Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010106.17ON71071035710.0
ZYRO0C07876g6.17ON68173115340.0
TDEL0G045206.17ON67953313760.0
SAKL0E01100g6.17ON71076313531e-177
Kwal_56.224116.17ON68975312961e-169
Kpol_1045.726.17ON69575712921e-168
YEL062W (NPR2)6.17ON61550612721e-167
Skud_5.276.17ON61550012721e-167
Smik_5.256.17ON61552412551e-164
KLTH0C11308g6.17ON69075112431e-161
KNAG0M011406.17ON59451811941e-155
NDAI0D008606.17ON66653311991e-155
KLLA0D01067g6.17ON66054511771e-152
NCAS0H008706.17ON61248011701e-151
Ecym_30216.17ON67452511751e-151
CAGL0L13288g6.17ON64648411501e-148
ACR009W6.17ON68074411421e-146
TPHA0J003106.17ON67552811301e-144
KAFR0L003806.17ON54052210911e-141
Suva_5.56.17ON619862385e-20
KLTH0C11440gna 1ON50895970.005
Suva_14.523.73ON93581800.54
NCAS0A034305.667ON368268706.7
Suva_5.3078.239ON65851717.3
YJR089W (BIR1)7.460ON954118708.5
Kpol_1055.55.370ON135943708.8
Suva_7.5545.55ON49241709.1
YGR256W (GND2)5.55ON49241699.7
Skud_8.2465.55ON48941699.9
Smik_8.2715.55ON489416910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01010
         (710 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...  1380   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   595   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   534   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   525   e-177
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   503   e-169
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   502   e-168
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   494   e-167
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   494   e-167
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   488   e-164
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   483   e-161
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   464   e-155
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   466   e-155
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   457   e-152
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   455   e-151
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   457   e-151
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   447   e-148
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   444   e-146
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   439   e-144
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   424   e-141
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)     96   5e-20
KLTH0C11440g Chr3 complement(940466..941992) [1527 bp, 508 aa] {...    42   0.005
Suva_14.52 Chr14 (89307..92114) [2808 bp, 935 aa] {ON} YNL287W (...    35   0.54 
NCAS0A03430 Chr1 complement(678079..679185) [1107 bp, 368 aa] {O...    32   6.7  
Suva_5.307 Chr5 (504141..506117) [1977 bp, 658 aa] {ON} YER173W ...    32   7.3  
YJR089W Chr10 (587718..590582) [2865 bp, 954 aa] {ON}  BIR1Subun...    32   8.5  
Kpol_1055.5 s1055 complement(7855..11934) [4080 bp, 1359 aa] {ON...    32   8.8  
Suva_7.554 Chr7 (959241..960719) [1479 bp, 492 aa] {ON} YGR256W ...    32   9.1  
YGR256W Chr7 (1004624..1006102) [1479 bp, 492 aa] {ON}  GND26-ph...    31   9.7  
Skud_8.246 Chr8 (439541..441010) [1470 bp, 489 aa] {ON} YHR183W ...    31   9.9  
Smik_8.271 Chr8 (445484..446953) [1470 bp, 489 aa] {ON} YHR183W ...    31   10.0 

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score = 1380 bits (3571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/710 (96%), Positives = 688/710 (96%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LTLKYGDYRLVSYPVTINSSLYAR           PINCETSPYEPIIARLGKMFRVLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180
           QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180

Query: 181 PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDVPV 240
           PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDVPV
Sbjct: 181 PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDVPV 240

Query: 241 AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS 300
           AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS
Sbjct: 241 AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS 300

Query: 301 DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNSG 360
           DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNSG
Sbjct: 301 DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNSG 360

Query: 361 SAIYPNNEILENDDRLRWPMYYKPRNXXXXXXXXXXXGNERTSNYLPTKSCLFDLYRSLS 420
           SAIYPNNEILENDDRLRWPMYYKPRN           GNERTSNYLPTKSCLFDLYRSLS
Sbjct: 361 SAIYPNNEILENDDRLRWPMYYKPRNSQSSLSSGISSGNERTSNYLPTKSCLFDLYRSLS 420

Query: 421 QGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTS 480
           QGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTS
Sbjct: 421 QGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTS 480

Query: 481 QSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINNSGSCGIKPSFDVNKLFI 540
           QSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINNSGSCGIKPSFDVNKLFI
Sbjct: 481 QSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINNSGSCGIKPSFDVNKLFI 540

Query: 541 NGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIADKVLSDIHRKLAKFDDTPRSPI 600
           NGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIADKVLSDIHRKLAKFDDTPRSPI
Sbjct: 541 NGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIADKVLSDIHRKLAKFDDTPRSPI 600

Query: 601 VKRKEDTFRDFSNGSNIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQ 660
           VKRKEDTFRDFSNGSNIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQ
Sbjct: 601 VKRKEDTFRDFSNGSNIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQ 660

Query: 661 QQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710
           QQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC
Sbjct: 661 QQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/731 (45%), Positives = 449/731 (61%), Gaps = 87/731 (11%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M D FEGFVPIHT+FY++FHPT+GT+VRYE+PPGNL+  NINFD IKNYIIPKPQLCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LTLKY  YR+V YPVT+NS  YAR           P +CETS YEP IARLGKMFRVLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180
           QNQ+LS+AEND +YFD   +  ++EQD  ++ +K  S  G ++ +         ++L++Y
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEK--SFKGLTKSQ--------GMALAKY 184

Query: 181 ----PDNES-GSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISY 235
                D ES  S+FSVQDL+MRIFQDLNNYSECLIPIDEGN+VDIKIFP   PP+  IS 
Sbjct: 185 NEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISI 244

Query: 236 EDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQ 295
           EDVP++ V+L  ++DVNWDPTMLKIVP+ID +NSIS+IA LS+SDV  V+EC++HLVYY 
Sbjct: 245 EDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYN 304

Query: 296 LVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDE 355
            VIL+DIFQF+NIYAPTS +R FLTD  LA++CQ++V L  +S+  ++P E+    DLD+
Sbjct: 305 CVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDD 364

Query: 356 Y---SNSGSAIYPNNEILENDDRLRWPMYY-KPRNXXXXXXXXXXXGNERTSN------- 404
                N  S     +   ++D + + P +Y  PRN            +   +N       
Sbjct: 365 MDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTHDLAR 424

Query: 405 YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPI 464
           +LPTK+CLFDLYR+LSQG  + +WYN +Y  I  N ID+RRFITFG+++GL+YRC++ P+
Sbjct: 425 HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPV 484

Query: 465 MKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINNS 524
           MK   IFD+   L T+ + N     G    G  + A  +++ S +D  +           
Sbjct: 485 MKKMSIFDLAHKLHTAGNLNQVTKKG---KGQKNLAESKYVFSTSDMKL----------- 530

Query: 525 GSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIADKVLSD 584
                                 E + +  N S D                  IAD+VL +
Sbjct: 531 ---------------------GEGSKMHQNFSVD------------------IADEVLRN 551

Query: 585 IHRKLAKF------DDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTGNKVSFNLSRDSD 638
           +++KL+        DD P S I + +        +G N+         +KV+F++++D D
Sbjct: 552 VYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKD-D 610

Query: 639 TTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEEL 698
               +L       +  ++     + KN+ + +LLES+  AD +DKIC+KL+KPR EVEEL
Sbjct: 611 PVPYSLSQQKG-KNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEEL 669

Query: 699 LSEIGDYVIIN 709
           L E+GDY IIN
Sbjct: 670 LHELGDYKIIN 680

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/533 (51%), Positives = 363/533 (68%), Gaps = 40/533 (7%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M D FEGF+PIHT+FY++FHPTEGTKVRYEFPPGNL+++NINFD IKNYIIPKPQLCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LTLKY +YR+ SYPVT+NS +YAR           P +C+TSPYEP IARLGKMF+VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFS--FSKRPTDLSLS 178
           QN +LS+AE D +++      +  +QD+    +K +  L  S+   S  + K  TD+  +
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180

Query: 179 EYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDV 238
           +       S FS++DL++R++QDLNNYSECLIPIDEGN+VDIKIFP M PP+ +IS EDV
Sbjct: 181 D-------STFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIEDV 233

Query: 239 PVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVI 298
           PV+ V+L+ V+DVNWDPTMLKIVP+I+ +NSIS+IA LS SD   V+ECI+HL+YY  V+
Sbjct: 234 PVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVL 293

Query: 299 LSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEK-------SINT 351
           L+DIFQF+NIYAPTS LR FLTD  L+T+CQ+YV   ++S   +LP ++       S++ 
Sbjct: 294 LADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDH 353

Query: 352 DLDE----YSNSGS---------AIYP--NNEI--LENDDRLRWPMYYKPRNXXXXXXXX 394
           +L +       SGS           +P  NNE+  L +++ L    Y   ++        
Sbjct: 354 ELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESL----YRTGKHSQSSFSSN 409

Query: 395 XXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRG 454
               +   + YLPTKSCLFDLYRSLSQGT L +WY  HY  I  N+ID+RRFITFG++ G
Sbjct: 410 NTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVING 469

Query: 455 LLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTA---STANIRF 504
           L+YRCY+ PIMKN  IFD+   L     SN    +   KN +    ST++I+F
Sbjct: 470 LIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKF 522

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 100/185 (54%), Gaps = 32/185 (17%)

Query: 550 TVKHNSSRDASEHLFSPPP-------KRQ------ILNSGIADKVLSDIHRKLA---KFD 593
           TVKHN +++ S+++FS          +RQ       LN  IAD+VL ++++KL+     D
Sbjct: 501 TVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTD 560

Query: 594 DTPRS--PIVK-RKEDTFRDFSNGS--NIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMN 648
             P S  PI +  +E +    ++GS  NI    +S+  +KVSF+        Q  + H++
Sbjct: 561 TRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPSKVSFD-------KQQEIGHIS 613

Query: 649 PILDSSKDIIAQQQEKNHIRR----LLLESLREADNMDKICIKLQKPRKEVEELLSEIGD 704
             + SS D +   +E    RR    +LLES+  AD++D IC+KL+  R +VE L+  +G+
Sbjct: 614 KGMSSSNDKVKMDEEAKLERRERDLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGE 673

Query: 705 YVIIN 709
           Y IIN
Sbjct: 674 YKIIN 678

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  525 bits (1353), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 308/763 (40%), Positives = 427/763 (55%), Gaps = 108/763 (14%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M  HF+GFVPIHTVFYS+FHPTEGTKVRY+FPP NL+  +INFDTIKNY+IPKPQLC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LT KYG YRL  YPV +N+S YAR           P NC TSPYEP +ARLGKMFRVLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNQLLSRAENDSVYF----------DNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSK 170
           Q+Q+LS+AEND VYF           +SH +     D     ++ T +      +     
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 171 RPTDLSLSEY----PDNESGSN-FSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPS 225
                ++ +Y     D E G    S++DLI +++QDLNNYSEC IPID GNSVDIK+FP 
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 226 MVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVV 285
           + PP+  +S+EDVP++ V+L+ ++DVNWDPTMLKIVPFI+ +NSI++IA  S+SD D V+
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 286 ECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPL 345
           EC++HL+YY  V+L+DIFQF+NIYA TS + +FLTD  LA++CQTYV    +    +LP 
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT-SSDLELYRLPF 359

Query: 346 EKSIN---TDLDEYSNSGSAIY-------PNNEILENDDRLRWP---------------- 379
           E   N          NS S I+       PN       + L +P                
Sbjct: 360 ESRPNLLSMHSSRKQNSSSTIHTVGVRNSPN-----RTNSLDYPSELSTRRNNFSSSSAS 414

Query: 380 MYYKPRNXXXXXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFN 439
              + R+             + +   LPTKSCLFDLYRSL QG  + +WY  ++ +I  N
Sbjct: 415 SLMRVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDN 474

Query: 440 KIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSN------PYHSNGDDK 493
            ID+RRFITFG+VRGL+YRCYA P+MKN G  ++L +L ++  S        +    +  
Sbjct: 475 HIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFT 534

Query: 494 NGTASTANIRFLNSITDSDIHDLKDDEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKH 553
           N   STA+I+                 ++   S G  P+   N+              KH
Sbjct: 535 NNVFSTADIK-----------------VDLEHSPGGAPAEIFNR--------------KH 563

Query: 554 NSSRDASEHLFSPPPKRQILNSGIADKVLSDIHRKLAKF--DDTPRSPIVKRKEDTFRDF 611
            S+ D +E +     K+  +   + D  L  +H  +++    D+  S     ++ + +  
Sbjct: 564 TSNVDMAEEVLKDAYKKLSIIESMDDN-LYHVHNPMSRLYGHDSGESSTKGSRKGSRKGS 622

Query: 612 SNGSNIVGYGSSNTGNKVSFNLSR-----DSDTTQNNLDHMNPILDSSKDIIAQQQEKNH 666
           S+         S T +KV+F   R     + D  +   + ++ +L          +EK H
Sbjct: 623 SSTM------ESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLL----------KEKRH 666

Query: 667 IRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
              LLL+S++  D  DKIC++L+K R+EVE+LL E+G Y IIN
Sbjct: 667 EEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIIN 709

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  503 bits (1296), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 293/753 (38%), Positives = 417/753 (55%), Gaps = 107/753 (14%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M  HF+GFVP+H + Y+IFHPTEGTKVR++FPPG L+  +I FDTIKNY+IPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LT KYG +RLV YPV + +  YAR           P +C TSPYE  IARLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNQLLSRAENDSVYFD----NSHSLLSSE---QDSIMHQDKNTSILGFSRKRFSFSKRPT 173
           Q+Q+LS+AEN  VYF     +SH   + E    + +    KN          ++F K   
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 174 DLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISI 233
            L     P+       SV+DLI +I++DLNNYSECLIPID GN+VDIK+FP + PPS  +
Sbjct: 181 ILKDLNGPNKR----ISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCL 236

Query: 234 SYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVY 293
           S+EDVP+  V+L+ ++DVNWDPTMLKIVP+I+  NSI+++A LS+SD + VVECIRHL+Y
Sbjct: 237 SFEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLY 296

Query: 294 YQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSI---- 349
           Y  VIL+DIFQF NIYAPTS L  FLT+  LAT+CQ YV L ++++   LP E+      
Sbjct: 297 YNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTT 356

Query: 350 --NTDLDEYSNSGSAIYPNNEILENDDRLRWPMYYKPRNXXXXXXXXXXXGNERTSN--- 404
             N  +   S++        E+   +      +    RN                S+   
Sbjct: 357 YNNIPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASL 416

Query: 405 -----------YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVR 453
                      +  +KSCLFD+YRSLSQG  + +WY  H+  I   +ID+RRFITFG++ 
Sbjct: 417 GNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIH 476

Query: 454 GLLYRCYAIPIMKNAGIFDILSSLT-----TSQSSNPYHSNGDDKNGTASTANIRFLNSI 508
           GLLYRCY+ PIMKN G  +++ +L      +S        N +  N   S A IR     
Sbjct: 477 GLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIG--- 533

Query: 509 TDSDIHDLKDDEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPP 568
            +S    L++   N+               F N D                         
Sbjct: 534 LESSSSKLRERRFNH---------------FSNAD------------------------- 553

Query: 569 KRQILNSGIADKVLSDIHRKLA----KFDDTPRS--PIVKRKEDTFRDFSNGS---NIVG 619
                    A+ +L+D++RKLA    K + + +S  P+++   +   D S  +   ++V 
Sbjct: 554 --------TAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVS 605

Query: 620 YGSSNTGNKVSFNLSR--DSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLRE 677
              S+T N V+F++ R  +S T ++             +++  +++K     LLL+S+R+
Sbjct: 606 TAGSDTRNTVAFDVRRLVNSATAEDR---------KKGEVMRLEEDKRKDELLLLKSVRD 656

Query: 678 ADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710
            +N DKIC +L + R+EVE++L ++G Y +++C
Sbjct: 657 VENFDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  502 bits (1292), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 304/757 (40%), Positives = 426/757 (56%), Gaps = 118/757 (15%)

Query: 5   FEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLLTLK 64
           F+GF PIHT+FYS+FHPTEG KV Y+FPP NL  Y+INFD+I++Y+IPKPQLC+KLLTLK
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEEQNQL 124
           YG+YR++ YP+TIN S+YAR           P  C+TSPYE +I +LGKMFRVLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSRAENDSVYFDNSHSLLSS-EQDSIMHQDKNTSILGFSRKRFSF-----------SKRP 172
           LS+AE D  YFD    L SS +QDS +  +K++S         S            SK+ 
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 173 TDLSLSEYPD-----NESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMV 227
           +     +Y +     +   S+FS+QD IMR++QDLNNYSECLIPID GN+VDIK+FP + 
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 228 PPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVEC 287
           PP  +IS EDVP++ V+L  ++DVNWDPTMLKIVP ID +NSI++IA LS+SD   V+EC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 288 IRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEK 347
           I+H +YY  V++SDIFQF+NIYAPTS LR+FLTD  +AT+CQTYV +P++S   +LPLE 
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 348 SINTDLDE----------------------YSNSGSAIYPNNEILENDDRLRWPMYYKPR 385
                LD                        S+ G++ +  N  L +   L +   ++  
Sbjct: 364 LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDL-YLNRHRSE 422

Query: 386 NXXXXXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRR 445
           +           GN +    LPT+S LFDLYRSLSQG  L +WY E++  I  N IDIR+
Sbjct: 423 SSISSQNTNDLNGNVKQ---LPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRK 479

Query: 446 FITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFL 505
           FI FG++ GLLYRC + P+                                  TAN   +
Sbjct: 480 FIIFGIINGLLYRCQSFPV----------------------------------TANFEEI 505

Query: 506 NSITD-SDIHDLKD---DEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASE 561
           N +    DI + K+   D++    S  I  + D+                         E
Sbjct: 506 NKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIK----------------------VGE 543

Query: 562 HLFSPPPKR-QILNSGIADKVLSDIHRKLAKFDDTPRS--------PIVKRKEDTFRDFS 612
            L S   +R Q L+  IAD VL ++++KL    +   S         + K+   +  + S
Sbjct: 544 DLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLFESS 603

Query: 613 NGSNIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLL 672
           N  + V      T +KVSF  + +   + ++ D     +  ++DI   ++ +    ++LL
Sbjct: 604 NPYSKVP-KRPGTLSKVSFQQNSNMQYSASSGD-----VTENEDINNLEKLRKQNEQILL 657

Query: 673 ESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
           E+L   +N+DKIC+ L+KPR EVEE+L  + D+ +IN
Sbjct: 658 EALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  494 bits (1272), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 259/506 (51%), Positives = 328/506 (64%), Gaps = 48/506 (9%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M+ +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+T KNYIIPKP LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSRAENDSVYFD-----NSHSLLSSEQDSIM------------HQDKNTSILGFSR 163
           QNQLLS++E D V+FD     NS +  S+   S                +K+T  +  SR
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 164 KRFSFSKRPTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIF 223
               +S    DL L +       S FS+QDL+MRIFQDLNNYSECLIPIDEGN+VDIKIF
Sbjct: 181 ----YSDLIKDLGLPQ-------SAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIF 229

Query: 224 PSMVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDF 283
           P + PP+  +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LSNSD   
Sbjct: 230 PLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGL 289

Query: 284 VVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKL 343
           V+ECIRHL+YY+ V LSDIFQF+NIYAP+S +R+FLTD  +A+DCQ+YV  P+ S    L
Sbjct: 290 VIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNL 349

Query: 344 PLEKSINT-DLDEYSNSGSAIYPNNEILENDD-------------------RLRWPMYYK 383
           PL KS+ + D D  S S      ++ I  N D                        +Y  
Sbjct: 350 PLNKSLGSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKD 409

Query: 384 PRNXXXXXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDI 443
            R                 + +LPT+SCLFDLYRSLSQG  L  WY   Y ++  N IDI
Sbjct: 410 WRQSQTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDI 469

Query: 444 RRFITFGLVRGLLYRCYAIPIMKNAG 469
           RRFITFGL + ++YRCY+ P+M NAG
Sbjct: 470 RRFITFGLEKRIIYRCYSFPVMINAG 495

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 670 LLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
           +L ES+R A+  DKIC+ L KP+ EVE  L+E+G++ +IN
Sbjct: 575 ILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  494 bits (1272), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 253/500 (50%), Positives = 328/500 (65%), Gaps = 38/500 (7%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M  +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+TIKNYIIPKP LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFS-KRPTDLSLSE 179
           QNQLLS++E D+V+FD      S+   S       ++    +   +  S K   DL  S 
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 180 YPD-----NESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISIS 234
           Y D         S+FS+QDL+MRIFQDLNNYSECLIPIDEGN+VDIKIFP + PP+  +S
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 235 YEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYY 294
            EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LS SD   V+ECIRHL+YY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 295 QLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINT-DL 353
           + V LSDIFQF+NIYAP+S +R FLTD  +A+DCQ+YV  P+ S    LPL K++++ D 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 354 DEYS-----NSGSAIYPNN-----EILENDDRLR---------------WPMYYKPRNXX 388
           D  S      S S+  P+N         ++ ++                W      R   
Sbjct: 361 DSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDW------RQSQ 414

Query: 389 XXXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFIT 448
                     N+  + +LPT+SCLFDLYRSLSQG  L  WY   ++++  N ID+RRFIT
Sbjct: 415 TSLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFIT 474

Query: 449 FGLVRGLLYRCYAIPIMKNA 468
           FGL R ++YRCY+ P+M N 
Sbjct: 475 FGLERRIIYRCYSFPVMLNV 494

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 29/41 (70%)

Query: 669 RLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
           R+L  S+R A++ D IC+ L K + EVE  L+E+G++ +IN
Sbjct: 574 RILENSIRSAESFDNICVLLSKSKLEVENYLNELGEFKVIN 614

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  488 bits (1255), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 258/524 (49%), Positives = 329/524 (62%), Gaps = 36/524 (6%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M+ +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+TIKNYIIPKP LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPT------D 174
           QNQLLS++E D V+FD     L + ++S +           +    +    PT      D
Sbjct: 121 QNQLLSKSEKDPVFFD-----LKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKD 175

Query: 175 LSLSEYPD-----NESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP 229
           L  S Y D         S FS+QDL+MRIFQDLNNYSECLIPIDEGN+VDIKIFP + PP
Sbjct: 176 LRNSRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235

Query: 230 SISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIR 289
           +  +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LSNSD   V+ECIR
Sbjct: 236 TTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIR 295

Query: 290 HLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSI 349
           HL+YY+ V LSDIFQF+NIYAP+S +R+FLTD  +A DCQ YV  P+ S    LPL K++
Sbjct: 296 HLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNL 355

Query: 350 NT-DLDEYSNSGSAIYPNNEILENDDRLRWP-------------------MYYKPRNXXX 389
            + DLD  S S      ++ I  N                           Y   R    
Sbjct: 356 TSGDLDSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQT 415

Query: 390 XXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITF 449
                    +   + +LPT+SCLFDLYRSLSQG  L  WY   Y +I  N IDIRRFITF
Sbjct: 416 SCSSSNIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITF 475

Query: 450 GLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDK 493
           GL + ++YR Y+ P+M + G  +   +       +P  SN  +K
Sbjct: 476 GLEKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEK 519

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 32/42 (76%)

Query: 668 RRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
            R+L ES+R A+N DKIC+ L KP+ EVE  L+E+G++ IIN
Sbjct: 573 ERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIIN 614

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  483 bits (1243), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 292/751 (38%), Positives = 411/751 (54%), Gaps = 104/751 (13%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M  HF+GFVP+H +FYS+FHPTEGTKVR++FP G L+  +I FDTIKNY+IPKPQLC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LT KYG +RLV YPV + +  YAR           P +C TSPYEP I RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNQLLSRAENDSVYFD----------NSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSK 170
           Q+Q+LS+AEN SVYF           N+ +   +EQ S +   +   I     + ++ +K
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGE---IAQPENQGYASAK 177

Query: 171 RPTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPS 230
               L   E P  +     ++ DLI +I++DLN+YSECLIPID GN+VDIK+FP + PPS
Sbjct: 178 YYEILKDLEGPSKK----IAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPS 233

Query: 231 ISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRH 290
              S EDVP++ V+L+ ++DVNWDPTMLKIVP I+ INSI+++A  S+SDV+ VVECI+H
Sbjct: 234 SCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKH 293

Query: 291 LVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLE---- 346
           L+YY  VIL+DIFQF+NIYA T+ L  FLT+  LA +CQ YV   ++++   LP E    
Sbjct: 294 LIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPS 353

Query: 347 ---------KSINTDLDEYSNSGSAIYPNNEILENDDRLRWPMYYKPR---------NXX 388
                    +S N  LD            N      D L     + P+         N  
Sbjct: 354 RSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTS 413

Query: 389 XXXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFIT 448
                    G +       +KSCLFDLYRSL+QG  + +WY  H+  I   +ID+RRFIT
Sbjct: 414 DASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFIT 473

Query: 449 FGLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSI 508
           FG++ GL+YR Y+ P+++N G  + + +L                    +T + R+    
Sbjct: 474 FGVLHGLIYRSYSYPVLRNIGFAESVEAL-------------------GATNHSRYAKY- 513

Query: 509 TDSDIHDLKDDE-INNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPP 567
                H LK ++ +NN  S       D+     N    + +  +K +S+ DA+E      
Sbjct: 514 ----KHLLKTNQPLNNVLSAA-----DIRIGLENAGFKARSEKLKQHSTADAAE------ 558

Query: 568 PKRQILNSGIADKVLSDIHRKLAKFD---------DTPRSPIVKRKEDTFRDFSNGSNIV 618
                       +VLSD++RKLA  D         + P S +  R  +   D S   +  
Sbjct: 559 ------------EVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRESAN 606

Query: 619 GYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREA 678
             G S+  NKV+F++ +   T+  +    + IL S        +EK +   +LL+S+R  
Sbjct: 607 SMG-SDIKNKVAFDVRKTLATSSADERRRSEILRSI-------EEKRNEELILLKSVRSV 658

Query: 679 DNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
            N DKIC  L K R+ VE +LSE+G Y +++
Sbjct: 659 HNFDKICTLLGKDRERVESMLSELGPYNVLH 689

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  464 bits (1194), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 250/518 (48%), Positives = 327/518 (63%), Gaps = 33/518 (6%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M+  FEGFVPIHT+FY+IFHPTEG+KV Y+FPPGNLQ Y+INFD IKNYIIPKPQLCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LT+KYG+YR+VSYPV + SS YAR           P  C TSPYEP I RLGKMFRVLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180
           Q+Q+LSRAE D   F      L  + +S  +Q   T  L    K FS             
Sbjct: 121 QSQVLSRAERDDSLFKGDK--LPFDNNSAKNQAPLTHALISKTKSFS------------- 165

Query: 181 PDNESGSN---FSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP-SISISYE 236
           PD ++  +    SVQDLIMRI+QDLNNYSECLIPIDEGN++DIKIFP + PP S+ +S E
Sbjct: 166 PDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIE 225

Query: 237 DVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQL 296
           DVP+ +V L  ++D+NWDPTM+ I+PFI+ +NSI  IA LS+SD + V+ECI+HL+YY+ 
Sbjct: 226 DVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKC 285

Query: 297 VILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSI---NTDL 353
           VI++DIFQF+NIYAP+S + +FLTD  +A DCQ YV LPK+S    +PL+ S+     + 
Sbjct: 286 VIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNK 345

Query: 354 DEYSNSGSAIYPNNEILENDDRLRWPMYYKPRNXXXXXXXXXXXGNERTSN------YLP 407
            + SNS S+    +    +        +Y   N           G            Y P
Sbjct: 346 HKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIYYP 405

Query: 408 TKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKN 467
           T+  LFDLYRSLSQG  L  WY  +++ I  N ID+R+FI FG ++ ++YR  + P+++ 
Sbjct: 406 TRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEK 465

Query: 468 AGIFDILSSLTTSQSSNPY-HSNGDDKNGTASTANIRF 504
                I   +  S+ +    HS    KN   ST++I+F
Sbjct: 466 RRNSIIAKQMGKSKMAEKAPHS----KNAFFSTSDIKF 499

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 627 NKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICI 686
           +KVSF   R++   + + D +     + K+ +   +E+   +  LL +L   ++ DKIC+
Sbjct: 514 SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEE---KLQLLGALDNLESFDKICV 570

Query: 687 KLQKPRKEVEELLSEIGDYVIINC 710
           +L + R E+  L+++IG+Y +INC
Sbjct: 571 QLGRSRVEIANLIADIGEYRVINC 594

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  466 bits (1199), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 255/533 (47%), Positives = 340/533 (63%), Gaps = 61/533 (11%)

Query: 2   IDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLL 61
           I+HFEGF+PIHT+FYSIFHPTEGTKVRYEFPP NL   +I+FD IKNYIIPK QLC+KLL
Sbjct: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69

Query: 62  TLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEEQ 121
           T KY +YR+VSYP+TINS  YAR           P +CETSPYEP IARLGKMF+VLEEQ
Sbjct: 70  TFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQ 129

Query: 122 NQLLSRAENDSVYFDNSHS------LLSSEQDSIMHQD----KNTSILGFSRKRFSFSKR 171
           NQ+LS+AEND +YF + ++      ++ +  D+   ++    K  + +  +R++ S S R
Sbjct: 130 NQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNR 189

Query: 172 ----------------------PTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECL 209
                                     ++ +Y +N   S  SVQDLIMRI+QDLNNYSECL
Sbjct: 190 ILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNN--NSRISVQDLIMRIYQDLNNYSECL 247

Query: 210 IPIDEGNSVDIKIFPSMVPPSI-SISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSIN 268
           IPID+GN+VDIKIFP + PP   S+S EDVP+++VDL+ + DVNWDPTMLK++PFI+ IN
Sbjct: 248 IPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGIN 307

Query: 269 SISRIAALSNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDC 328
            IS+I+ LSNS    V+ECI+HL+YY  VI++DIFQF+N Y+ TS +  FLTD N+AT C
Sbjct: 308 DISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLC 367

Query: 329 QTYVCLPKNSNFGKLPLEKSINTDLDEYS-------------NSGSAIYPNN--EILEND 373
           Q YV LP  S   +LP      T +   S             + GS+I  NN       D
Sbjct: 368 QNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRSSFSAD 427

Query: 374 DRLRWPMYYKPRNXXXXXXXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHY 433
           DR       K               N  ++ +LPTK  LF+LYRSL+Q T L +WY  +Y
Sbjct: 428 DR-------KQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNWYKLNY 480

Query: 434 SLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPY 486
           + I  N IDIR+FI FG+++GL+YRC++ PI+    I  ++S+  +++S++P+
Sbjct: 481 TTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV----ITPVVSAPESAKSTSPF 529

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 40/59 (67%), Gaps = 5/59 (8%)

Query: 652 DSSKDIIAQQQEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710
           D SK  +  +Q     R +LL+S+   DNMDKIC+KL +PR ++EE LSE GDY +INC
Sbjct: 613 DKSKSQLTLKQ-----RNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  457 bits (1177), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 248/545 (45%), Positives = 337/545 (61%), Gaps = 44/545 (8%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M   F+GFVPIHTVFY++FHPTEG+KVR++FPP +L+   I+FDTIKNYIIPKPQLC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LT KYG+YR+V YPV +N+  YAR           P +C TSPYEP IARLGKMF+VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSRAENDSVYF-----DNSHSLLSSEQDSIM---HQD-KNTSILGFSRKRFSFSKR 171
           Q+Q+LS++E + VYF     D++ +  S+E  SI    H D K+T   G   K     K 
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDG--EKYLEIIK- 177

Query: 172 PTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSI 231
                  E   N+   +  ++DL+M++F DLNNYSECLIPIDEGNS+DIK+FP   PPS 
Sbjct: 178 -------ELAKNQK--SLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSS 228

Query: 232 SISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHL 291
           +IS EDVP+A+V+LS ++DVNWDPTM+KIVP+I+ INS+++IA  + SDV+ V ECI+HL
Sbjct: 229 NISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHL 288

Query: 292 VYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYV------------------C 333
           +YY  VILSDIFQF+NIYAPTS + +FLT+  +A  CQ +V                   
Sbjct: 289 MYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNI 348

Query: 334 LPKNSNFGKLPLEKSINTDLDEYSNSGSAIYPNNEILENDDRLRWPMYYKPRNXXXXXXX 393
            P            S   D ++ + +GS     +             Y++          
Sbjct: 349 YPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAH---ASENT 405

Query: 394 XXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVR 453
               G  +    LPT+SCLFDLY+SLSQG  + DWY +++ +I  N+ID+R+ I FG+ R
Sbjct: 406 SLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITR 465

Query: 454 GLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDI 513
            L+YR  + PI+KN G +DIL SL + +    Y S G  KN   S A+I+ +++  + + 
Sbjct: 466 RLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGS-GSSKN-IFSAADIKVVDTKEEGNQ 523

Query: 514 HDLKD 518
            D  D
Sbjct: 524 SDKLD 528

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 670 LLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
           +LLESL  A+  DK+C KL+K R EVE LL ++G Y I+N
Sbjct: 620 ILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVN 659

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  455 bits (1170), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 240/480 (50%), Positives = 319/480 (66%), Gaps = 18/480 (3%)

Query: 2   IDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKLL 61
           ++HFEGF+PIHT+FYSIFHPTEGTKV YEFPP NL  ++INFDTIKNYIIPK QLC++LL
Sbjct: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68

Query: 62  TLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEEQ 121
           T KY +YR+VSYP+TIN+  YAR           P  CETSPYEP IARLGKMF++LEEQ
Sbjct: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128

Query: 122 NQLLSRAENDSVYFDNSH-----SLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLS 176
           +Q+LS+AEND +YF + +     +     Q S  H++K  +    +     F    TD  
Sbjct: 129 SQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFE---TDF- 184

Query: 177 LSEYPDNESG-SNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMV-PPSISIS 234
              + + E G + FSVQDLIMRI+QDLNNYSECLIPID+GN ++IK+FP +  PP+  IS
Sbjct: 185 ---FGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLIS 241

Query: 235 YEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYY 294
            EDVP+++++L++V+DVNWDPTML IVP+I+ +N IS+IA L+ +D   V+ECI+HLVYY
Sbjct: 242 LEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYY 301

Query: 295 QLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLD 354
             VI++DIFQF+N+YAPTS +  FLTD  +AT CQ YV LP  S    LP E + N    
Sbjct: 302 NCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENNGNKQPS 361

Query: 355 EYSNSGSAIYPNNEILENDDRLRWPMYYKPRNXXXXXXXXXXXGNERTS-NYLPTKSCLF 413
              +S +    ++     +      M    ++            N      +LPTK+CLF
Sbjct: 362 TPKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLF 421

Query: 414 DLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMK---NAGI 470
           DLYRSLS G  L  WY  + ++I  N +D+R+FI FG++RGL+YRC++ PI +   N GI
Sbjct: 422 DLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGI 481

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%)

Query: 668 RRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIINC 710
           R +LL+S+   +N+DKIC+KL K R++VE  L E+G+Y II C
Sbjct: 570 RSVLLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKIITC 612

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  457 bits (1175), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 236/525 (44%), Positives = 329/525 (62%), Gaps = 25/525 (4%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M +HF+GFVPIH++FYS+FHPTEGTKVR++FPP +L+   I+FDTIKNY+IPKPQLC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LT KYG YRLV YPV IN+S YAR           P +  TSPYEP I RLGKMFRVLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNQLLSRAENDSVYFD-NSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLS--- 176
           Q+Q+LS+ E D +Y+   +  + + +Q+S   + KN       + R    +   +     
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 177 LSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYE 236
           +     NE     S++DLI ++++DLNNYSECLIP+D GN++DIK+FP + PP+   S E
Sbjct: 181 MKHIAMNEK--QLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVE 238

Query: 237 DVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQL 296
           DVP+A ++L   +DVNWDPTM+KIVP+I+ INSI++I+  S+SDV  V+EC++HL+YY  
Sbjct: 239 DVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDC 298

Query: 297 VILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDE- 355
           V+L D+FQF+NIYAPTS+L +FLTD ++A +CQ YV   ++S   +LP E   N +    
Sbjct: 299 VVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRN 358

Query: 356 ---------------YSNSGSAIYPNNEILENDDRLRWPMYYKPRNXXXXXXXXXXXGNE 400
                          Y+N     + +N            +  +P              N 
Sbjct: 359 PTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENN 418

Query: 401 RT--SNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYR 458
           +   +  LPT+SCLFDLYRSLSQG  + DWY  ++ +I  N+ID+RRFITFG+ R L+YR
Sbjct: 419 KGILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYR 478

Query: 459 CYAIPIMKNAGIFDILSSLTTSQSSNPYHS-NGDDKNGTASTANI 502
           CY+ P+ K+ G  D+L     +   N + S   ++ N   STA+I
Sbjct: 479 CYSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADI 523

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (48%), Gaps = 19/146 (13%)

Query: 572 ILNSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTGNKVSF 631
           + N+  AD+VL D ++KL+  +  P +P+ +          N        S+N  N+   
Sbjct: 539 VPNTDAADEVLRDAYKKLSLNERLP-NPLDQITRSKKLSLEND------ASANVDNR--- 588

Query: 632 NLSRDSDTTQNNLDHMNPILDSSKDIIAQQQ--------EKNHIRRLLLESLREADNMDK 683
            LS  +  T   L  M   L S+KD   + Q         K   + LLL+S++  D+ DK
Sbjct: 589 KLSSSTSGTAKVLFDMKDRL-SNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDK 647

Query: 684 ICIKLQKPRKEVEELLSEIGDYVIIN 709
           I IKL+  ++EVEELL   G+Y IIN
Sbjct: 648 IAIKLEINKQEVEELLKATGEYNIIN 673

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  447 bits (1150), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 231/484 (47%), Positives = 326/484 (67%), Gaps = 37/484 (7%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M   FEGFV IH++FYS FHPTEG+KV+++FPP +L+   INFD+IKNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           +T KYG+YR+  YPVT+NSS+YAR           P NCETSPYEP I RLGKMFRVLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILG-------FSRKRFSFSKRPT 173
           QNQ+LS++END++ F+    L S++++  +  D +  ILG        ++++  + +   
Sbjct: 121 QNQILSKSENDTIMFN----LKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNN 176

Query: 174 DLS-LSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSIS 232
            +S + + P     SNF++ DL+MR++QDLN YSECLIPID+GN+VDIK+FP + PP+  
Sbjct: 177 IISNIKKKP-----SNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY 231

Query: 233 ISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLV 292
           IS E VP+++V+L  ++DVNWDP ML I+P+I+ IN+I RI+ LS+++   V+ECIRHLV
Sbjct: 232 ISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLV 291

Query: 293 YYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPL------E 346
           YY+ ++L+DIF+F+N+YAPTS LR FL D N+AT+CQ+YV LP NS    L L       
Sbjct: 292 YYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKH 351

Query: 347 KSINTDLDEYSNS-GSAIYPNNEILENDDRLR---------WPMYYKPRNXXXXXXXXXX 396
            + N D+   +NS  +++Y  N    ND R +            +YK +           
Sbjct: 352 SAFNGDIGSRNNSVSTSLYSFN---GNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGN 408

Query: 397 XGN-ERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGL 455
             N +    +LPT+S LFDLYRSLSQG  L +WY +++ +I  N+ID+RRFITFG++R +
Sbjct: 409 SNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRI 468

Query: 456 LYRC 459
           +YRC
Sbjct: 469 IYRC 472

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 628 KVSFN-LSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICI 686
           KVSF  L  D +  +   +   PI +++   +++ Q     RR++L++L +A+ +DKIC+
Sbjct: 568 KVSFEALPEDRNGFRWGSNIKTPIQETTWKKLSKMQ-----RRIMLKALADAETLDKICV 622

Query: 687 KLQKPRKEVEELLSEIGDYVIINC 710
            L+ PR+ V  +L E+G+  +INC
Sbjct: 623 LLEMPRQNVVNILHELGELKLINC 646

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  444 bits (1142), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 275/744 (36%), Positives = 393/744 (52%), Gaps = 107/744 (14%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M + F+GFVPIH +FY++FHPTEGTKVR++FP  +L+   I FDTIKNY+IPK QLC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           +T K+G YRLV YPV I +  YAR           P +  TSPYEP IARL KM RVLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180
           Q+Q+LS+ E D VY+        + +      D         +K  +     T       
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187

Query: 181 PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDVPV 240
             N    N  ++DLI ++++DLNNYSECLIP+D GN++DIK+FP + PP+  +S+EDVP+
Sbjct: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVPI 247

Query: 241 AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS 300
           A V+L +++DVNWDPTMLKIVPFI+ INSI++I+  S+S V+ V+ECI+HLVYY  V L 
Sbjct: 248 AKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALV 307

Query: 301 DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLE------------KS 348
           D+FQF+NIYAPT+ LRDFL D  L  +CQ YV   ++    +LP E             S
Sbjct: 308 DMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQTAS 367

Query: 349 INTDLD-----------------EYSNSGSAIYPNNEILENDDRLRWPMYYKPRNXXXXX 391
            NT                    E+S   S I    +     ++  +  Y + RN     
Sbjct: 368 TNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYY--YNRSRN----- 420

Query: 392 XXXXXXGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGL 451
                   +RT   LPT+  LFDLYRSL+QG  L +WY  +YS I  N+ID+RR I FG+
Sbjct: 421 ---LESNCKRT---LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGV 474

Query: 452 VRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDK-NGTASTANIRFLNSITD 510
              L+YRCY+ P+ K+ G  ++L       +++ +   G    N   ST++IR       
Sbjct: 475 FHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRV------ 528

Query: 511 SDIHDLKDDEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPPKR 570
                   D   +S S  I P       F+N  D                          
Sbjct: 529 --------DFDGSSRSRNIPP-------FLNSSD-------------------------- 547

Query: 571 QILNSGIADKVLSDIHRKLAKFDDTPRS--PIVKRKE---DTFRDFSNGSNIVGYGSSNT 625
                 +A++VL + ++KL+  D    S  PI K  +   D        S      + NT
Sbjct: 548 ------VAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNT 601

Query: 626 GNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKIC 685
             +++F++ R+   +++N +H       ++DI    ++K     LLL+S++  D+ DKI 
Sbjct: 602 -TRITFDI-RNRHVSKDN-EHRE---QQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIA 655

Query: 686 IKLQKPRKEVEELLSEIGDYVIIN 709
           ++L+  + EVE LL   G+Y I+N
Sbjct: 656 VRLEMNKHEVERLLKGTGEYNIVN 679

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  439 bits (1130), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/528 (47%), Positives = 330/528 (62%), Gaps = 48/528 (9%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M + F+GFVPIH +FYS+FHPTEGTKV YEFPP NL    INFD IKNY+IPKPQLCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LTLKY +YR+V YP+ INSSLYAR           P  CETSPYEP++ RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLS---------SEQDSIMHQDKNTSIL----------GF 161
           Q Q LS+ E D  YFD    L+S         +E D+ +    N+ IL          G 
Sbjct: 121 QCQFLSKCEKDMAYFD--FKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGS 178

Query: 162 SRKRFSFSKRPTDLSLSEYPDNES-----GSNFSVQDLIMRIFQDLNNYSECLIPIDEGN 216
           +  +   + +  +   S+Y   ++         S+ D++MR+FQDLN+YSEC IPID+GN
Sbjct: 179 TNTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGN 238

Query: 217 SVDIKIFPSMVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAAL 276
           ++DIK+FP+++PP  SIS EDVP+  V+L+ ++DVNWDPTMLKIVP+ID +NSI +IA L
Sbjct: 239 AIDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANL 298

Query: 277 SNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPK 336
           SNSD   V+ECIRH VYY  VILSDIFQF+NIYAPTS + DFLTD  LAT+CQ YV  P+
Sbjct: 299 SNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPE 358

Query: 337 NSNFGKLPLEK-----------------SINTDLDEYSNSGSAIYPNNEILENDDRLRWP 379
           +S    LP +K                 + ++ L +  NS ++ + ++E   NDD   +P
Sbjct: 359 DSLLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDT-AYP 417

Query: 380 MYYKPRNXXXXXXXXXXXGN----ERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSL 435
            +                GN     +  NYLPTKS LFDLYRSLSQG  L +WY  +++ 
Sbjct: 418 NHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNS 477

Query: 436 IHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDILSSLTTSQSS 483
           I  N IDIRRFI FG+++ ++YRC++ P+ KN   F  L+ L   Q+ 
Sbjct: 478 IRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNG 525

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 31/145 (21%)

Query: 569 KRQILNSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNGSNIVGYGSSNTGNK 628
           K   L+  +AD+VL+++++KL+  +  P + I                    G     +K
Sbjct: 559 KLHTLDVDVADRVLNNVYKKLST-NGRPTTSI-------------------NGQGQHPSK 598

Query: 629 VSF-NLSRDSD--TTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKIC 685
           V+F N S D+D     NNL      ++++K   +++   N  +  LL++L+ A+N+D IC
Sbjct: 599 VAFKNQSYDNDLPGLMNNLG-----IEATK--FSREININD-KIYLLDALQSAENLDNIC 650

Query: 686 IKLQKPRKEVEELLSEIGDYVIINC 710
             L+  R+EVE LL+E+ +Y IINC
Sbjct: 651 SNLELSREEVETLLNELTEYRIINC 675

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  424 bits (1091), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/522 (42%), Positives = 317/522 (60%), Gaps = 68/522 (13%)

Query: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60
           M   FEGF PIHT+F+SIFHPTEG+KV Y+FPP NLQ YNINFD+IKN++IPKPQLCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTLKYGDYRLVSYPVTINSSLYARXXXXXXXXXXXPINCETSPYEPIIARLGKMFRVLEE 120
           LTL+Y +YRLVSYPV ++SS YAR             +C+T PYEP I RLGKMF+ LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180
           Q+Q+LS+++  S +F +   +                                     ++
Sbjct: 121 QSQILSKSQRTSAFFKDGEDV-------------------------------------DF 143

Query: 181 PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP-SISISYEDVP 239
            D    + FS+QDL+MR++QDLNNYSECLIPIDEGN ++IKIFP + PP S+ IS EDVP
Sbjct: 144 VD----TKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVP 199

Query: 240 VAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVIL 299
           +++V+L  ++D+NWDPTML I+PFID +NSI+ I+ LS+SD + V+ECI+HL+YY  VI+
Sbjct: 200 LSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVII 259

Query: 300 SDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNS 359
           +DIFQF+NIYAP+S + +FL D  +A +CQ+YV LP  S    LPL    + +++    +
Sbjct: 260 TDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMT 319

Query: 360 GSAIYPNNEILENDD-------RLRWPMYYKPRNXXXXXXXXXXXGNERTSNYLPTKSCL 412
             A+  +     +         R+    ++  ++            N R    LP+K  L
Sbjct: 320 QKALSSSRSSFSSYFSHKSAYARVSETAHHH-QSTSTLSSSEGQQDNPRQGQVLPSKCTL 378

Query: 413 FDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFD 472
           FDLYRSL+ G  +  WY +++S I  N ID+R+FI FG++  ++YR +  PIM++     
Sbjct: 379 FDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHKTF-- 436

Query: 473 ILSSLTTSQSSNPYHSNGDDKNGTASTANIRF------LNSI 508
                      +P  S+  +     ST++I+F      LNSI
Sbjct: 437 ----------KSPLLSDRQNDKIVLSTSDIKFDVGDRILNSI 468

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 70/147 (47%), Gaps = 24/147 (16%)

Query: 570 RQILNSGIADKVLSDIHRKLAKFDDTPRSPIVK-RKEDTFR------DFSNGSNIVGYGS 622
           R+ +  G+ +K++  +H+       T +SP++  R+ D          F  G  I+    
Sbjct: 410 RKFIKFGVINKIIYRVHQYPIMEHKTFKSPLLSDRQNDKIVLSTSDIKFDVGDRILN-SI 468

Query: 623 SNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMD 682
            N  +KV+F+  +  ++   N  ++             + EKN    +L  +L   ++ D
Sbjct: 469 YNKLSKVTFDRDKKLESKIGNSRNLG------------ESEKN----ILFNALERHESFD 512

Query: 683 KICIKLQKPRKEVEELLSEIGDYVIIN 709
           +IC KL K + EVE ++SEIG+Y+ IN
Sbjct: 513 RICSKLGKSKNEVESIISEIGEYMTIN 539

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 2/86 (2%)

Query: 401 RTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCY 460
           + + +LPT+SCLFDLYRSLSQG  L  WY   ++ +  N IDIRRFITFGL R ++YRCY
Sbjct: 432 KRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCY 491

Query: 461 AIPIMKNAGIFDI--LSSLTTSQSSN 484
           + P+M + G  D   ++ + T + SN
Sbjct: 492 SFPVMIHVGSRDTKEMTPVATKEPSN 517

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 59/108 (54%), Gaps = 21/108 (19%)

Query: 609 RDFSNGSNIVGYGSSNTGN-------KVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQ 661
           RD+++  ++ G  S+   N       KVSF + R +             L + K+ I + 
Sbjct: 525 RDYNHSLSVTGSKSTTQTNVKSERPSKVSFEMQRANS------------LATGKNKIPKL 572

Query: 662 QEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709
            ++   +++L +S+R A+N DKIC+ L K ++EVE  LSE+G++ +IN
Sbjct: 573 SDEE--KKILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVIN 618

>KLTH0C11440g Chr3 complement(940466..941992) [1527 bp, 508 aa] {ON}
           similar to uniprot|P53296 Saccharomyces cerevisiae
           YGR177C ATF2 Alcohol acetyltransferase may play a role
           in steroid detoxification forms volatile esters during
           fermentation which is important in brewing
          Length = 508

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 20/95 (21%)

Query: 620 YGSSNTGNKV-----SFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNH----IRRL 670
           YGS+  G +      SFN+  D D   + +D+   + +S+        EK H    +  L
Sbjct: 351 YGSNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSA-------MEKKHYLFPLGAL 403

Query: 671 LLESLREADNMDKICIK--LQKPRKEVEELLSEIG 703
           +L+SLRE  NMDK+ +   L KPR+ V  +LS +G
Sbjct: 404 MLDSLREKSNMDKVIMDDLLGKPRQGV--ILSNVG 436

>Suva_14.52 Chr14 (89307..92114) [2808 bp, 935 aa] {ON} YNL287W
           (REAL)
          Length = 935

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 16/81 (19%)

Query: 259 KIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDF 318
           +I PF   +NS SR  +L+  + +FVV  I+HL    +V     FQF         +++ 
Sbjct: 681 QIKPFGQLVNS-SRAISLTEPEAEFVVSGIKHLFKDNVV-----FQF--------NIKNT 726

Query: 319 LTDINLATDCQTYVCLPKNSN 339
           LTDI  A D    VC P+NS+
Sbjct: 727 LTDI--ALDNVAVVCSPENSD 745

>NCAS0A03430 Chr1 complement(678079..679185) [1107 bp, 368 aa] {ON}
           Anc_5.667
          Length = 368

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 95/268 (35%), Gaps = 48/268 (17%)

Query: 453 RGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIR--------- 503
           R  LY   A P      I   L  L++       H + DDK      A            
Sbjct: 37  RYWLYVSLACPWAHRTMITRALKGLSSVIGLTVVHWHLDDKGWRMLPAPAEITDDDKKNF 96

Query: 504 --FLNSI--TDSDIHDLKDDEINNSGSCGIKPSFDVNKLF--------INGDDHS----- 546
             F   I  T+ D+     D  N+S    I  +FD N  F         +  D+S     
Sbjct: 97  HTFHGGIKPTEEDVSHPVGDVKNDSARLWIDSTFDPNNGFERLSELYHKSQPDYSARYTV 156

Query: 547 ------ETTTVKHNSSRDASEHLFSPPPKRQILNSGIADKVLSDIHRKLAKFDDTPRSPI 600
                 ET T+ +N S D            +ILNSG+ D+V  D    L        + I
Sbjct: 157 PVLWDTETKTIVNNESADII----------RILNSGVFDEVAGDEATHLDLVPKELEAQI 206

Query: 601 VKRKEDTFRDFSNGSNIVGYGSSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQ 660
            +     + + +NG    G+  S      +    ++     N+LD +  IL+   D++A 
Sbjct: 207 DEFNSWVYDNINNGVYKAGFSES------AAVYEKEVTNIFNHLDKVEKILEEKYDVLAG 260

Query: 661 QQEKNHIRRLLLESLREADNMDKICIKL 688
           +  K++  ++L E       + +  ++L
Sbjct: 261 KHGKDNKDKILKEYFTIGHQLTEADVRL 288

>Suva_5.307 Chr5 (504141..506117) [1977 bp, 658 aa] {ON} YER173W
           (REAL)
          Length = 658

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%)

Query: 315 LRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNSGSAIYP 365
           + D LT +N  ++C+T   LP+++ +G   + K+      E  N G+  +P
Sbjct: 394 ISDALTIVNCLSECETMNTLPESNEYGLRKVRKTFRNIAKESHNHGTVYFP 444

>YJR089W Chr10 (587718..590582) [2865 bp, 954 aa] {ON}  BIR1Subunit
           of chromosomal passenger complex (CPC;
           Ipl1p-Sli15p-Bir1p-Nbl1p), which regulates chromosome
           segregation; required for chromosome bi-orientation and
           for spindle assembly checkpoint activation upon reduced
           sister kinetochore tension
          Length = 954

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 495 GTASTANIRFLNSITDSDIHDLKDDEINNSGSCGIKPSFDV------NKLFINGD-DHSE 547
           G  S+ NI     I D ++ D+  D++ N GS  +  + ++       +   NG+  H +
Sbjct: 521 GRDSSTNILIRTQIVDQNLGDIDRDKVPNGGSPEVPKTHELIRDNSEKREAQNGEFRHQK 580

Query: 548 TTTVKH-------NSSRDASEHLFSPPPKRQILNSGIADKVLSDIHRKLAKFDDTPRS 598
            +TV+        N S D S ++ + P + Q   +     + +DIH K  K    PRS
Sbjct: 581 DSTVRQSPDILHSNKSGDNSSNITAIPKEEQRRGNSKTSSIPADIHPKPRKNLQEPRS 638

>Kpol_1055.5 s1055 complement(7855..11934) [4080 bp, 1359 aa] {ON}
           complement(7855..11934) [4080 nt, 1360 aa]
          Length = 1359

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 488 SNGDDKNGTASTANIRFLNSITDSDIH-DLKDDEINNSGSCGI 529
           S  D+KN T      + L+S TD D H DL +D+IN +G  GI
Sbjct: 282 SGSDNKNTTDQNDPSKILSSKTDGDSHLDLPNDDINRNGGSGI 324

>Suva_7.554 Chr7 (959241..960719) [1479 bp, 492 aa] {ON} YGR256W
           (REAL)
          Length = 492

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 574 NSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNG 614
           N+G+ D  L +I R + KFDD    P+V++  DT      G
Sbjct: 225 NTGVLDSFLIEITRDILKFDDVDGKPLVEKIMDTAGQKGTG 265

>YGR256W Chr7 (1004624..1006102) [1479 bp, 492 aa] {ON}
           GND26-phosphogluconate dehydrogenase (decarboxylating),
           catalyzes an NADPH regenerating reaction in the pentose
           phosphate pathway; required for growth on
           D-glucono-delta-lactone
          Length = 492

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 574 NSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNG 614
           N+G+ D  L +I R + KFDD    P+V++  DT      G
Sbjct: 225 NTGVLDSFLIEITRDILKFDDVDGKPLVEKIMDTAGQKGTG 265

>Skud_8.246 Chr8 (439541..441010) [1470 bp, 489 aa] {ON} YHR183W
           (REAL)
          Length = 489

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 574 NSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNG 614
           N G+ D  L +I R + KFDD    P+V++  DT      G
Sbjct: 222 NKGVLDSFLVEITRDILKFDDVDGKPLVEKIMDTAGQKGTG 262

>Smik_8.271 Chr8 (445484..446953) [1470 bp, 489 aa] {ON} YHR183W
           (REAL)
          Length = 489

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 574 NSGIADKVLSDIHRKLAKFDDTPRSPIVKRKEDTFRDFSNG 614
           N G+ D  L +I R + KFDD    P+V++  DT      G
Sbjct: 222 NKGVLDSFLVEITRDILKFDDVDGKPLVEKIMDTAGQKGTG 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,377,940
Number of extensions: 4034403
Number of successful extensions: 16555
Number of sequences better than 10.0: 159
Number of HSP's gapped: 17260
Number of HSP's successfully gapped: 190
Length of query: 710
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 593
Effective length of database: 40,065,477
Effective search space: 23758827861
Effective search space used: 23758827861
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)