNASRNNRHKKQQASISDLMLESHGMSLNQYNNNLTNNLEF 492

Query: 349 ASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEK 528
           ++ P   T    NN  SS  +       ++  +  R  +F N   +     I   EEK++
Sbjct: 493 SNSPRLIT----NNSVSSSDLSV-----FDQTLINRRSTFLNENGMSSTILIGGTEEKDE 543

Query: 529 YSGLWISRRYLKEETIDQLLQDIKIL 606
                      +EE  ++ LQDI+++
Sbjct: 544 DED-----EEYEEEYEEEKLQDIRLM 564

>Ecym_4177 Chr4 (372606..374813) [2208 bp, 735 aa] {ON} similar to
            Ashbya gossypii AGL124C
          Length = 735

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 31/136 (22%), Positives = 52/136 (38%)
 Frame = +1

Query: 1078 NAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNS 1257
            NA   + +L     +     ++   SL +  +  +YS+N F    +   RK   S   N 
Sbjct: 247  NAVRHKSKLFADSIIKLTDSSEDETSLSRTSSQLLYSQNSFISTEKFQTRKRPSSL--NK 304

Query: 1258 NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLE 1437
               S  IA    +D       +++  S      DAK  S+  + L K    ED+   N +
Sbjct: 305  RRLSDKIALTVEHDSVNTSSTMTSSSSLDGLAADAKNSSDHFRVLGKGNGYEDDDDANGD 364

Query: 1438 GKSKEDVKEMRNITEN 1485
            G  + D  +  +  EN
Sbjct: 365  GDGECDDDDDDDDDEN 380

>KLLA0E06073g Chr5 complement(549775..552111) [2337 bp, 778 aa] {ON}
           some similarities with uniprot|P47134 Saccharomyces
           cerevisiae YJR089W BIR1 Protein involved in cell cycle
           regulation and chromosome segregation contains BIR
           (Baculovirus Inhibitor of apoptosis Repeat) domain
          Length = 778

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 32/133 (24%), Positives = 51/133 (38%), Gaps = 8/133 (6%)
 Frame = +1

Query: 178 STEGNVDATSESRIQVPGSPEKIKRKH--------TQLAATPVTKKNTGIQDNPNELKLK 333
           +TE    A  E  +   G P K +R          T ++ T  +KKNT   +N N     
Sbjct: 72  TTEARKSAKKEPILDENGLPVKKRRGRPRKSLIDPTNISFTSESKKNTTTDNNNNIQDTS 131

Query: 334 NQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINV 513
             I  AS    S           K+   +K +   ++ + ++H   NY+N  K      +
Sbjct: 132 GGIPKASRAKHSHNVLPIPIQPKKRGRPKKTESIVSVRTEQLHEDMNYSNDMKLKIEKIL 191

Query: 514 EEKEKYSGLWISR 552
            +K+ Y  L  SR
Sbjct: 192 HKKDNYPNLISSR 204

>Skud_16.88 Chr16 complement(158550..160916) [2367 bp, 788 aa] {ON}
            YPL190C (REAL)
          Length = 788

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 10/102 (9%)
 Frame = +1

Query: 1384 KELNKTLTKEDNVSKNLEGKSKEDVKE-MRNIT-----ENIMQIGMLKNIGYDPTHGKMK 1545
            +E NKT   E N+++    + + DV E +R IT     EN      ++N+ YD    ++K
Sbjct: 141  EEDNKTKDMEVNITRETLEREQMDVDEAVRKITAEKNDENTQSSTNMENVNYDLLQKQVK 200

Query: 1546 YLMKKSNGKDPSY----TSNRSNAVNDLLHFKKDKVNLKPLK 1659
            Y+M  +    P +       + +A+  +L+   D     PL+
Sbjct: 201  YIMDSNMLNLPQFQHLPQDEKMSAILAMLNSNSDTALSLPLQ 242

>TBLA0J00720 Chr10 (167109..169553) [2445 bp, 814 aa] {ON} Anc_5.603
            YOR023C
          Length = 814

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 31/153 (20%), Positives = 59/153 (38%), Gaps = 11/153 (7%)
 Frame = +1

Query: 1009 PCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALG--------APTKADT---NPS 1155
            P  T  N  K+     +  T +RN        + S +L         A T+  T   +P 
Sbjct: 270  PFTTTFNDYKEWIDNMNPNTNYRNNIPSAFNYSASNSLNNIQILNSNANTRCSTPIQHPY 329

Query: 1156 LYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLD 1335
            L + K+ +  S N  ++          ++  H+S  + TN+ +  FN+   N  + SN +
Sbjct: 330  LTRSKSLHNNSINATSMNSLDMINNNNNTNNHSSILQDTNLNQNIFNNSNNNITLCSNNN 389

Query: 1336 SKRRKLKDAKRDSELIKELNKTLTKEDNVSKNL 1434
            +      +   ++      N    K +N++ NL
Sbjct: 390  NNNNNNNNNNNNNNNNNNNNNNNNKNNNINFNL 422

>NCAS0A13410 Chr1 (2638271..2639206) [936 bp, 311 aa] {ON} Anc_7.227
          Length = 311

 Score = 31.6 bits (70), Expect = 6.1
 Identities = 31/141 (21%), Positives = 63/141 (44%), Gaps = 2/141 (1%)
 Frame = +1

Query: 913  LSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRNAAAK 1092
            L I+TKY+    +G  R++     P+ +   +     +  T +         +  +AA K
Sbjct: 112  LFIRTKYELKKWVGTPREVS--EPPMSTTHEQVAKLSLESTSNPNSNSSSLLDIGSAAKK 169

Query: 1093 RIELNGSFALGAPTKADT--NPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFR 1266
             +  N +    +     T  N + + KKT++ +++    VV +R   K+    L++    
Sbjct: 170  SVSANTNLKSTSLLNLATPSNSTEHVKKTHS-HNERTDRVVTQRPDLKKSILSLYSKPSS 228

Query: 1267 STNIAKAFFNDEFQNPDIISN 1329
            +TN   +FFN+   N +I+S+
Sbjct: 229  NTNTNSSFFNNNANNNNIMSS 249

>TPHA0C02960 Chr3 complement(647899..648384) [486 bp, 161 aa] {ON}
            Anc_2.215 YNL079C
          Length = 161

 Score = 30.8 bits (68), Expect = 6.2
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 7/101 (6%)
 Frame = +1

Query: 1189 KNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKR 1368
            K Q+ V+ + N  KE + K  ++                +N ++ + L++   KL D+K+
Sbjct: 26   KEQYKVIEQDNTDKENEIKSLST----------------KNENLEAELETLENKLTDSKQ 69

Query: 1369 ---DSELIKELNKT-LTKEDNVSKNLE---GKSKEDVKEMR 1470
               DS+ +K  N+T L K   + + LE    K KE ++++R
Sbjct: 70   VLEDSDNLKSNNETFLKKNQQLEEELEESDSKLKEAIEKLR 110

>ZYRO0G20438g Chr7 complement(1684028..1685020) [993 bp, 330 aa]
           {ON} similar to uniprot|Q01590 Saccharomyces cerevisiae
           YLR026C SED5 Sed5p is a t-SNARE (soluble NSF attachment
           protein receptor) required in ER to Golgi transport
          Length = 330

 Score = 31.6 bits (70), Expect = 6.3
 Identities = 24/89 (26%), Positives = 41/89 (46%)
 Frame = +1

Query: 331 KNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIIN 510
           K   +PA   + +T    N F SS   E  + Q       A      N  +L +ESQ++ 
Sbjct: 176 KESQQPAHAESVATYNSSNPFMSSMLAETSEQQSDGGNGGA-----SNGLSLPQESQMLL 230

Query: 511 VEEKEKYSGLWISRRYLKEETIDQLLQDI 597
           +EE +  +G ++  R    ETI+  +Q++
Sbjct: 231 MEEGQMSNGQYLQERNRAVETIESTIQEV 259

>NDAI0J02820 Chr10 (698768..702619) [3852 bp, 1283 aa] {ON} 
          Length = 1283

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 17/41 (41%), Positives = 26/41 (63%)
 Frame = +1

Query: 1339 KRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVK 1461
            K +K K AK+DSE+ +E + T T E+  S+    K+K+D K
Sbjct: 88   KAKKPKKAKKDSEVSEEGSVTPTTEEGKSEKKSKKTKKDKK 128

>KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1301

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 27/118 (22%), Positives = 64/118 (54%)
 Frame = +1

Query: 1162 KKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSK 1341
            +++TNN+  K +FN   + +++++  +K++N      N   + +N+  Q  +  S L   
Sbjct: 922  EQETNNV--KAEFN--SKMSSKRDTLNKINND----INTVSSIWNEITQYDE--SLLSQC 971

Query: 1342 RRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNI 1515
             R+L+ ++ +   + ELN+ +  ++N   + + K K+   E RN+++NI  + + K +
Sbjct: 972  TRELERSELE---LAELNQQIDFKNNELNDQKQKLKDSNNEKRNLSQNIELLDLKKKL 1026

>CAGL0M00924g Chr13 (102735..106646) [3912 bp, 1303 aa] {ON} similar
            to uniprot|Q06673 Saccharomyces cerevisiae YLR436c ECM30
            involved in cell wall biogenesis and architecture
          Length = 1303

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 13/103 (12%)
 Frame = +1

Query: 1216 RNARKEGDSKLHNSNFRSTNIAKAFFNDE----FQNPDIISNLDSKRRKLKDAKRDS--- 1374
            +N R     +LH+ ++ + N  KAF NDE      +P++I + + K     D+  DS   
Sbjct: 823  KNIRLRDFYRLHDLSYNNINFRKAFNNDEGFHRSSSPNLIKSNNGKNNDNNDSDNDSMDM 882

Query: 1375 ------ELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITEN 1485
                   L K + +  + +D  + NL  +         NI  +
Sbjct: 883  NSSAYLVLTKPIAREYSSDDLRNNNLTTREHAGSNNNNNINSS 925

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 41/195 (21%), Positives = 80/195 (41%), Gaps = 9/195 (4%)
 Frame = +1

Query: 1120 LGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFND 1299
            +G+P  +  N   +     +I S        R+N+     S  ++S+  + N+   + N 
Sbjct: 124  MGSPFVSTPNIHSFPYSATSISSTPTRKSFSRKNSNSNSISNSNSSSMSNLNLNSKYDNY 183

Query: 1300 EFQNPDIISNLDSKRRKLKDAKRDSELIKE---LNKTLTKEDNVSKNLEGKSKEDVKEMR 1470
                  I+ N     + +++++ +S  I+    +N+ L K+DN  +     S++  KE  
Sbjct: 184  PIPPVPILKNPPLNNQNIRNSRNNSNRIRNNHIINRKLLKDDNSYR----ISQQTFKENP 239

Query: 1471 NITE-----NIMQIGMLKNIGYDPTHGKMKYLMKKSNG-KDPSYTSNRSNAVNDLLHFKK 1632
             I E     +++ I  L  I   P     K L K ++  +  S      N   D     K
Sbjct: 240  MIIEKPKYSSVIDINKLLEI---PLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVK 296

Query: 1633 DKVNLKPLKSDLLMK 1677
            + +N  P++S  L+K
Sbjct: 297  NFINFGPIESVYLIK 311

>Suva_6.286 Chr6 (502176..508220) [6045 bp, 2014 aa] {ON} YJL207C
            (REAL)
          Length = 2014

 Score = 32.0 bits (71), Expect = 6.6
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = +1

Query: 1351 LKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQI--GMLKNIGYD 1524
            L + + D ++ K+++  LTK  N + ++  KSK     + +    I+Q+   + K I  D
Sbjct: 650  LSNTQIDKDMAKQVSYLLTKCSNFNHSVNLKSKNIDNALLHNENRILQVYLKLEKYISGD 709

Query: 1525 PTHGKMKYLMKKSNGKDPS-YTSNRSNAVNDLLHFKKDKVNLK 1650
                 +  ++K  N  DP+ YT + S+ ++ L H +  K+  K
Sbjct: 710  FNSSLLILIVK--NFSDPNLYTESGSSVLSSLKHIRSKKMGNK 750

>KLTH0D17006g Chr4 complement(1403707..1412385) [8679 bp, 2892 aa]
            {ON} some similarities with uniprot|P32768 Saccharomyces
            cerevisiae YAR050W FLO1 Lectin-like protein involved in
            flocculation
          Length = 2892

 Score = 32.0 bits (71), Expect = 6.7
 Identities = 25/77 (32%), Positives = 32/77 (41%)
 Frame = +1

Query: 145  KVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNEL 324
            KVS A D    +T GNV   + + I  PGS        T L +TP +   TG    P  +
Sbjct: 2644 KVSLASDSTETATNGNV--VTSTVIVAPGSKSN---SDTGLVSTPASVSQTGTATGPEHV 2698

Query: 325  KLKNQIEPASVPAGSTA 375
                   PA+ PA   A
Sbjct: 2699 TTGPATGPATGPATGPA 2715

>KAFR0C01110 Chr3 complement(225557..226903) [1347 bp, 448 aa] {ON}
            Anc_3.149 YOL069W
          Length = 448

 Score = 31.6 bits (70), Expect = 7.0
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 3/71 (4%)
 Frame = +1

Query: 1285 AFFNDE--FQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKE-DNVSKNLEGKSKED 1455
            A F +E  F     I+ +++   +L+    D  L+++  K +  +  +++ +LEG S+ED
Sbjct: 122  ARFREERMFDCKKFINEMENLLNELRSKFDDFNLLRQQTKDIEDQIGHINDSLEGNSEED 181

Query: 1456 VKEMRNITENI 1488
            + E+ N  +N+
Sbjct: 182  LNELENKNKNL 192

>TDEL0B05550 Chr2 (985068..985805) [738 bp, 245 aa] {ON} Anc_1.447
            YEL018W
          Length = 245

 Score = 31.2 bits (69), Expect = 7.0
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 6/85 (7%)
 Frame = +1

Query: 1276 IAKAFFNDEFQNPD----IISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGK 1443
            +A A   DE  NP       +N+D KR KL    RD+     LNK   K     K+L+  
Sbjct: 112  VAIAKLEDEIINPRKKPRTQTNVDPKREKLLQLYRDT----VLNKLQAKSGGTKKDLQWL 167

Query: 1444 SKEDVKE--MRNITENIMQIGMLKN 1512
             +  V E  +  I + I++I  +KN
Sbjct: 168  YETLVSEGNIEKIVKEIIEIDRIKN 192

>NDAI0A04970 Chr1 (1131663..1133069) [1407 bp, 468 aa] {ON} Anc_3.393
            YBR130C
          Length = 468

 Score = 31.6 bits (70), Expect = 7.1
 Identities = 18/82 (21%), Positives = 44/82 (53%)
 Frame = +1

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNV 1422
            KL N   RST + ++    + ++ ++ S ++ K+RKL D + + E +++  + +  E++ 
Sbjct: 161  KLENYQSRSTKLNESLSVLKHEHDNLTSMINRKQRKLNDIENELEKLQQNYEKIHTENDS 220

Query: 1423 SKNLEGKSKEDVKEMRNITENI 1488
            S +      +  K +++  EN+
Sbjct: 221  SSSKYDDFDQVEKNLQSEIENL 242

>TDEL0C01000 Chr3 (167919..169619) [1701 bp, 566 aa] {ON} Anc_8.72
            YPL020C
          Length = 566

 Score = 31.6 bits (70), Expect = 7.5
 Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 7/107 (6%)
 Frame = +1

Query: 1225 RKEGDSKLHNSNFRS-------TNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELI 1383
            R     KLH +N  +           K  +N E+Q P I+ +    +  L    +DS+L 
Sbjct: 195  RSRSPRKLHGNNQLTPRAQSDEVKYLKTIYNGEYQVPKILEDERENQLSLLQRDKDSQLK 254

Query: 1384 KELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYD 1524
            K +     K  N+    EG S     +   ++E   ++  L+   YD
Sbjct: 255  KTIVDLTQKIKNILVEREGASSASDDDFMIVSER--KVSSLERKRYD 299

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 31.6 bits (70), Expect = 7.5
 Identities = 46/218 (21%), Positives = 85/218 (38%), Gaps = 25/218 (11%)
 Frame = +1

Query: 397 SSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRYLKEETI 576
           S + + +Q  +   T  S  + +      L +     N E ++      I    +KEET+
Sbjct: 295 SLRSLNSQIEEQTSTFASHTIEALAKRDELDRYISSSNSELEQ------IGEILMKEETM 348

Query: 577 DQLLQ-DIKILRLN-KLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKYFKF 750
            + L  +++ LR N ++F ++RP      + S+ +++   ++++G +  +     KY KF
Sbjct: 349 RRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDENGTQCITIKREAKYHKF 408

Query: 751 T-----------------IGDFQQ------NISIFVFNREAIAKYYNLRVGDIICILNPV 861
           T                 IG   Q      N+ IF + +    K Y +        LNP 
Sbjct: 409 TFDRCFGAQESNKDIFHEIGQLIQSSLDGYNVCIFAYGQTGSGKTYTM--------LNP- 459

Query: 862 IAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGW 975
                   E+G I S      T     + + K ++LGW
Sbjct: 460 --------EDGIIPS------TLNHIFLWVEKLKELGW 483

>CAGL0E00737g Chr5 complement(66978..67802) [825 bp, 274 aa] {ON}
            similar to uniprot|Q03973 Saccharomyces cerevisiae
            YDR174w HMO1
          Length = 274

 Score = 31.2 bits (69), Expect = 7.6
 Identities = 33/132 (25%), Positives = 52/132 (39%), Gaps = 1/132 (0%)
 Frame = +1

Query: 1342 RRKLKDAKRDSELIKELNKTLTKEDNVS-KNLEGKSKEDVKEMRNITENIMQIGMLKNIG 1518
            R++L+DA+  + L    +  +T+E +   KNL  + KE  K+  N+     Q+       
Sbjct: 136  RQELRDARAQAGLPPLSSTEITQEISKKWKNLSDEEKEKWKQAYNVELENYQVE------ 189

Query: 1519 YDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEI 1698
                  K KYL  K NG  P               F     N  P+     ++KR  DEI
Sbjct: 190  ------KQKYLEAKKNGTLP--------------EFMDPSTNHAPVPLPANLQKRSIDEI 229

Query: 1699 WNEYFGDQSKSN 1734
            +    G +  S+
Sbjct: 230  YGGSDGHKVSSS 241

>KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {ON}
            Anc_4.364 YJR134C
          Length = 616

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 8/142 (5%)
 Frame = +1

Query: 1165 KKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKR 1344
            +KTN + SKN+   +   +  +E  +KL N                    DI+ + D K 
Sbjct: 125  EKTNELLSKNEKKSLYTISQLEEKSTKLENEY------------------DILKSADKKN 166

Query: 1345 R-KLKDAKRDSELIKELN-------KTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIG 1500
              K+   K++   + ++N       K LTK +   KN+E K +   + +  +   I  + 
Sbjct: 167  TVKIDQLKKELAALNKINKEGESNFKELTKREEDWKNIETKLESKERTIEELNATIQALE 226

Query: 1501 MLKNIGYDPTHGKMKYLMKKSN 1566
                   +    K+K L++ +N
Sbjct: 227  ASSKQEKNDHEEKVKRLIESNN 248

>TPHA0E01410 Chr5 (285375..287240) [1866 bp, 621 aa] {ON} Anc_5.302
            YDR292C
          Length = 621

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 44/203 (21%), Positives = 77/203 (37%), Gaps = 28/203 (13%)
 Frame = +1

Query: 1165 KKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRS-TNI-AKAFFNDEFQNPDI----IS 1326
            KK  N    N+ N  + +N    G       N    +NI A      E   PDI      
Sbjct: 183  KKVTNTKRNNEGNAKKNKNGNNGGRKWGRGGNMEDGSNIDASTLDFSEHGTPDINDEQYE 242

Query: 1327 NLDSKRRKL-KDAKRDSELIKELNKTLTKEDNVS--KNLEGKSKEDV------------- 1458
            N+   +  L K  ++   L+KE+++ L  +  +S  KN EGK K  +             
Sbjct: 243  NISQNKDDLGKRTEKGDFLVKEIDELLASQKELSNQKNTEGKPKGFMGSAYSYLQKNVIG 302

Query: 1459 ------KEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 1620
                   ++  I E + Q  + KN+  +      + + +   G   S  ++  +A ND L
Sbjct: 303  NKTITKDDLNIILEELKQQLISKNVAPEAADFLAQQVSRDLLGSKTSNWTSVQSAANDSL 362

Query: 1621 HFKKDKVNLKPLKSDLLMKKRKR 1689
                 ++    +  DLL + +K+
Sbjct: 363  TKALTQILTPGISVDLLHEVQKK 385

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 46/218 (21%), Positives = 85/218 (38%), Gaps = 25/218 (11%)
 Frame = +1

Query: 397 SSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRYLKEETI 576
           S + + +Q  +   T  S  + +      L +     N E ++      I    +KEET+
Sbjct: 295 SLRSLNSQIEEQTSTFASHTIEALAKRDELDRYISSSNSELEQ------IGEILMKEETM 348

Query: 577 DQLLQ-DIKILRLN-KLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKYFKF 750
            + L  +++ LR N ++F ++RP      + S+ +++   ++++G +  +     KY KF
Sbjct: 349 RRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDENGTQCITIKREAKYHKF 408

Query: 751 T-----------------IGDFQQ------NISIFVFNREAIAKYYNLRVGDIICILNPV 861
           T                 IG   Q      N+ IF + +    K Y +        LNP 
Sbjct: 409 TFDRCFGAQESNKDIFHEIGQLIQSSLDGYNVCIFAYGQTGSGKTYTM--------LNP- 459

Query: 862 IAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGW 975
                   E+G I S      T     + + K ++LGW
Sbjct: 460 --------EDGIIPS------TLNHIFLWVEKLKELGW 483

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] {ON}
            Anc_5.430 YDR365C
          Length = 669

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 15/96 (15%)
 Frame = +1

Query: 1240 SKLHNS-NFRSTNIA--KAFFNDEFQNPDII----SNLDSKRRKLKDAKRDSELIKELNK 1398
            +K++N   FR T     K   +D F   D+     S +D   RKL D+K + + + + +K
Sbjct: 17   AKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGNEKEMNDFDK 76

Query: 1399 TLTKEDN--------VSKNLEGKSKEDVKEMRNITE 1482
               K+D           K++  + KED +E R  TE
Sbjct: 77   YFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETE 112

>Skud_4.391 Chr4 complement(687561..688433) [873 bp, 290 aa] {ON}
           YDR130C (REAL)
          Length = 290

 Score = 31.2 bits (69), Expect = 7.8
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +1

Query: 232 SPEKIKRKHTQLAATPVTKKN-TGIQDNPNELKLKNQIEPASVPA 363
           SPE+I+++H      P   KN TG+ D PNE    N++    + A
Sbjct: 148 SPERIQQQHQVPQILPSQAKNGTGVTDEPNENSYDNELSQDKLKA 192

>KAFR0G03490 Chr7 complement(720975..723227) [2253 bp, 750 aa] {ON}
            Anc_6.150 YBR238C
          Length = 750

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 1051 EFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARK 1230
            +F  E    + + K + LN S +     + + +  LY+  +N     +QFN    +N  +
Sbjct: 70   DFMYEMNPNSQSMKDVPLNNSNSNNHKNRNNNHEGLYRNDSNKNSRGHQFNF---KNQSR 126

Query: 1231 EGDSKLHNSN 1260
              DS+ HNSN
Sbjct: 127  NNDSQNHNSN 136

>CAGL0F08635g Chr6 (857724..859997) [2274 bp, 757 aa] {ON} similar to
            uniprot|P53202 Saccharomyces cerevisiae YGR003w
          Length = 757

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 10/98 (10%)
 Frame = +1

Query: 1165 KKTNNIYSKNQFN--VVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNP-------- 1314
            KK +   S   F   VVR+  A  E ++K +NS   S  +   + N + +          
Sbjct: 342  KKCHEFLSNVNFGSVVVRKSEADNETETKAYNSAVISNEVFSEYLNQDGKRSSEFVTIYL 401

Query: 1315 DIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 1428
            D    L  +++K K  K+D +   +L K L ++D  S+
Sbjct: 402  DSCLKLSIEKQKYKQVKQDLDAAVKLFKLLQEKDIFSQ 439

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] {ON}
            similar to uniprot|P54199 Saccharomyces cerevisiae
            YDL028c Serine/threonine protein kinase
          Length = 774

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 32/151 (21%), Positives = 56/151 (37%), Gaps = 15/151 (9%)
 Frame = +1

Query: 1060 RETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGD 1239
            ++ E R  A K + +  S        +++ PS+   K NN+    +      R       
Sbjct: 272  QKEENRKKALKNVNMKQSLNYDLKHYSNSFPSIESGKENNLIHNTEIEDFNGRGHSTNNH 331

Query: 1240 SKLHNSNFRSTNIAKAFF---NDEFQNPDI---ISNLDSKRRKLKDA---------KRDS 1374
            S  + SN  S  ++  F    N E + P +   +SN DS R   ++A          RD 
Sbjct: 332  SSSYLSNSHSHPVSTQFVESANIELEKPTLKKSLSNADSYRHTQREALQNIDVNSNVRDG 391

Query: 1375 ELIKELNKTLTKEDNVSKNLEGKSKEDVKEM 1467
             +  +  K   K+      L+ K    +K +
Sbjct: 392  AIDYKRQKIALKDSEFDGILDKKKYRGIKRV 422

>CAGL0F07667g Chr6 complement(744275..746653) [2379 bp, 792 aa] {ON}
            some similarities with uniprot|Q03825 Saccharomyces
            cerevisiae YMR164c MSS11 activator of STA1 STA2 and STA3
          Length = 792

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = +1

Query: 1372 SELIKELNKTLTKEDNVSKNLEGKSKEDVKEMR--NITENIMQIGMLKN 1512
            S+ +KE+   LT  +N+ K  E   ++D  +MR  +I EN+++  ML N
Sbjct: 75   SQFLKEVEVPLTTIENIGKIKENTVRDDSSQMRYDDIPENLLRPDMLLN 123

>KLLA0E14191g Chr5 complement(1254213..1256795) [2583 bp, 860 aa] {ON}
            similar to uniprot|P34077 Saccharomyces cerevisiae
            YFR002W NIC96 Component of the nuclear pore complex
            required for nuclear pore formation forms a subcomplex
            with Nsp1p Nup57p and Nup49p
          Length = 860

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 34/144 (23%), Positives = 51/144 (35%), Gaps = 25/144 (17%)
 Frame = +1

Query: 1357 DAKRDSELIKELNKTLTKEDNVSKNLEGKSKE------DVKEMRNITENIMQIGMLKNIG 1518
            DAK      K  +K   +    SKNL   S +       V EM+   +      M K I 
Sbjct: 19   DAKTSGSTSKSSSKLFNELLETSKNLPSTSSDLGAILLSVNEMKKRAQE-----MRKTIP 73

Query: 1519 YDPTHGKMKYLMKKSNGKDPSYTSNRSNA-------------------VNDLLHFKKDKV 1641
            +D  H K  YL+  S  +     S+  N                    ++  LH KKD+ 
Sbjct: 74   HDSNHTKAHYLLAGSGLEFHEIESSLKNLKSSELLTEQRVAQGYNDGDLDTYLHIKKDEN 133

Query: 1642 NLKPLKSDLLMKKRKRDEIWNEYF 1713
             L  ++  L +  +  D   N+ F
Sbjct: 134  ILSSIEQSLSLAAKDFDNFINQNF 157

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
            (REAL)
          Length = 948

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 56/277 (20%), Positives = 107/277 (38%), Gaps = 28/277 (10%)
 Frame = +1

Query: 880  SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPI------NKTKD 1041
            ++ NG   + N+++   YD              N   +S    P   P       N  K 
Sbjct: 279  NQSNGSNANGNMNVNADYDSFF-----------NANTRSNSSNPNQNPYFLSSRNNSLKF 327

Query: 1042 KCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRN 1221
               +F  + + RN++ +    +G+     P ++  N      KTNN  + N  N++   N
Sbjct: 328  NPEDFDFQFKRRNSSVRGTLDHGNQNAFIP-ESRLNSLSVSSKTNNDTAPNNENIIDNTN 386

Query: 1222 ARKEGDSKLHNSNFRSTNIAKAFFNDEFQ---NPDIISNLDSK-------RRKLKDAKRD 1371
              K  +    + N  +    K   ND      NP   +N+ ++            ++++D
Sbjct: 387  NSKSNEINNEDGNNNNNTNMKHDDNDNNDSSINPTSSTNIPNQDDHSLVSANNASNSRKD 446

Query: 1372 -SELIKELNKTLTKEDNVSKNLE---GKSKEDVKEM----RNITENIMQIGMLKNIGYDP 1527
              E+ + L K L  ED+ S  +     K+ E V+      +++ E+ MQ  + K +  D 
Sbjct: 447  LKEIEQRLRKHLNDEDSYSNTIARPLDKNSEIVESNEGSDQHVDESSMQTDVNKKMKKDE 506

Query: 1528 THGKMKYLMKKSNGKDPSYTSNRSNAVND----LLHF 1626
            +     Y+  ++   D S    + N V+D    ++HF
Sbjct: 507  S---AIYIKNEAPHNDSSVI--KGNQVSDESASIIHF 538

>TBLA0C00390 Chr3 complement(67095..70328) [3234 bp, 1077 aa] {ON}
            Anc_8.14 YLR072W
          Length = 1077

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 1/130 (0%)
 Frame = +1

Query: 1063 ETEFRNAAAKRIELNGS-FALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGD 1239
            ++  R A+     +N S  ++ A  K  +  S    KT ++   N  N   + ++    D
Sbjct: 74   DSNIRKASVDGTAINTSNSSVNANAKYLSEQSEASTKTASVTDLNPTNTPPQNSS----D 129

Query: 1240 SKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDN 1419
            + +  SN  STN +KA   +  +  D+ SN++  R+KL       +L KEL K +  +  
Sbjct: 130  TTI-TSNVSSTNKSKATKREAKKKTDLKSNINIIRQKL-------DLQKELPKLVNHKST 181

Query: 1420 VSKNLEGKSK 1449
             S ++  KSK
Sbjct: 182  NSSSITPKSK 191

>TPHA0A01880 Chr1 (379362..382604) [3243 bp, 1080 aa] {ON} Anc_8.248
            YDR104C
          Length = 1080

 Score = 31.6 bits (70), Expect = 8.2
 Identities = 47/218 (21%), Positives = 76/218 (34%), Gaps = 8/218 (3%)
 Frame = +1

Query: 988  VKSKGGKPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKK 1167
            +     KP    +N  KD    + R     N    R   NG+  L        NP + K 
Sbjct: 120  ISESESKPLLKKVNVDKDNAINYRRIHSRNNKKLGRYNKNGNKLL--------NPRIDKI 171

Query: 1168 KTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRR 1347
             + NI      +     N   E   KL  SN                      NL +K R
Sbjct: 172  SSKNIIDNESQSYFTANNITSEIIGKLEQSN----------------------NLVNK-R 208

Query: 1348 KLKDAKRDSELIKELNKTLTKEDNVSKNLEG-------KSKEDVKEMRNITENIMQIGML 1506
             +   K   E I+ L +    E +   NL+         S + V + R+   +   + +L
Sbjct: 209  SINSLKTYGESIESLPRDPGSESDYHFNLKSICEFNNHPSSQHV-DTRSYIIDKDYLNVL 267

Query: 1507 KNIGYDPTHGKMKYLMKKSNGKDPSY-TSNRSNAVNDL 1617
            +     PT  ++  L+   N + P + TSNR N+ +++
Sbjct: 268  EPKPMSPTKNELDVLLNNENKRKPVFTTSNRHNSSHNV 305

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 31.6 bits (70), Expect = 8.3
 Identities = 35/166 (21%), Positives = 66/166 (39%), Gaps = 20/166 (12%)
 Frame = +1

Query: 991  KSKGGKPCGTPINKTKDKCCEFHRETEFRNAAA-----KRIELNGSF--ALGAPTKADTN 1149
            + +GGK    P+NK+  K  E + +T+ +N +      K +  NGSF       + ++ +
Sbjct: 968  QQRGGKDLEPPLNKSVQKTREKNNDTQAKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKS 1027

Query: 1150 PSLYKKKTNNIYSKNQFNVVRR----------RNARKEGDSKLHNSNFRSTN---IAKAF 1290
              LY K    + +K  FN + +          +N +   ++        S N   +    
Sbjct: 1028 TELYAK----VSAKQLFNGLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTL 1083

Query: 1291 FNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 1428
            F         +S ++ K+      K   +L+KE+   L KE  + K
Sbjct: 1084 FEVSIYQKGKVSVVEFKKIS-GSFKTVKKLVKEVENVLNKEGVLQK 1128

>Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250W
            (REAL)
          Length = 1312

 Score = 31.6 bits (70), Expect = 8.4
 Identities = 31/142 (21%), Positives = 54/142 (38%), Gaps = 18/142 (12%)
 Frame = +1

Query: 1141 DTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDI 1320
            D   ++   K      +N  N + RR    E   + +  N       K  F   F     
Sbjct: 322  DLEMNISNLKNQQSSLQNHSNSLIRRQGELEARKEAYEQNLSHLASLKEDFQQRFHRLSN 381

Query: 1321 ISNLDSKRRKLKDAKRDSELIKELNKT--------LTKEDNVSK----------NLEGKS 1446
             +N D  +   + ++  + + ++L+ T        L KE NVS+          NLE   
Sbjct: 382  ENNTDMAQTNDEMSQFQTRISQDLSNTAEQFAKEILLKETNVSELVKSITVDSQNLEYNK 441

Query: 1447 KEDVKEMRNITENIMQIGMLKN 1512
            K+  K +R+  E   ++ +LKN
Sbjct: 442  KDRTKLIRDTEELTEEVRLLKN 463

>NDAI0D03340 Chr4 complement(790702..791718) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 31.2 bits (69), Expect = 8.4
 Identities = 46/156 (29%), Positives = 68/156 (43%), Gaps = 3/156 (1%)
 Frame = +1

Query: 1243 KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNV 1422
            KL NSN+    ++KAF  D F +    S+ ++ R  L D  + + LI EL       DN 
Sbjct: 166  KLFNSNY----LSKAFI-DTFDSTK--SHAENLRLALMDPVKSTILINELL------DN- 211

Query: 1423 SKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSN 1602
              NL  K    +  MRN   N ++ GM++ I   P   K K  + K    D     NR  
Sbjct: 212  GINLMAK----ISPMRNTNFNHLRDGMIRTIKKHPEAEKNKEALDKGI-LDLRKAFNRKG 266

Query: 1603 AVNDLLHFKKDKVNLKPLKS---DLLMKKRKRDEIW 1701
            A++     K D + ++ L      L    +KRDE +
Sbjct: 267  ALD-----KDDDLYVQLLNDGALQLTFHSKKRDEFF 297

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 31.6 bits (70), Expect = 8.4
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 15/105 (14%)
 Frame = +1

Query: 1219 NARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRR-----------KLKDAK 1365
            N  K    K+H      +   +   N + +N  I++NLDSKR+           K+    
Sbjct: 417  NVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTD 476

Query: 1366 RDSELIKELNKTLTKEDNV---SKNLEGKSKEDVK-EMRNITENI 1488
            ++ + I E   +L +   V   + ++E +  E++K ++R  TE++
Sbjct: 477  QEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHL 521

>TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1504

 Score = 31.6 bits (70), Expect = 8.5
 Identities = 29/119 (24%), Positives = 50/119 (42%)
 Frame = +1

Query: 1333 DSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKN 1512
            + KRRKL++ +R  E  +   K   KE+   K  E + + + ++ R   E + +    +N
Sbjct: 838  EEKRRKLEEQRRREEEQERQRKL--KEEQKRKRDEERRQREEEQKRKQEEKLRRKQEEEN 895

Query: 1513 IGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKR 1689
                      K L K+   K+      +      LL  KK++  L   K D   KK+K+
Sbjct: 896  ----------KRLQKEKEEKEKLLKKQKELEEEKLLKKKKEQERLAKFKKDEEAKKKKQ 944

>Smik_8.240 Chr8 complement(388293..389333) [1041 bp, 347 aa] {ON}
            YHR156C (REAL)
          Length = 347

 Score = 31.2 bits (69), Expect = 8.5
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 1/106 (0%)
 Frame = +1

Query: 970  GWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTN 1149
            GW    +K KG +   T   +  D    +HR+  +RN      E +   ++ + T  + N
Sbjct: 6    GWNTSKLKRKGDQ--FTDDEELHDG--PYHRDKRYRNGKLNTAEYDSDSSVESYTDDENN 61

Query: 1150 PSLYKKKTNNIYSKNQFNVVRRRNAR-KEGDSKLHNSNFRSTNIAK 1284
                  K N +  K   ++    N +  EG  KL  SN +  +IA+
Sbjct: 62   GRGMDAKINEVDEKKDEDMFSSDNYKHSEGHEKLKKSNMKLLDIAE 107

>SAKL0B10274g Chr2 (881660..886324) [4665 bp, 1554 aa] {ON}
            uniprot|Q875Q8 Saccharomyces kluyveri MYO2 Myosin- 2
          Length = 1554

 Score = 31.6 bits (70), Expect = 8.5
 Identities = 27/132 (20%), Positives = 55/132 (41%), Gaps = 10/132 (7%)
 Frame = +1

Query: 1291 FNDEFQNPDIISNLDSKR---RKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVK 1461
            FN   ++  ++ +L  K+   +KLKD K +++ +  L +   K +N    L     E VK
Sbjct: 893  FNTTRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVK 952

Query: 1462 EMRNITENIMQI-------GMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 1620
            E + +T  I ++         +K +         K L ++ +  D  +   +   VN   
Sbjct: 953  ENKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKK 1012

Query: 1621 HFKKDKVNLKPL 1656
              ++ K  ++ L
Sbjct: 1013 EVEEAKEEIEQL 1024

>Ecym_8397 Chr8 (818932..819999) [1068 bp, 355 aa] {ON} similar to
            Ashbya gossypii ACL051C
          Length = 355

 Score = 31.2 bits (69), Expect = 8.6
 Identities = 48/205 (23%), Positives = 80/205 (39%), Gaps = 20/205 (9%)
 Frame = +1

Query: 919  IQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFH--RETEFRNAAAK 1092
            +Q   +C  E  + R L   +     +G KP    +    DK    +   E E+ N+  +
Sbjct: 80   LQKTDECTSERSRKRSLE--HRVCLERGVKPLEKKLGYQLDKLTRAYIKMEKEYDNSKQR 137

Query: 1093 RIELNGSFALGAPTKADTNPS---------LYKKKTNNIYSKNQFNVVRRRNARK--EGD 1239
              E  G  A+GA   A ++ S         +YK  TN + SKN     R + A +  +G 
Sbjct: 138  ARE-RGESAVGAAEGAGSDVSDSSDDEEALMYKPNTNAMVSKNTGKNSRDKKAPQDVDGG 196

Query: 1240 SKLHNSNFRSTNIAKAF-------FNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNK 1398
             + ++  ++   I+          F D+F N     N  SK R     +   E IKE   
Sbjct: 197  EESNSGVYKPPKISAMLPPAQNHHFEDKF-NAQEHKNRSSKSR----MQAMEEFIKENTD 251

Query: 1399 TLTKEDNVSKNLEGKSKEDVKEMRN 1473
                E ++  N+    K  +K +R+
Sbjct: 252  QPELETSIGANIVKHGKGGIKSLRD 276

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 31.6 bits (70), Expect = 8.6
 Identities = 35/147 (23%), Positives = 62/147 (42%), Gaps = 2/147 (1%)
 Frame = +1

Query: 1300 EFQNPDIISNLDSKRRKLKDAKRDSE-LIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNI 1476
            E Q+ +  S L+ + + L      SE L KEL   L+      + LE + +E  KE+  I
Sbjct: 717  EIQSSEKRSQLEKQIKSLTSNFEASEQLKKELEDKLSTISEKQQTLESEYEEKKKELAEI 776

Query: 1477 TENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL-HFKKDKVNLKP 1653
            T N   +  L     +    K+   +KK         +     V +L  H +K++  +  
Sbjct: 777  TANNTSLEQL-----NTQKEKLTEELKKQLADTKEKLTQMEKQVKELSEHKEKNEQGINK 831

Query: 1654 LKSDLLMKKRKRDEIWNEYFGDQSKSN 1734
            +  DL   +R++ ++  E    QSK +
Sbjct: 832  MNRDLFSLQREKQKL--EEDNKQSKKD 856

>TDEL0A05990 Chr1 (1051012..1051701) [690 bp, 229 aa] {ON} Anc_8.653
            YOR232W
          Length = 229

 Score = 30.8 bits (68), Expect = 8.9
 Identities = 17/77 (22%), Positives = 36/77 (46%)
 Frame = +1

Query: 1252 NSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 1431
            N+ F +T +    + D+ + P+      S  ++      + ++IKEL   + K+D  +  
Sbjct: 26   NATFANTRLGLRSYADDVK-PETEEAKQSAAKETDSLTEEQKMIKELEAKVEKKDKEAVE 84

Query: 1432 LEGKSKEDVKEMRNITE 1482
            L+ +    V + RN+ E
Sbjct: 85   LKDRLLRSVADFRNLQE 101

>KAFR0B05820 Chr2 (1203344..1203757) [414 bp, 137 aa] {ON} Anc_8.337
           YDR156W
          Length = 137

 Score = 30.0 bits (66), Expect = 9.0
 Identities = 20/63 (31%), Positives = 29/63 (46%)
 Frame = +1

Query: 565 EETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKYF 744
           + T+   L  +K  RL + F  + P  FESP  S    V V   ++G  +T S T     
Sbjct: 75  DTTLTSSLSQLK--RLQRDFKGLPPATFESPSPSTTTPVTVTVTETGDSITKSATGGTKM 132

Query: 745 KFT 753
           KF+
Sbjct: 133 KFS 135

>CAGL0A01606g Chr1 complement(159192..159914) [723 bp, 240 aa] {ON}
            similar to uniprot|P53187 Saccharomyces cerevisiae
            YGL033w HOP2
          Length = 240

 Score = 30.8 bits (68), Expect = 9.2
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 4/69 (5%)
 Frame = +1

Query: 1315 DIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQ 1494
            D+++ L    R + DAK D +L +  + T  KE N  KNLE   K+D+   + +  +++ 
Sbjct: 132  DVLATLRESERDI-DAKLD-DLERNWDPTNQKEINELKNLEKNLKKDLASRKKLINDLLA 189

Query: 1495 I----GMLK 1509
            I    G+LK
Sbjct: 190  IIKESGLLK 198

>Kwal_26.8727 s26 (916132..917469) [1338 bp, 445 aa] {ON} YPL146C -
            Protein required for cell viability [contig 67] FULL
          Length = 445

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 26/137 (18%), Positives = 61/137 (44%), Gaps = 16/137 (11%)
 Frame = +1

Query: 1150 PSLYK---KKTNNIYSKNQFNVVRRRNARKEGDSKL-HNSNFRSTNIAKAFFNDEFQNPD 1317
            P+ YK   +K    + KN        + R++ D ++ H S   S+   +  F  +    +
Sbjct: 8    PAQYKQTSRKGKKAWRKNIDISDIENSIRQQNDEEITHGSKDLSSLRNEDLFQVDTVGDE 67

Query: 1318 IISNLDSKRRKLKDAKRDSELIKELNKT------------LTKEDNVSKNLEGKSKEDVK 1461
            ++     KR+++K   + SE+++ +                TK+++ +K ++G SK++++
Sbjct: 68   VLKQKLIKRKQIKKNLKSSEILESIKTNSKVPALAHRKSKATKDEDKTKKIQGVSKKELR 127

Query: 1462 EMRNITENIMQIGMLKN 1512
             +  +   +     LKN
Sbjct: 128  RLMALAGRVEGESKLKN 144

>NCAS0D01160 Chr4 complement(213074..213865) [792 bp, 263 aa] {ON}
           Anc_2.385 YMR144W
          Length = 263

 Score = 30.8 bits (68), Expect = 9.8
 Identities = 40/171 (23%), Positives = 67/171 (39%), Gaps = 7/171 (4%)
 Frame = +1

Query: 292 NTGIQ---DNPNELKLKNQI-EPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARV 459
           N G+Q    N N L  K ++ +P S    +  +  +N  +      + IQD  TL +   
Sbjct: 22  NAGLQLAIHNVNHLINKMKVPQPISPVEDNNEFEADNDNNIVFTNGKYIQDLTTLSTPTT 81

Query: 460 HSFGNYTNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKI---LRLNKLFAK 630
               N   L  + Q++        SGL  S R ++E     +LQ +      R  K+   
Sbjct: 82  PLDSNIQGLTNQVQVLTKAVDTLSSGLSDSLRQVRELKYKSMLQTLNFDSDRRKAKVEIS 141

Query: 631 IRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISI 783
           +   ++E  +Y N+ A+        +K   S    K  K+     Q+NI I
Sbjct: 142 LLKQEYEQTKYMNFNAI------EEYKCHLSRKEAKIQKYKKKLVQKNIEI 186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 151,850,104
Number of extensions: 3377579
Number of successful extensions: 12555
Number of sequences better than 10.0: 169
Number of HSP's gapped: 12398
Number of HSP's successfully gapped: 173
Length of query: 595
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 480
Effective length of database: 40,294,809
Effective search space: 19341508320
Effective search space used: 19341508320
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 35 (18.1 bits)