Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010205.703ON59459431520.0
TDEL0B021705.703ON56760213141e-175
YIL150C (MCM10)5.703ON57160013121e-175
Suva_9.385.703ON56960513091e-174
Skud_9.185.703ON57160012941e-172
Smik_9.195.703ON57260112881e-171
KAFR0D022105.703ON58461712881e-171
Kpol_1043.715.703ON58561012481e-165
NCAS0G002205.703ON59259712331e-163
NDAI0F002805.703ON61063812141e-160
KNAG0L021505.703ON61663112011e-157
ZYRO0G06578g5.703ON56960411831e-155
TPHA0E002105.703ON54456611801e-155
CAGL0H06589g5.703ON58361311731e-154
KLTH0E01034g5.703ON58358511641e-152
SAKL0E14938g5.703ON57460610871e-141
Kwal_55.196915.703ON46647710111e-131
AFR287W5.703ON6116298651e-107
KLLA0A00572g5.703ON5776107891e-96
NDAI0F008605.624ON42955790.59
TPHA0C036802.346ON913104770.96
SAKL0B09504g7.102ON657128771.0
KLTH0D17006gsingletonON289277771.2
Kwal_55.21164singletonOFF588164732.8
TBLA0D006508.799ON156849733.3
Kwal_YGOB_55.211643.479ON657164723.5
Kpol_1070.207.220ON62995707.6
CAGL0M10109g2.494ON46379698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01020
         (594 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...  1218   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   510   e-175
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   509   e-175
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   508   e-174
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   503   e-172
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   500   e-171
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   500   e-171
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   485   e-165
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   479   e-163
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   472   e-160
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   467   e-157
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   460   e-155
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   459   e-155
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   456   e-154
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   452   e-152
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   423   e-141
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   394   e-131
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   337   e-107
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   308   1e-96
NDAI0F00860 Chr6 (210078..211367) [1290 bp, 429 aa] {ON}               35   0.59 
TPHA0C03680 Chr3 (801572..804313) [2742 bp, 913 aa] {ON} Anc_2.3...    34   0.96 
SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {...    34   1.0  
KLTH0D17006g Chr4 complement(1403707..1412385) [8679 bp, 2892 aa...    34   1.2  
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    33   2.8  
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    33   3.3  
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    32   3.5  
Kpol_1070.20 s1070 complement(46652..48541) [1890 bp, 629 aa] {O...    32   7.6  
CAGL0M10109g Chr13 (1006975..1008366) [1392 bp, 463 aa] {ON} sim...    31   8.6  

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score = 1218 bits (3152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/594 (100%), Positives = 594/594 (100%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120
           TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180
           AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL
Sbjct: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240
           WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS
Sbjct: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300
           SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI
Sbjct: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360
           KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN
Sbjct: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 420
           AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN
Sbjct: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSN 420

Query: 421 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 480
           FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG
Sbjct: 421 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 480

Query: 481 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 540
           KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL
Sbjct: 481 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 540

Query: 541 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594
           HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV
Sbjct: 541 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  510 bits (1314), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 278/602 (46%), Positives = 396/602 (65%), Gaps = 43/602 (7%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           MNDPREV + D F  ++ DE+++ EL+ QI  IERQKRDL ERL+ KR++ ++ DPNF  
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQL-KSKDPNF-- 57

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120
                DA     IQV  SP  +K+    +   P   K     +N NE K++++   + +P
Sbjct: 58  -----DA-----IQVESSP--VKKPAESIKVEPSRTKRVLDIENLNEKKVESR---SQIP 102

Query: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSF----GNYTNLQKESQIINVEEKEK 176
           A +T+YF++NF +SKK E +  Q+ + L+S RVH+F    GN+     + + + VEE E+
Sbjct: 103 ANTTSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNH-----KFKAVAVEEVEE 157

Query: 177 YSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGF 236
           YS LW+ +RY+ ++ + ++L ++KILRL+KLFAKI+PPKF  PQYSNW  +G+I+ K   
Sbjct: 158 YSDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQV 217

Query: 237 KLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEE 296
           K +SS  P KYFKFT+ DFQ N+ ++VF ++ + +YYNLRVGDI+ ILNP + PWRPSE+
Sbjct: 218 KFSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEK 277

Query: 297 NGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRET 356
             +IKSFNL I   + CI+EIG+SRD+ WC    KS+  K CGTPINKTK+KCC+FHRE 
Sbjct: 278 GNFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQ-NKACGTPINKTKEKCCDFHREI 336

Query: 357 EFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEG-DSK 415
           +FR+  AKRIELNGSFALGAPTK D+ P+LY++K+   +    F V+     +  G +S 
Sbjct: 337 QFRSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAH--RNFKVLPNHYQKSVGKNSD 394

Query: 416 LHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVS 475
           L   +F + N AKAFFNDEFQNPDI++NLDSKRRK +D K+   L ++L +  ++   + 
Sbjct: 395 LRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIE 454

Query: 476 KNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS---YTSNR 532
                K  E++ E    TE  +Q G+++N+G+DPTHG++  ++K++  KD S     + +
Sbjct: 455 IEKGSKKYEEICET---TEATLQSGLIQNLGFDPTHGEIGNVLKQA-AKDKSNNGQLNKK 510

Query: 533 SNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLE 592
              V+ LL FKK+ V LKP K  LL +KR R+  W E FGD+S     + LSS  DSD+E
Sbjct: 511 QKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKS-----VNLSSDSDSDIE 565

Query: 593 IV 594
           IV
Sbjct: 566 IV 567

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  509 bits (1312), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 264/600 (44%), Positives = 392/600 (65%), Gaps = 35/600 (5%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           MNDPRE+   D ++NI+ DE++E  + +++E +ER+++ L ERL+ K++  +  DPNF +
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120
                       I+VP SP K + K     AT    K  G   N NE++L    +    P
Sbjct: 61  ------------IEVPQSPTKNRVKVGSHNATQQGTKFEG--SNINEVRLSQLQQQPKPP 106

Query: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180
           A +T YFM  F ++KK E ++I  +E++M+ARVH+F   T+ +K   II   E E +S L
Sbjct: 107 ASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFS--TDEKKYVPII-TNELESFSNL 163

Query: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240
           W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P+Y+NW  VG+I+ KS  K TS
Sbjct: 164 WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 223

Query: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300
           S  P K+F FTI DFQ  + +++F ++ + +YYNLR+GD+I ILNP + PWRPS    +I
Sbjct: 224 SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 283

Query: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360
           KSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN +  KCC++HRE +FR 
Sbjct: 284 KSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKKCGSPINISLHKCCDYHREVQFRG 342

Query: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVV---RRRNARKEGDSKLH 417
            +AKRIELNG +ALGAPTK D+ PSLYK K      +N FN++   R+R + +E   K  
Sbjct: 343 TSAKRIELNGGYALGAPTKVDSQPSLYKAK-----GENGFNIIKGTRKRLSEEEERLKKS 397

Query: 418 NSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 477
           + NF ++N AKAFF+++FQNPD+++NLD+KRRK+ + K+ + L +EL K + + +  S  
Sbjct: 398 SHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRE--SSG 455

Query: 478 LEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSN 534
           LE KS  + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S +G +P  +    +  
Sbjct: 456 LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 515

Query: 535 AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594
            +NDLLH+KK+KV L P K++   K+  R+E+W ++FG  SK  ++   S G  SDLEI+
Sbjct: 516 VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFG--SKETKET--SDGSASDLEII 571

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  508 bits (1309), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 268/605 (44%), Positives = 384/605 (63%), Gaps = 47/605 (7%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           M+DPRE+   D ++N++ DE++E  + K++E +ER+K+ L ERL+ K+   +  DPNF +
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  TEGNVDATSESRIQVPGSPEK---IKRKHTQL--AATPVTKKNTGIQDNPNELKLKNQIE 115
            E            VP SP K   +K+    L  A  PV         N NE  L  Q +
Sbjct: 61  VE------------VPQSPAKKSIVKKSQDALKQAIRPVA-------SNINESMLSQQSQ 101

Query: 116 PASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKE 175
            +  P+ +T YFM  F  +K+ E ++I  YE +M+ARVH+FG      KE + I   E E
Sbjct: 102 ES--PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN---KEYKPIITNELE 156

Query: 176 KYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSG 235
            +S LW+ +RY+ EE + + L +IKILRLNKLFAKIRPPKF+ P Y+NW  VG+I+ KS 
Sbjct: 157 SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 216

Query: 236 FKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE 295
            K TSS  P K+F FTI DFQ ++ +++F ++ + +YYNLR+GD+I ILNP + PWRPS 
Sbjct: 217 IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 276

Query: 296 ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 355
              +IKSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN     CC++HRE
Sbjct: 277 RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKSCGSPINTNVHMCCDYHRE 335

Query: 356 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR--RRNARKEGD 413
            +FR   AKRIELNG +ALGAPTK D+ PSLY+ K      +NQFN+VR  R+   +E +
Sbjct: 336 VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAK-----GENQFNIVRSTRKGLSEEEE 390

Query: 414 SKLHNS-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKED 472
               NS NF ++N AKAFF+++FQNPD+++NLDSKRRK+ D K+ + L +EL K + ++D
Sbjct: 391 RVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKD 450

Query: 473 NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS--NGKD-PSYT 529
             S  LE KS+ + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S   G+  P+  
Sbjct: 451 --SSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRI 508

Query: 530 SNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDS 589
           + +   +NDLL +KK+KV L P K++   K+  R+E+W  +FG    S    + S    S
Sbjct: 509 NGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFG----SKETEVASDASGS 564

Query: 590 DLEIV 594
           DLEIV
Sbjct: 565 DLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  503 bits (1294), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 258/600 (43%), Positives = 387/600 (64%), Gaps = 35/600 (5%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           M+DPRE    D ++N++ DED+E  + K++E +ER+K+ L ERL+ K++  RA DPNF +
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120
                       I+VP SP   K ++   +   + +       N N+LKL    +   +P
Sbjct: 61  ------------IEVPQSP--AKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELP 106

Query: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180
           + +T YFM  F ++K+ E ++   YE +M+ARVH+FG     +KE +     E E++S +
Sbjct: 107 SNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTD---KKEYRATIANELEEFSNI 163

Query: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240
           W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P Y+NW  VG+I+ KS  K TS
Sbjct: 164 WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTS 223

Query: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300
           S+ P K+F FTI DFQ  + +++F ++A+ +YYNLR+GD+I ILNP + PWRPS +  +I
Sbjct: 224 SDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFI 283

Query: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360
           KSFNL I   + CI+EIG SRDLGWC + V  K  + CG+PIN    KCC++HRE +FR 
Sbjct: 284 KSFNLRISHDFKCILEIGSSRDLGWCPI-VNRKKNENCGSPINIALHKCCDYHREVQFRG 342

Query: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR--RRNARKEGDSKLHN 418
            +AKRIELNG +ALGAPTK D  P+LY+ K      +N FN+VR  R+   +E +    N
Sbjct: 343 TSAKRIELNGGYALGAPTKVDAQPTLYRAK-----GENNFNLVRSIRKTLSEEEERMKKN 397

Query: 419 S-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 477
           S NFR++N AKAFF+++FQNPD+++NLDSKRRK+ D+K+ + L +EL K + ++   S  
Sbjct: 398 SHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKG--SSG 455

Query: 478 LEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSN 534
           LE K  E+ ++++  TE+ +Q G+L+ +G+DPTHGK+  ++K S  G +P       +  
Sbjct: 456 LEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKT 515

Query: 535 AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594
            ++DLL++KK+KV L P K++   K+  R+E+W ++FG +        +S    SDLEIV
Sbjct: 516 VIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDE----VSDASTSDLEIV 571

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  500 bits (1288), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 259/601 (43%), Positives = 388/601 (64%), Gaps = 36/601 (5%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           M+DPRE+   D +++++ DE++E  + K++E +ER+++ L ERL+ K+   +  DPNF +
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKH-TQLAATPVTKKNTGIQDNPNELKLKNQIEPASV 119
                       I+VP SP K + K  +Q A   VT+  T    N NE  L    +   +
Sbjct: 61  ------------IEVPQSPTKSRVKSGSQNAVKQVTRLETS---NANESNLSQIQKQPEL 105

Query: 120 PAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSG 179
           P  +T YFM  F ++KK E ++I  +E++M ARVH+FG  T+ +K   II   E E +S 
Sbjct: 106 PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPII-ANELEGFSN 162

Query: 180 LWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLT 239
           LW+ +RY+ E+ + + L +IKILRL KLFAK+RPPKF++P+Y+NW  VG+I+ KS  K T
Sbjct: 163 LWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFT 222

Query: 240 SSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGY 299
           SS  P K+F FTI DFQ  + +++F ++ + +YYNLR+GDII ILNP + PWRPS    +
Sbjct: 223 SSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNF 282

Query: 300 IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFR 359
           IKSFNL I   + CI+EIG SRDLGWC + V +K  K CG+PIN +  KCC++HRE +FR
Sbjct: 283 IKSFNLRISHDFKCILEIGSSRDLGWCPI-VNTKTHKKCGSPINISLHKCCDYHREVQFR 341

Query: 360 NAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR-RRNARKEGDSKLHN 418
             +AKRIELNG +ALGAPTK ++ PSLYK K      +N+FN++R  R    E + ++  
Sbjct: 342 GTSAKRIELNGGYALGAPTKVNSQPSLYKAK-----GENRFNIIRDARKGLSEEEERMKK 396

Query: 419 S--NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 476
           S  NF ++N AKAFF+++FQNPD+++NLD+KRRK+ D K+   L +EL K + +++  S 
Sbjct: 397 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKE--SS 454

Query: 477 NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS---YTSNRS 533
            LE KS  + ++M+  TEN +Q G+++ +G+DPTHG++  ++K S     S     + + 
Sbjct: 455 GLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKK 514

Query: 534 NAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEI 593
             +NDLLH+KK+KV L P K++   K+  R+E+W  +FG + ++      S    SDLEI
Sbjct: 515 TVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEE---ASDASASDLEI 571

Query: 594 V 594
           +
Sbjct: 572 I 572

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  500 bits (1288), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 272/617 (44%), Positives = 392/617 (63%), Gaps = 56/617 (9%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           M+DPRE+  NDL+ NI+PD+++   ++ ++E IE  KRDL ERL  K+      DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTK-KNTG----IQDNPNELKLKNQIE 115
                       +QVP SP  +K+   QL      K KN        +NPNEL L+ + +
Sbjct: 61  ------------VQVPASP--VKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQ 106

Query: 116 PASV----PAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINV 171
             +        ST YFM  F  +K+ E   I+ +E++M +RVH+F N    + E Q + V
Sbjct: 107 KQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTF-NGIEPKNEYQHVIV 165

Query: 172 EEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVIT 231
           +E E+YS LWI++RY     +  +L ++KILRLNKLFAK+RPPKFE PQYSNWV VG+++
Sbjct: 166 DELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVS 225

Query: 232 EKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPW 291
           +KS  K T+SN P+KY KFT+ DF+  +  ++F +E + +YYNLR+GDII +LNP I PW
Sbjct: 226 DKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPW 285

Query: 292 RPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCE 351
           RPS +  YIKSFNL I   Y CI+EIGKSRDL  C + V+S   K CG PINK  D+CCE
Sbjct: 286 RPSGKQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRS-TSKECGVPINKKVDRCCE 344

Query: 352 FHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKT-NNI----------YSKNQF 400
           +HRE E R   +KR++L+G +ALGAPTK ++ P+LY+  T  N+          YS+N  
Sbjct: 345 YHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNP 404

Query: 401 NVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSEL 460
           +++ +   +    SK     F + N AKAFF+DEFQNPD+ISNLD+KRRK+ + ++ + L
Sbjct: 405 HLIDKYGEK----SKF----FSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVL 456

Query: 461 IKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMK- 519
            +EL++ L K+    ++LEGK++E+V++M+  T+  +Q G+ + +G+DPT GK+  ++K 
Sbjct: 457 NRELDRLLRKD----QDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKN 512

Query: 520 --KSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKS 577
             +S   +P + S +   V+DL+ FKK+ + L P K DLL KK KR+++W E FG Q+KS
Sbjct: 513 KERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFG-QNKS 571

Query: 578 NRDIILSSGDDSDLEIV 594
           N +    S  DSDLEIV
Sbjct: 572 NDN----SESDSDLEIV 584

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  485 bits (1248), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 272/610 (44%), Positives = 390/610 (63%), Gaps = 53/610 (8%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           MNDPRE  + DL+ N+S DE E+ E+ +Q++ IERQK+DL ERL+ K++    +DPNF+ 
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNFV- 59

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120
                        QVP SP+K +    +  + P+       ++NPNE+ L  + +     
Sbjct: 60  -------------QVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSN--- 103

Query: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180
            G+T+YFM  F +SKK   +K+  Y ++MS+RVH+F   T  +KE +  +V+E ++YS L
Sbjct: 104 YGTTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSG-TGSKKEFKPTDVDELDQYSNL 162

Query: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240
           W+  RY+  + ++ +L DIKILRL KLFAK+RPPKF  PQYSNWV  G+IT K   K TS
Sbjct: 163 WLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTS 222

Query: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG-- 298
           S+ P KYFKFTI DFQ N+ +F+F  + + KYYNLRVGD++ ILNP I PWRPSE +G  
Sbjct: 223 SSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGS 282

Query: 299 --YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRET 356
              IKSFNL I  K+DCI+EIG SRDLGWC +P  SK    C TPINK+K+  C++HRE 
Sbjct: 283 GSTIKSFNLRISHKFDCILEIGASRDLGWCPIPNASKNTL-CKTPINKSKEDKCQYHREI 341

Query: 357 EFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK--TNNIYSKNQFNVVRRRNARKEGDS 414
           +FR   + R+EL+G++ALGAPTK D  P+LY+ +  +NN   +  +N+V   + +K  DS
Sbjct: 342 QFRKTTSNRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDS 401

Query: 415 -----KLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 469
                ++H  +F + N AKAFF+++FQNPDI++NLDSKRRK+KD+K +  L+K L  T+ 
Sbjct: 402 NKLETRMH--HFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVD 459

Query: 470 KEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDP--- 526
           KE   SKN         K ++N T+  +Q G+L+ +G+DPT GK+  +++ SN +     
Sbjct: 460 KE---SKNF--------KNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTN 508

Query: 527 SYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSG 586
            Y   +  A++DL+ F+KD VNLKP K DL+ ++  R   W + FG Q  S     + + 
Sbjct: 509 KYQMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSS-----IDNN 563

Query: 587 DD--SDLEIV 594
           DD  SDL+I+
Sbjct: 564 DDSGSDLKIL 573

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  479 bits (1233), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 250/597 (41%), Positives = 384/597 (64%), Gaps = 30/597 (5%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           MNDPREV   D +DN+S DE +E  + + +E +ER+++DL  R++ K++  + +DPNF  
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNF-- 58

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120
                      ++QVP SP K    +  +A    T +     +NPNEL+++ +     +P
Sbjct: 59  ----------QQLQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREK--SGQLP 106

Query: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180
           + +T YFM  F  SKK E  KIQ  E +M+ARVH+F +    Q E + I V E E+YS +
Sbjct: 107 SNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQ-EFKPIQVNEIEEYSNI 165

Query: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240
           W+ +RY+ +  + ++L +IKILRL+KLFAK+RPPKF  PQYSNW A+G+I+ K   K T+
Sbjct: 166 WLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTT 225

Query: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300
           ++ P+KY KFT+ DFQ  + +++F +  + +YYNLRVGD+I ILNP + PWRPS +  +I
Sbjct: 226 TDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFI 285

Query: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360
           KSFNL I   + CI+EIG S+DLG+C   V S+ G  C TPIN +K+  C++H+E  FR+
Sbjct: 286 KSFNLRINHDFKCILEIGSSKDLGFCK--VTSRNGTLCNTPINMSKEDRCDYHQEIRFRD 343

Query: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIY----SKNQFNVVRRRNARKEGDSKL 416
             +KRIELNGSFALGAPTK + NP+LY+KK         ++  F+V     +  +    L
Sbjct: 344 NNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDL 403

Query: 417 HNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 476
            N +F + N AKAFF+++FQNPD+++NL+SKRRK++D K+ + + KEL+K +   +  S 
Sbjct: 404 RNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIG--NRASD 461

Query: 477 NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYT-----SN 531
           +L  +S  +VK+M+  TE  +Q G+++ +G+DPTHGK+  +++ ++ K+   T     S 
Sbjct: 462 DLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSG 521

Query: 532 RSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSK--SNRDIILSSG 586
           + + VNDLLHF+K  V L P +++L+ ++ +R+ IW E FG + K  S  D++   G
Sbjct: 522 KKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQKRKPISANDLLAIEG 578

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  472 bits (1214), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/638 (42%), Positives = 394/638 (61%), Gaps = 72/638 (11%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           MNDPRE    D F ++S  E+ E  + +++E ++R+K DL  RL+  ++  +  DPNF  
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNF-- 58

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQD----------------- 103
                       +Q+PG+PE+   K+T +     T + T +Q+                 
Sbjct: 59  ----------DEVQIPGTPEE---KNTNI----FTSEQTILQNRDRKEEEVEEEEFSGER 101

Query: 104 --NPNELKLKNQIEPAS-VPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYT 160
             NPNELK++ + E    +P+ +T+YFM  F   KK E  +    E ++ ARVH F    
Sbjct: 102 LPNPNELKVREREENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMF---Q 158

Query: 161 NLQKESQIINVE-------EKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRP 213
            L K S+I  +E       E E+YS L I +RY+ ++ ++ + Q+IKILRLNKLFAK+RP
Sbjct: 159 GLNKSSKIHKIEYQPEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRP 218

Query: 214 PKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYY 273
           PKFE PQYSNWV +G+IT+K   K TSS+ P+KYFKFTI DF+ N+ IF+F++ A+ +YY
Sbjct: 219 PKFEEPQYSNWVTLGIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYY 278

Query: 274 NLRVGDIICILNPVIAPWRPS-EENGY-IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVK 331
           NLR+GDII ILNP + PWRPS  +NG  IKSFNL I   Y CIIE+GKS+DLG+C +P K
Sbjct: 279 NLRIGDIIAILNPEVLPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNK 338

Query: 332 SKGGKPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK- 390
                 C TPI+ +K+  C +H+E  FRN  +KRIELNGSFALGAP K    P LY+   
Sbjct: 339 INESGTCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNN 398

Query: 391 --TNNIYSKNQFNVVRRRNARKEGDSKLHNSN----FRSTNIAKAFFNDEFQNPDIISNL 444
                +Y  N+FNVV+    RK  +SKL        F S N AKAFF+++FQNPD+++NL
Sbjct: 399 VPVRGVYHGNRFNVVKGSEIRK-NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNL 457

Query: 445 DSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG-KSKEDVKEMRNITENIMQIGMLK 503
           D+KRRK+ D KR + L +EL+K +  E+  S  L G K+K++  +M++ TE  +Q G+++
Sbjct: 458 DTKRRKIADDKRSNYLDQELSKAI--ENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQ 515

Query: 504 NIGYDPTHGKMKYLMK--KSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKR 561
            +G+DPTHGK+  +++  K +GKD  + +++   V DLL FKK KV L P K +L+ +K 
Sbjct: 516 RLGFDPTHGKIAKVLQTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKN 575

Query: 562 KRDEIWNEYFGD-----QSKSNRDIILSSGDDSDLEIV 594
           +R+E+W ++FG      +   N D+  S   +SDLEIV
Sbjct: 576 RREEVWQKHFGSGKRLAEQPLNDDVDTS---ESDLEIV 610

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  467 bits (1201), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 250/631 (39%), Positives = 382/631 (60%), Gaps = 57/631 (9%)

Query: 3   DPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFISTE 62
           DPR+V   D +DNI+ DEDEE ++Q+++E +ER+K+DL++RL+ KR   +  D N     
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNL---- 59

Query: 63  GNVDATSESRIQVPGSPEK-------IKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIE 115
             +D      +QVP SP+K       + RK  +  A  + K+N  +  N  +    N+  
Sbjct: 60  -QLD------VQVPSSPQKRSVSAIDVARKRRE-EAEAIKKRNLSLALNTAQKVNLNEAR 111

Query: 116 PASVPA--------GSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQ 167
            A +           +T+YF+  F  SKK E  +I+  ET++SARVH+F     + KE Q
Sbjct: 112 FAQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTF---QGVDKEFQ 168

Query: 168 IINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAV 227
           +  V E E++S LWIS+RY+ ++ +++ L+D+K+LRLNKLFAK+RPPKF+ PQYSNW  +
Sbjct: 169 LEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVL 228

Query: 228 GVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPV 287
            +I++KS  K T+S  P+K+ +FT+ +FQQ + +FVF    + +YYNLR GDI+ +LNP 
Sbjct: 229 AIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPE 288

Query: 288 IAPWRP---SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINK 344
           I PWRP   S++   IKSFNL I  K+ CI+EIGKSRDLG+C V  K    K CG+ IN 
Sbjct: 289 ILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEK-CGSAINL 347

Query: 345 TKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTN------------ 392
            +D+ CE+HRE + R  ++KR++LNG FALGAPTK  T P L+++ +             
Sbjct: 348 ARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRD 407

Query: 393 ---NIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRR 449
                Y++  +N    +    E +  L    F S+N AKAFF+DEFQNPD++ NLD+KRR
Sbjct: 408 QGKRFYTEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRR 467

Query: 450 KLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDP 509
           KL+D+K+  +L ++L + L+K+++  +    K+  ++  ++  TE  +  G+++ +G+DP
Sbjct: 468 KLQDSKKSRQLDRKLKRLLSKDED--RATLDKNTAEMAALKRTTETALHTGLIQRLGFDP 525

Query: 510 THGKMKYLMKK------SNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKR 563
           THG+   +MKK      S   +    S + N VN+LL +K+DK NL P ++ L  +K+ R
Sbjct: 526 THGRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHR 585

Query: 564 DEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594
            E+W E FG +        + + D  DLEIV
Sbjct: 586 REVWRETFGKKGTPVDSQPVDNDDSDDLEIV 616

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  460 bits (1183), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 257/604 (42%), Positives = 382/604 (63%), Gaps = 46/604 (7%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           M DPREV  NDL+D ++ + +EE E++ QI  IERQK+DL +RL  K+   + +DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNL-- 58

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTG--IQDNPNELKLKNQIEPAS 118
                     S IQV  SP+K+   ++ L  T   ++  G    +N NELK ++Q     
Sbjct: 59  ----------SHIQVESSPKKVT--NSVLPPTVQQQEPRGEVRNENLNELKAQSQ---EQ 103

Query: 119 VPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYS 178
           +PA +T++F+  +++SK+ +  +++  E L+S RVH+F      Q E + I   E E++S
Sbjct: 104 IPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQG-ARRQDEYKPIPTNELEEFS 162

Query: 179 GLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKL 238
            LWIS+RY+ +E    +  +IKILRL+KLFAK++PPKF  P YSNW  +G+I+ K   K 
Sbjct: 163 NLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKF 222

Query: 239 TSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG 298
           TS+ +P+KYFKFT+ +FQ +I  ++F +E + +YYNLRVGDII ILNP + PWRPS    
Sbjct: 223 TSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKA 282

Query: 299 YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEF 358
           +IKSFNL I  K++CI+EIG SRDLGWC +  KSK  + C  PINK K+ CCE+HRE +F
Sbjct: 283 HIKSFNLRISHKFECILEIGASRDLGWCPMFNKSK-NEICRAPINKDKEDCCEYHRELKF 341

Query: 359 RNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKN-QFNVVRRRNARKEGDSK-- 415
           R+  AKR+EL+G++ALGAPT+ D  P+LY+  ++    KN  +N++   N    G +K  
Sbjct: 342 RSTNAKRVELSGTYALGAPTRIDAQPALYRGGSS---QKNLNYNII--TNGADGGSNKEI 396

Query: 416 ----LHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKE 471
               ++  +F + N AKAFF++ FQNP+ + NL++KRRKL+D ++ + L +EL K     
Sbjct: 397 NPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK----- 451

Query: 472 DNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMK-KSNGKDPSYTS 530
            N   +++ KS E++ E++  TE+ M  GM+KN+G+DPT GK+  + K + +  D    +
Sbjct: 452 -NSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLT 510

Query: 531 NRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSD 590
            + ++V  LL FKKD V LKP K  L+ +KR+R+ +W E+FG       D       DSD
Sbjct: 511 EKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSGGDEKDD------SDSD 564

Query: 591 LEIV 594
           LEIV
Sbjct: 565 LEIV 568

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  459 bits (1180), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 255/566 (45%), Positives = 362/566 (63%), Gaps = 36/566 (6%)

Query: 42  ERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGI 101
           +RL+ K++  + +DPNF            + IQ+  SPEK K+ +      P+  K    
Sbjct: 2   KRLKAKKEDQKKLDPNF------------TDIQIQRSPEK-KKSNPNTTVNPIPLKRLVE 48

Query: 102 QDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTN 161
             NPNE K+   +  A++PA +T+YFM NF  +KK E +++++Y+  MS+RVHSF    N
Sbjct: 49  DVNPNEAKV---VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAG-AN 104

Query: 162 LQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQY 221
           L K+ Q I VEE E+YS   IS+RYL +E + + L +IKILRLNKLFAKIRPPKF  P Y
Sbjct: 105 LSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDY 164

Query: 222 SNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDII 281
           +NW   G+I  K   KLTSS TP K+FKFTI +FQ  + IF+F    + KYYNLRVGDII
Sbjct: 165 ANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDII 224

Query: 282 CILNPVIAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTP 341
            ILNP + PWRP  +   IKSFNL I  K+DCI+EI +S+D+ WC   +  K G  C TP
Sbjct: 225 FILNPEVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQ-QINRKTGAKCNTP 283

Query: 342 INKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK-TNNIYSKNQF 400
           INK+K   C++H+E +FR+A AKR+EL+G++ALGAPT+ D+ P+LY+ K T+N+   N F
Sbjct: 284 INKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNF 343

Query: 401 NVV--RRRNARKEGD---SKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAK 455
           N+V  RR   +KE D   SK H  +F S+N AKAFF+++FQNPD++ NL++KRRK+KD K
Sbjct: 344 NIVADRRYMKKKENDPINSKRH--HFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDK 401

Query: 456 RDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMK 515
           RD  L + L +++    N    L+ KS ++++ MRN T+  +Q G ++ +G+DPT G++K
Sbjct: 402 RDVMLQRALRESV---GNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIK 458

Query: 516 YLMKKSNGKDPS--YTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGD 573
            +++KS  K         +SNA+ +L+ FKK  VNLKP +  LL K   R++ + +Y   
Sbjct: 459 VVLEKSADKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKS 518

Query: 574 -QSKSNRDIILSS----GDDSDLEIV 594
             +  NRD   +S     D  DLEI+
Sbjct: 519 IIAAENRDRKSASTKNDTDSDDLEII 544

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  456 bits (1173), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/613 (43%), Positives = 378/613 (61%), Gaps = 56/613 (9%)

Query: 2   NDPREVFENDLFDNISPDEDE-ELELQKQIELIERQKRDLQERL-EYKRKV-SRAVDPNF 58
           NDPREV   D + ++S D+ E E ++Q+++E+IER+K+DL  RL E KRK+ S+ +DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  ISTEGNVDATSESRIQVPGSP--EKIKRKHTQLAATPVTKKNTGIQD---NPNELKLKNQ 113
                N++  S  R++VP SP  E +  +       P    N    +   NPNE   ++ 
Sbjct: 67  ----KNIN--SRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNE---EDI 117

Query: 114 IEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEE 173
           +        +T+YF N F +SK  E + +  Y+ +MSAR H+F   T+L  +++ I  +E
Sbjct: 118 VRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLS-DNKTIQCDE 176

Query: 174 KEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEK 233
            E YS   I +RY+ ++ +D+LL  IKILRLNKLFAK+RPP F  PQYSNWVA+G I+ K
Sbjct: 177 LEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSK 236

Query: 234 SGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRP 293
              KLT++  P KYFKFT+ DF+ N+ ++VF ++ + +YYNLRVGDII +LNP I PWRP
Sbjct: 237 EDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRP 296

Query: 294 SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFH 353
           S     IKSFNL I   ++CI+EIG SRDLGWC + V     K C +PIN   D+CCEFH
Sbjct: 297 SGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQM-VNHGQSKICNSPINTKTDRCCEFH 355

Query: 354 RETEFRNAAAKRIELNGSFALGAPTKADTNPSLYK-----KKTN----NIYSKNQFNVVR 404
           RE + R+ A+KRIEL+GS+ALGAPTK  T PS+YK     + TN     ++S       +
Sbjct: 356 RELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKK 415

Query: 405 RRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKEL 464
            +   K      H SN R+   AKAFF+D FQ+P +++NL+SKRRK+K +K D  L+K L
Sbjct: 416 EQEKEKHEIEAHHFSNKRA---AKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKAL 472

Query: 465 NKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGK 524
           N     ED      + K+K+ VKE   ITE  +Q G+++ +G+DP+ G++  ++ KS G 
Sbjct: 473 N----GEDAS----QSKNKQQVKE---ITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGT 521

Query: 525 ---DPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDI 581
              DP+  S +   +NDL+HFKKDK+ LKP +   L K+ +R+ IW ++F D + S    
Sbjct: 522 KTDDPT-ISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDS---- 576

Query: 582 ILSSGDDSDLEIV 594
                 DSDLEIV
Sbjct: 577 ------DSDLEIV 583

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  452 bits (1164), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 243/585 (41%), Positives = 381/585 (65%), Gaps = 33/585 (5%)

Query: 3   DPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFISTE 62
           DPREV + D+ D ++ DEDE+ ++++Q++ +ERQ+RDL++RLE K    +A         
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKA--------- 56

Query: 63  GNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNT-GIQDNPNELKLKNQIEPASVPA 121
                 S  R++VP SP++ ++      A+P ++K++ GI    N      ++   + P+
Sbjct: 57  ---QRQSLERVEVPASPKEERKS----KASPQSQKSSKGITLAANSNNDSIEVPWKNGPS 109

Query: 122 GSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLW 181
            +T+YF+ NF +++KVE QKIQ   +L+S RVH+F    +L K SQ +NV+EKE YSG  
Sbjct: 110 NTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSL-KGSQPVNVDEKELYSGFN 168

Query: 182 ISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSS 241
           ISRRY+    +D+++++IK+LRL KLF+K+RPPKF  P Y+NWVA+G+I+ KS  KLTSS
Sbjct: 169 ISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSS 228

Query: 242 NTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENG--- 298
           + P KYFK T+ DF  N+ I++FN + + KYYNLRVGDII ILNP I PWRPS+ N    
Sbjct: 229 SKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEF 288

Query: 299 ---YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 355
               +KSFNLSI+  +DC++EIG S+DLG+C +P K+   K CG PIN+     CE+H++
Sbjct: 289 SGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKA-TRKACGAPINRAATDRCEYHQD 347

Query: 356 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSK 415
             FR+  A+R+ELNGS +L +P K     +LY   T+ +  K +  ++  ++A +  D +
Sbjct: 348 VRFRHVNAQRVELNGSTSLRSPVKNGKKQALY--GTSGV--KRKLQLLPDKHAPQAQDGE 403

Query: 416 LHNSNFRST-NIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNV 474
             N+ F S  N AKAFF+D +QNPD+++NL++KRRKLKD++++  L  +LN  + K    
Sbjct: 404 SQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQ 463

Query: 475 SKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSN 534
           S N   KSKE+ K+M++ TE ++  G+L++IG+DP  GKM+ ++K     +    S +S+
Sbjct: 464 SFN--NKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNS-KSS 520

Query: 535 AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNR 579
            V +++ FKK  V+L P K++   +  +R+++W E+F  +  +N+
Sbjct: 521 QVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQ 565

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/606 (40%), Positives = 374/606 (61%), Gaps = 44/606 (7%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           M DPRE  E D+FD +S DED++L   K+++ +ER+K+DL++RL+   +  + +DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDDDL--HKRLDELEREKKDLKQRLQDISQRKKKIDPNF-- 56

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNT----GIQDNPNELKLKNQIEP 116
                     S ++VP SP K   KH  +  T  +K +        +N NEL+++ +   
Sbjct: 57  ----------SGVEVPRSPSK--SKHVAVKETSRSKDDRESCFPAHENLNELQVQKK--- 101

Query: 117 ASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEK 176
           AS+ + ST YF  NF+SSKK +  + +    +++ RVH+F    +  +E   I V E+E+
Sbjct: 102 ASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDG-PDFVREYSPIAVNEEEE 160

Query: 177 YSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGF 236
           +SG WIS+RY+  E   ++L++ K+LRL KLFAK+RPP F  PQYSNWV +G+I+ KS  
Sbjct: 161 FSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSV 220

Query: 237 KLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE- 295
           K+T+   P +YF  T+ DF+  I+I++F  + + KYYNL+VGDII +LNP I PWRPS+ 
Sbjct: 221 KMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKV 280

Query: 296 -----ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCC 350
                    IKSFNL I+  ++ I+EIG SRD G+C++  K + GK CGTPINK+ +  C
Sbjct: 281 EHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQ-GKTCGTPINKSVEDRC 339

Query: 351 EFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARK 410
            +H+E +FR   AKR+ELNG+ +L +PTK      LY K  +  Y     +++  R A +
Sbjct: 340 YYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNKSGKY-----DLLPDRYAPQ 394

Query: 411 EGDSKLHNS-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 469
                  N   F + N A+AFF+D++QNPD ++NLDSKRRKL+  K++  L K+L + + 
Sbjct: 395 TQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIG 454

Query: 470 KED-NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSY 528
           K + N+ KN E  +K+D  E+R  T+N ++ G++K IG+DPT G+M  ++K  N      
Sbjct: 455 KSNSNLFKN-ETSTKQD--EIRRATKNALESGLIKKIGFDPTSGRMSSVLK--NNSKGLK 509

Query: 529 TSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDD 588
              +++AV ++L  KK+K+ LKP K  L  K +KR+E+WN +F  +   N  +  S G D
Sbjct: 510 EQAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDG-D 568

Query: 589 SDLEIV 594
           S+LEIV
Sbjct: 569 SELEIV 574

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  394 bits (1011), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 209/477 (43%), Positives = 305/477 (63%), Gaps = 21/477 (4%)

Query: 128 MNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGLWISRRYL 187
           M NFA+S+K E  +I+    ++ +RVH+F       K  + I VEEKE  SGLW+SRRY+
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGL-KATKSRKPIAVEEKEPASGLWVSRRYI 59

Query: 188 KEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKY 247
             + + ++L+DIKILRL KLF+K+RPPKF  P Y+NWVAVG++  KS  K+TSS+ P KY
Sbjct: 60  ASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKY 119

Query: 248 FKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE------ENGYIK 301
           FK TI DF  ++ ++VFN   + KYYNLRVGDII ILN  I PWRPS+          +K
Sbjct: 120 FKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVK 179

Query: 302 SFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRNA 361
           SFNLSI+  YDC++EIG SRDLG+C +  K+K GK CG PIN+     C++H+E  FR  
Sbjct: 180 SFNLSIRGNYDCVLEIGTSRDLGFCQIYNKAK-GKVCGAPINRAAVDRCDYHQEIRFRQV 238

Query: 362 AAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNS-N 420
            A+R+ELNGS +L +P K     +LY         K + N++  ++A ++ D +  N+  
Sbjct: 239 NAQRVELNGSMSLRSPVKNGKKQALYGSSG----VKRKLNLLPDKHAPQQQDRESQNTLY 294

Query: 421 FRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG 480
           F + N AKAFF+D +QNPD++ NLDSKRRK++D + + +L  +L++ L K+    +    
Sbjct: 295 FSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQ--QRFSE 352

Query: 481 KSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSYTSNRSNAVNDLL 540
           K+K++ K+M+  TE  +  G+LKNIG+DPT GKM+ ++K       S T  +S  V +++
Sbjct: 353 KTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNS-TDTKSIQVREII 411

Query: 541 HFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF---GDQSKSNRDIILSSGDDSDLEIV 594
             +K  V+L P K+D   +  +R+++W E+F    D + +N+  I S   DSDLEIV
Sbjct: 412 ETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQ--IPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 217/629 (34%), Positives = 347/629 (55%), Gaps = 59/629 (9%)

Query: 1   MNDPREVFENDLFDNISPDEDEELE----------------------LQKQIELIERQKR 38
           +NDPRE+     +D +S +ED   E                      ++ +++ IE ++ 
Sbjct: 6   LNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESERS 65

Query: 39  DLQERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKN 98
           DL  RLE  +  S+              A     ++VP SP K K    + A  P T  +
Sbjct: 66  DLLARLEELKHRSKKK------------AKKSPTVEVPRSPTKAKCVEDEPA--PSTSAS 111

Query: 99  TGIQDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGN 158
           T   + P E + +  +  A+ P  +T+YF   FA ++   A  ++  + L+  RV++F +
Sbjct: 112 TTYVEEPEENENERYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSD 169

Query: 159 YTNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFES 218
             +   E     V+E E YS + I++RY+ EE + ++L DIK+LRL KLFAK+RPPKF  
Sbjct: 170 -RDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSE 228

Query: 219 PQYSNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVG 278
           P Y+NWV +G I+ KS  K TS   P KYF   I DF  ++ I VF ++ + KYY LRVG
Sbjct: 229 PDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVG 288

Query: 279 DIICILNPVIAPWRPSEEN------GYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKS 332
           D+I ILNP I PW+ S +          +SF LSI+   +CI+EIG S++LG+C    K+
Sbjct: 289 DVIAILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKT 348

Query: 333 KGGKPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTN 392
           KG  PCG PINK K++ C +H+ET  R+  AKR+ELNG+ +L APT+     + Y   T 
Sbjct: 349 KGA-PCGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGY--MTR 405

Query: 393 NIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLK 452
           N +      +      R  G  +    +F S N  +A+F+ ++ NPD++ NL+SKRRK++
Sbjct: 406 NSHGTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQ 465

Query: 453 DAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHG 512
            +K+D ++ K+L+  L K  N ++  +  S+E +++    T+N+M+ G+L++IG+DPT G
Sbjct: 466 LSKKDQQINKQLSLVLGK--NHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGG 523

Query: 513 KMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFG 572
           +M  ++ + +   P+ T  R  +++++L  KK  ++LKP K     + ++R+E++N  F 
Sbjct: 524 RMAAVLYQGD-HGPADTV-REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFK 581

Query: 573 DQS-----KSNRDIILSSGDDSD--LEIV 594
           +++      S     LSS D SD  LEIV
Sbjct: 582 EEAVATPQGSCETAQLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 207/610 (33%), Positives = 330/610 (54%), Gaps = 53/610 (8%)

Query: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60
           + DPRE+   D ++ +S DE E   ++++I  I+ +KRDL  RL    K     DPNF S
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQD---NPNELKLKNQIEPA 117
                       I VP SP+K       +           I++   N NE  ++ +++  
Sbjct: 65  ------------IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL 112

Query: 118 SVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKY 177
               G+T+YF     S    E + I+  + L++ RV++F    ++  E + I V+EK+  
Sbjct: 113 ----GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG--DMFDEYEPITVDEKDDL 166

Query: 178 SGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFK 237
           SGL I RRY+    + +  ++IK+LRL KLF+K+R PKF  P Y NW+ +G+I++K+  +
Sbjct: 167 SGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPR 226

Query: 238 LTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEEN 297
           +T+S  P K+F  TI DFQ  +++  F +  + KYY LR+GD+I ILNP I P +  E  
Sbjct: 227 MTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAG 286

Query: 298 G--YIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 355
                 +F+L +    + I+E+G S++ G C   +K+K GK CG PINK  D  C +H+E
Sbjct: 287 ASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNK-GKLCGAPINKLHDNYCAYHKE 345

Query: 356 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNN-----IYSKNQFNVVRRRNARK 410
            + R  +++R+E++ S A+ AP       ++ K + NN      Y +N      R  A  
Sbjct: 346 AKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAA 405

Query: 411 EGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKEL----NK 466
           E +  L    F S N + AFF+D+++NPDI++NLD+KRRK+++ + +  L K+L    +K
Sbjct: 406 ETNRFL----FSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDK 461

Query: 467 TLT-KEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKD 525
            L+ KED V  N E K        +  T ++ Q G+   IGYDPT GK    M + + ++
Sbjct: 462 LLSKKEDRV--NQEAK--------KTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTEN 511

Query: 526 PSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYF-GDQSKSNRDIILS 584
            +  +++  A+ D+ + KKD V+LKP K  L  K  KR+ I+NE   G Q + ++D    
Sbjct: 512 KAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKD---- 567

Query: 585 SGDDSDLEIV 594
            G   DLEI+
Sbjct: 568 EGSSDDLEII 577

>NDAI0F00860 Chr6 (210078..211367) [1290 bp, 429 aa] {ON}
          Length = 429

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 102 QDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSF 156
           Q N NELKL + +E ++ P G      NN+  +  V  +   + E +M+++ H F
Sbjct: 73  QQNKNELKLTDSLEGSTTPLGQLTQVSNNYQLNMSVPRRSESNIERMMNSKKHCF 127

>TPHA0C03680 Chr3 (801572..804313) [2742 bp, 913 aa] {ON} Anc_2.346
           YMR164C
          Length = 913

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 9/104 (8%)

Query: 53  AVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKN 112
           ++ P   ST+ ++DAT  + + + GS  + K K+TQ    PV +        P + K K 
Sbjct: 652 SISPKMTSTDNSIDATVNTVVSM-GSSRQPKSKNTQSNKKPVAE--------PKKRKKKT 702

Query: 113 QIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSF 156
           +I  +S P G+T +   N + +      + QD   L   +   F
Sbjct: 703 EISRSSTPIGTTKFISENNSIANVESINRNQDSGALKQVQSSGF 746

>SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {ON}
           some similarities with uniprot|P31376 Saccharomyces
           cerevisiae YAL011W SWC3 Protein of unknown function
           component of the Swr1p complex that incorporates Htz1p
           into chromatin required for formation of nuclear-
           associated array of smooth endoplasmic reticulum known
           as karmellae
          Length = 657

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 63/128 (49%), Gaps = 6/128 (4%)

Query: 367 ELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNI 426
           +L+G   LG P  AD++P L + K    Y+K +  +V +  + +E   +L     +  N 
Sbjct: 413 DLSGVTTLGKPAAADSSPKLDQPKPKRKYTKRKNVLVAKDESTEEKSMQLTTFQQKYMNN 472

Query: 427 AKAFFNDEFQNPDIISNL--DSKRRKLKDAKR--DSELIKELNKTLTKEDNVS-KNLEGK 481
           A   F +  +NP+I  NL  D+   +L+D +    S ++    K + K +N   K LEGK
Sbjct: 473 ADIVF-EYLENPNIRYNLPKDAIFEQLEDEESYLMSWIVIHNKKDIEKYENKKLKELEGK 531

Query: 482 SKEDVKEM 489
           +   V E+
Sbjct: 532 TSRKVTEV 539

>KLTH0D17006g Chr4 complement(1403707..1412385) [8679 bp, 2892 aa]
            {ON} some similarities with uniprot|P32768 Saccharomyces
            cerevisiae YAR050W FLO1 Lectin-like protein involved in
            flocculation
          Length = 2892

 Score = 34.3 bits (77), Expect = 1.2,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 5/77 (6%)

Query: 49   KVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNEL 108
            KVS A D    +T GNV   + + I  PGS        T L +TP +   TG    P  +
Sbjct: 2644 KVSLASDSTETATNGNV--VTSTVIVAPGSKSN---SDTGLVSTPASVSQTGTATGPEHV 2698

Query: 109  KLKNQIEPASVPAGSTA 125
                   PA+ PA   A
Sbjct: 2699 TTGPATGPATGPATGPA 2715

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 68/164 (41%), Gaps = 48/164 (29%)

Query: 187 LKEETIDQLLQ-DIKILRLN-KLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTP 244
           +KEET+ + L  +++ LR N ++F ++RP      + S+ +++   ++++G +  +    
Sbjct: 343 MKEETMRRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDENGTQCITIKRE 402

Query: 245 RKYFKFT-----------------IGDFQQ------NISIFVFNREAIAKYYNLRVGDII 281
            KY KFT                 IG   Q      N+ IF + +    K Y +      
Sbjct: 403 AKYHKFTFDRCFGAQESNKDIFHEIGQLIQSSLDGYNVCIFAYGQTGSGKTYTM------ 456

Query: 282 CILNPVIAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGW 325
             LNP         E+G I S      T     + + K ++LGW
Sbjct: 457 --LNP---------EDGIIPS------TLNHIFLWVEKLKELGW 483

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
           YMR247C
          Length = 1568

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 13  FDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIST 61
           ++N S D++ +L+L+  I      K DLQE  +    ++  +DPNF++T
Sbjct: 417 YNNTSIDDELKLKLENDIIATLHAKIDLQELHDLSIIIAENIDPNFVTT 465

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 68/164 (41%), Gaps = 48/164 (29%)

Query: 187 LKEETIDQLLQ-DIKILRLN-KLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTSSNTP 244
           +KEET+ + L  +++ LR N ++F ++RP      + S+ +++   ++++G +  +    
Sbjct: 343 MKEETMRRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDENGTQCITIKRE 402

Query: 245 RKYFKFT-----------------IGDFQQ------NISIFVFNREAIAKYYNLRVGDII 281
            KY KFT                 IG   Q      N+ IF + +    K Y +      
Sbjct: 403 AKYHKFTFDRCFGAQESNKDIFHEIGQLIQSSLDGYNVCIFAYGQTGSGKTYTM------ 456

Query: 282 CILNPVIAPWRPSEENGYIKSFNLSIQTKYDCIIEIGKSRDLGW 325
             LNP         E+G I S      T     + + K ++LGW
Sbjct: 457 --LNP---------EDGIIPS------TLNHIFLWVEKLKELGW 483

>Kpol_1070.20 s1070 complement(46652..48541) [1890 bp, 629 aa] {ON}
           complement(46652..48541) [1890 nt, 630 aa]
          Length = 629

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 14/95 (14%)

Query: 115 EPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSAR----VHSFGNYTNL------QK 164
           E   VP    A+   N ++  ++E++ +QD+E   + R     H   +Y NL      + 
Sbjct: 250 EEGYVPGEEEAWISQNISTLAQLESKTLQDFEFPNAERDILPFHQVKHYENLLTTDESEL 309

Query: 165 ESQIINV----EEKEKYSGLWISRRYLKEETIDQL 195
           ES+++N     E + ++   +IS  YL +E +  L
Sbjct: 310 ESELVNALKLTEREIEFLAQYISPEYLTKEGLASL 344

>CAGL0M10109g Chr13 (1006975..1008366) [1392 bp, 463 aa] {ON}
           similar to uniprot|P36075 Saccharomyces cerevisiae
           YKL090w
          Length = 463

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 373 ALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIA-KAFF 431
            L +  KAD N S + K  NNI +     ++R  N  +E  SK + +N  S  +A  +  
Sbjct: 116 VLSSTVKADENTSKWGKTHNNIET-----IIRYTNVDRERASKYYTNNLFSAPLAIISII 170

Query: 432 NDEFQNPDIISNLDSKRRK 450
            D ++ P IIS  ++  RK
Sbjct: 171 RDGYEQP-IISKTNTTNRK 188

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,432,313
Number of extensions: 3470871
Number of successful extensions: 15845
Number of sequences better than 10.0: 358
Number of HSP's gapped: 16660
Number of HSP's successfully gapped: 382
Length of query: 594
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 479
Effective length of database: 40,294,809
Effective search space: 19301213511
Effective search space used: 19301213511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)