Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G010006.13ON46546524770.0
KLTH0C11462g6.13ON49246119480.0
KLLA0D00902g6.13ON49246519390.0
Kwal_56.223626.13ON49345919360.0
SAKL0E00946g6.13ON49346119250.0
Ecym_30166.13ON48946119210.0
Kpol_1032.46.13ON46746019120.0
CAGL0A01045g6.13ON48346519130.0
Smik_6.4706.13ON48845919060.0
NCAS0D026206.13ON49346119060.0
Skud_16.166.13ON48845919030.0
ACR013C6.13ON48846119010.0
YPL262W (FUM1)6.13ON48845919000.0
TDEL0G045806.13ON48445918890.0
KNAG0E027506.13ON49846118820.0
Suva_16.436.13ON48845918810.0
KAFR0B065206.13ON49546118680.0
TPHA0J002706.13ON49645918630.0
Kpol_1045.766.13ON48546018550.0
ZYRO0C07964g6.13ON50546318450.0
TBLA0A071306.13ON50046018050.0
NDAI0I024706.13ON47545917700.0
SAKL0D09746g1.354ON4642821232e-06
KLLA0A08404g1.354ON4612331179e-06
Ecym_27491.354ON4702941107e-05
Kwal_27.127821.354ON4652371108e-05
NCAS0A090101.354ON4622371099e-05
TDEL0D022201.354ON4652321081e-04
TPHA0A021901.354ON4632351081e-04
AEL019W1.354ON4692161071e-04
Kpol_1018.1251.354ON4602371072e-04
KAFR0A009501.354ON4642321072e-04
CAGL0I08987g1.354ON4612821062e-04
ZYRO0G00748g1.354ON4622321043e-04
TBLA0F034801.354ON4662371043e-04
KNAG0I015601.354ON4622431044e-04
KLTH0G19338g1.354ON4652861035e-04
Skud_8.701.354ON4632401036e-04
NDAI0G059401.354ON4622401019e-04
KLLA0B13189g4.197ON4821871000.001
NDAI0J019504.197ON482187990.001
KNAG0B058404.197ON482185990.002
Kwal_47.180664.197ON482185990.002
Smik_8.831.354ON463240980.002
NCAS0J012004.197ON482185980.002
Suva_15.2011.354ON463240970.002
TDEL0E017604.197ON482185970.002
SAKL0B04972g4.197ON482185970.002
Ecym_24524.197ON482190960.003
TPHA0B010404.197ON482193930.008
CAGL0B02794g4.197ON482193920.009
ZYRO0B07964g4.197ON482193910.013
TBLA0A083204.197ON482215900.019
KLTH0A03344g4.197ON482185900.020
YHR018C (ARG4)1.354ON463240900.020
Kpol_1042.164.197ON482185890.023
Skud_12.4434.197ON482186880.033
YLR359W (ADE13)4.197ON482190870.042
Smik_12.4464.197ON482190860.051
Suva_10.4594.197ON482190850.069
YDR097C (MSH6)8.235ON1242119830.17
Suva_2.2568.235ON1245119820.19
ABL006C4.197ON482185780.53
KAFR0A062304.197ON482193770.77
Kpol_1050.635.94ON1058163770.82
NDAI0E024208.615ON48899761.0
SAKL0F08712g7.245ON42876741.6
Skud_4.3558.235ON1247143741.9
Suva_4.4946.148ON85092732.6
Smik_4.3388.235ON1248119722.9
ZYRO0E09460g3.564ON100952722.9
KAFR0A023708.235ON1206115704.9
ZYRO0C12606g3.438ON113065697.3
Kpol_1058.398.78ON1216105688.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G01000
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   958   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   754   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   751   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   750   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   746   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   744   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   741   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   741   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   738   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   738   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   737   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   736   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   736   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   732   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   729   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   729   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   724   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   722   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   719   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   715   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   699   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   686   0.0  
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    52   2e-06
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    50   9e-06
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    47   7e-05
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    47   8e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    47   9e-05
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    46   1e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    46   1e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    46   1e-04
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    46   2e-04
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    46   2e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    45   2e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    45   3e-04
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    45   3e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    45   4e-04
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    44   5e-04
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    44   6e-04
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    44   9e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    43   0.001
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    43   0.001
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    43   0.002
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    43   0.002
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    42   0.002
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    42   0.002
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    42   0.002
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    42   0.002
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    42   0.002
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    42   0.003
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    40   0.008
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    40   0.009
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    40   0.013
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    39   0.019
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    39   0.020
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    39   0.020
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    39   0.023
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    39   0.033
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    38   0.042
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    38   0.051
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    37   0.069
YDR097C Chr4 complement(640109..643837) [3729 bp, 1242 aa] {ON} ...    37   0.17 
Suva_2.256 Chr2 complement(439531..443268) [3738 bp, 1245 aa] {O...    36   0.19 
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    35   0.53 
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    34   0.77 
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    34   0.82 
NDAI0E02420 Chr5 (501925..503391) [1467 bp, 488 aa] {ON} Anc_8.6...    34   1.0  
SAKL0F08712g Chr6 (666544..667830) [1287 bp, 428 aa] {ON} some s...    33   1.6  
Skud_4.355 Chr4 complement(617056..620799) [3744 bp, 1247 aa] {O...    33   1.9  
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    33   2.6  
Smik_4.338 Chr4 complement(606613..610359) [3747 bp, 1248 aa] {O...    32   2.9  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...    32   2.9  
KAFR0A02370 Chr1 (489885..493505) [3621 bp, 1206 aa] {ON} Anc_8....    32   4.9  
ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} simil...    31   7.3  
Kpol_1058.39 s1058 complement(110901..114551) [3651 bp, 1216 aa]...    31   8.6  

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/465 (100%), Positives = 465/465 (100%)

Query: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60
           MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV
Sbjct: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60

Query: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120
           NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL
Sbjct: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120

Query: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180
           GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN
Sbjct: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180

Query: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240
           KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK
Sbjct: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240

Query: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300
           KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG
Sbjct: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300

Query: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN
Sbjct: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360

Query: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420
           TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD
Sbjct: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420

Query: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE
Sbjct: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/461 (75%), Positives = 408/461 (88%)

Query: 3   ETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNE 62
           + R+E D FGE+ VPA+KYWGAQTQR+L NF IGG RERMPEP++ A+GILKKS AIVNE
Sbjct: 31  KCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNE 90

Query: 63  SLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGG 122
           SLGTLDPKISK IQ+AADEV  G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIEI+GG
Sbjct: 91  SLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGG 150

Query: 123 QLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKI 182
           ++G+K++HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+   KS EF  I
Sbjct: 151 KMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESI 210

Query: 183 VKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKD 242
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+ SL +LKF+AQGGTAVGTG+NTK  
Sbjct: 211 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVG 270

Query: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSG 302
           F   +A+Q+S ETGI+FKTAPNKFEALA+HDAIVECSGALNTLACSLFKI+ DIR+LGSG
Sbjct: 271 FGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSG 330

Query: 303 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTY 362
           PRCGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +
Sbjct: 331 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 390

Query: 363 KPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAA 422
           KP+MISNLL+S+RLL D+C SFR+HC+ GI AN DKI KLL+ESLMLVTALNPKIGYDAA
Sbjct: 391 KPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAA 450

Query: 423 TAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           + +AK+AHK G+TLKE+AL+ K+LT+ +FD+W+VPE+MV P
Sbjct: 451 SKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/465 (74%), Positives = 412/465 (88%)

Query: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60
           M   R+E D FGE++VP++KYWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+V
Sbjct: 28  MVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVV 87

Query: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120
           NE LGTLDP+I+K I++AADEVA+G L EHFPLVVFQTGSGTQ+NMN NEVISNRAIE++
Sbjct: 88  NERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELI 147

Query: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180
           GG+LGSK +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPELE L+ ALK KS EF 
Sbjct: 148 GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQ 207

Query: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240
            IVKIGRTHLQDATPLTLGQEFSGYVQQVENGI RV+ SL +LKF+AQGGTAVGTG+NTK
Sbjct: 208 HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTK 267

Query: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300
             F   +A+Q+S ETGI+FKTAPNKFEALA+HDA+VE SGALNTLA SLFKI+ DIR+LG
Sbjct: 268 VGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLG 327

Query: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGN++AITFAGASGQFELN
Sbjct: 328 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELN 387

Query: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420
            +KP+MISNLL+SIRLL D+ NSFRIHC+ GI+ANED+I KLL+ESLMLVTALNPKIGYD
Sbjct: 388 VFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYD 447

Query: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           AA+ +AK+AHK G+TLKE+AL+ K+L++E+FD+W++PE M+ P E
Sbjct: 448 AASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/459 (75%), Positives = 410/459 (89%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R+E D FGE++VP +K WGAQTQR+L NF IGG+RERMPEP++ A+GILKKS AIVNESL
Sbjct: 33  RVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVNESL 92

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLDPK+SK IQ+AADEV  G L +HFPLVVFQTGSGTQ+NMN NEVISNRAI+++GG++
Sbjct: 93  GTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVGGEV 152

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK++HPNNH NQ+QS+ND+FP+ MHI+AV EV   LLPEL  LRDA   K+ EF+ IVK
Sbjct: 153 GSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDSIVK 212

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV++SL NLKF+AQGGTAVGTG+NTK  F 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFA 272

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A+Q+S ETGI+FKTAPNKFEALA+HDA+VECSGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MISNLL+SIRLL D+C SFR+HC+ GI+ANEDKI KLL+ESLMLVTALNPKIGYDAA+ 
Sbjct: 393 VMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLKE+AL+  +L++ +FDEW+VPE+MV P
Sbjct: 453 VAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/461 (74%), Positives = 406/461 (88%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           RIE D FGE++VPA+KYWGAQTQR+  NF IGG RERMPE ++ A+G+LKKS AIVNESL
Sbjct: 33  RIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVVRAFGVLKKSAAIVNESL 92

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLDP+ISK IQ+AADEV +G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIEI+GG+ 
Sbjct: 93  GTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEK 152

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+ + KS EF+ IVK
Sbjct: 153 GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVK 212

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL +LKF+AQGGTAVGTG+NTK  F 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFA 272

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A+Q+S ETGI+FKTAPNKFEALA+HDA+VECSGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MISNLL+S+RLL D+  SFR+HC+ GI+ANED+I+KLL+ESLMLVTALNPKIGYDAA+ 
Sbjct: 393 VMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESLMLVTALNPKIGYDAASK 452

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           +AK+AHK G+TLKE+AL+  +L  ++FDEW++PE M+ P E
Sbjct: 453 VAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGPKE 493

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/461 (75%), Positives = 405/461 (87%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           RIE D FGE++VPANKYWGAQTQR+L NF IGG RERMPEP+I A+GILKKS AIVNESL
Sbjct: 29  RIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVNESL 88

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLDPKISK IQ+AADEV +G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE++GG+L
Sbjct: 89  GTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 148

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           G+K +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+ + K+ EF+ IVK
Sbjct: 149 GTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSHIVK 208

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEF GY QQ+ NGITRV+ SL +LKF+AQGGTAVGTG+NTK  F 
Sbjct: 209 IGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFA 268

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A+Q+S ET IEFKTAPNKFEALA+HDA+VECSGALNT+ACSLFKI+ DIR+LGSGPR
Sbjct: 269 EKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGSGPR 328

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM QAC+QVMGNNS ITFAGASGQFELN +KP
Sbjct: 329 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNVFKP 388

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MISNLLNSIRLL D+  SFR+HC+ GI+ANEDKI K+L+ESLMLVTALNPKIGYD+A  
Sbjct: 389 VMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDSACK 448

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           +AK+AHK  +TLKE+AL+  +L+ E+F EW+VPE M+ P++
Sbjct: 449 VAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPTK 489

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/460 (75%), Positives = 406/460 (88%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R+E DGFGE++VPA+KYWGAQTQR+  NF IGG RERMPEP++ A+G+LKKS AIVNE  
Sbjct: 8   RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           G LD  ISK IQ+AADEV +G LNEHFPLVVFQTGSGTQ+NMN NEVISNRAIE+ GG +
Sbjct: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK +HPNNH N +QS+ND+FPT MHI+AV E+   L+P++ +L+DAL +KS EF  IVK
Sbjct: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+++SL NLKF+AQGGTAVGTG+NTK  F 
Sbjct: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A+Q+S ETGIEFKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MISNLL+SIRLL D+C+SF IHC+ GI+ANEDKINKLL+ESLMLVTALNPKIGYD+AT 
Sbjct: 368 VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPS 464
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE M+ PS
Sbjct: 428 VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/465 (73%), Positives = 410/465 (88%)

Query: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60
           M   R+E D FGE++VPA+KYWGAQTQR+  NF IGG RERMPEP++ A+G+LKKS AIV
Sbjct: 19  MMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIV 78

Query: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120
           NE LGTLD +I+  IQ+AADEVAKG LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE++
Sbjct: 79  NEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELI 138

Query: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180
           GG+LGSK +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPE+ +L+DAL  K+ EF 
Sbjct: 139 GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQ 198

Query: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240
            IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++N+L +LK++AQGGTAVGTG+NTK
Sbjct: 199 DIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTK 258

Query: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300
           + FD L+A+QIS ETGI+FKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LG
Sbjct: 259 EGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 318

Query: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+A+TFAGA+GQFELN
Sbjct: 319 SGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELN 378

Query: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420
            +KP+MISNLL+SIRLL D+C+SFR+HC+ GI AN +KIN  L+ SLMLVTALNPKIGYD
Sbjct: 379 VFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYD 438

Query: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           AA+ IAK+A K  +TLKE+AL+ K LT+E+FDEW++PE+MV P++
Sbjct: 439 AASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGPTK 483

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/459 (74%), Positives = 406/459 (88%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R E D FGE+ VPA+KYWGAQTQR+  NF IGG RERMP PL+ A+G+LKKS AIVNESL
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           G LDPKISKAIQEAADEVA G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIEILGG++
Sbjct: 89  GGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNNH NQSQS+ND+FPT MHI+A  ++  +L+PEL  L++AL+ KS EF+ IVK
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVK 208

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQVENGI RV +SL  L F+AQGGTAVGTG+NTK  FD
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
           + +A+QIS ETG++F+TAPNKFEALA+HDAIVECSGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGY EL LPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITFAG+ GQFELN +KP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MI+NLLNSIRL+TD+  SFR+HC+ GI+ANE +I++LL +SLMLVTALNPKIGYDAA+ 
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE+M+ P
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/461 (74%), Positives = 406/461 (88%)

Query: 3   ETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNE 62
           + RIE D FGE++VPA+KYWGAQTQR+  NF IGG RER+P+P+I A+GILKKS AIVNE
Sbjct: 31  QYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNE 90

Query: 63  SLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGG 122
           SLGTLDPK++  I++AADEV +G L +HFPLVVFQTGSGTQTNMNVNEVISNRAIE++GG
Sbjct: 91  SLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGG 150

Query: 123 QLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKI 182
           +LGSK +HPNNH NQSQS+ND+FP+ MHI+AV E+   L+PEL KL+DAL  K+ EF  I
Sbjct: 151 KLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADI 210

Query: 183 VKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKD 242
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+++SL +LKF+AQGGTAVGTG+NTK  
Sbjct: 211 VKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIG 270

Query: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSG 302
           FD L+A+++S ETGIEFKTAPNKFEALA+HDAIV  SGALNT+A SLFKI+QDIR+LGSG
Sbjct: 271 FDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSG 330

Query: 303 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTY 362
           PRCGYGEL LPENEPGSSIMPGKVNPTQNEAM Q C+Q+MGNN  I+ AG+ GQFELN Y
Sbjct: 331 PRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVY 390

Query: 363 KPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAA 422
           KPLMI+NLLNSIRL+TD+C SFRIHCI  ++AN+DKIN+ LN+SLMLVTALNPKIGYDAA
Sbjct: 391 KPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAA 450

Query: 423 TAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           + IAK+AH   +TLKE+AL+ K LTAE+FDEW+VPE+M+ P
Sbjct: 451 SKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/459 (74%), Positives = 405/459 (88%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           RIE D FGE+ VPA+KYWGAQTQR+  NF IGG RERMP PL+ A+G+LKKS A+VNESL
Sbjct: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           G LDPKISKAIQ+AADEV  G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIEILGG++
Sbjct: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNNH NQSQS+ND+FPT MHI+A  ++  +L+PEL  L++AL+ KS EF  IVK
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQVENGI RV +SL  L F+AQGGTAVGTG+NTK  FD
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
           I +A+QIS ETG++F+TAPNKFEALA+HDAIVECSGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGY EL LPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITFAG+ GQFELN +KP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MI+NLLNSIRL+TDS  SFR+HC+ GI+ANE +I++LL +SLMLVTALNPKIGYDAA+ 
Sbjct: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE+M+ P
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/461 (72%), Positives = 404/461 (87%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R+E D FGE+ VPA+KYWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+VNE L
Sbjct: 28  RVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQL 87

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTL+P I+KAIQ+AADEVA+G L EHFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG+L
Sbjct: 88  GTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGEL 147

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPELE LR + + K+ EF  IVK
Sbjct: 148 GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVK 207

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGY QQ+ NGI RV+++  +L+F+AQGGTAVGTG+NT++ F 
Sbjct: 208 IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFA 267

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A Q+S ETG+EF+TAPNKFEALA+HDA+VE SGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 268 EQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPR 327

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+ QAC+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 328 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKP 387

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MI+NLL+S+RLL D+  SFR+HC+ GI+ NED+I KLL+ESLMLVTALNPKIGYDAA+A
Sbjct: 388 VMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASA 447

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           +AK+AHK G+TL+ +AL+  +LT  +FDEW+VPE M+ P +
Sbjct: 448 VAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD 488

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/459 (74%), Positives = 405/459 (88%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R E D FGE+ VPA+KYWGAQTQR+  NF IGG RERMP PL+ A+G+LKKS AIVNESL
Sbjct: 29  RTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           G LDPKISKAIQ+AADEVA G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIEILGG++
Sbjct: 89  GGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNNH NQSQS+ND+FPT MHI+A  ++  +L+PEL  L++AL+ KS EF+ IVK
Sbjct: 149 GSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVK 208

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQVENGI RV +SL  L F+AQGGTAVGTG+NTK  FD
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
           + +A+QIS ETG++F+TAPNKFEALA+HDAIVECSGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGY EL LPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITFAG+ GQFELN +KP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MI+NLLNSIRL+TD+  SFR+HC+ GI+ANE +I++LL +SLMLVTALNPKIGYDAA+ 
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE M+ P
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGP 487

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/459 (72%), Positives = 403/459 (87%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R+E D FGE++V A++YWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+VNESL
Sbjct: 24  RVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESL 83

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLDPK+++ I++AADEVA+G L  HFPLVVFQTGSGTQ+NMN NEVISNRAIE++GG+L
Sbjct: 84  GTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 143

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+L  KS EF+ IVK
Sbjct: 144 GSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVK 203

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQV NGI RV+ SL  LK++AQGGTAVGTG+NTK  F 
Sbjct: 204 IGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFA 263

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A+Q+S ETG++FKTAPNKFEALA+HDA+VE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 264 EKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPR 323

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 324 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKP 383

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MISNLL+S+RLL D+  SFR+HC+ GI AN D+I KL++ESLMLVTALNPKIGYDAA+ 
Sbjct: 384 VMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASK 443

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLK++AL   +LT  +FDEW+VPE+M+ P
Sbjct: 444 VAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/461 (73%), Positives = 403/461 (87%)

Query: 3   ETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNE 62
           E R+E D FGE+ VPA++YWGAQTQR+  NF IGG+RE++PEP++ A+GILKKS A VNE
Sbjct: 36  EFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNE 95

Query: 63  SLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGG 122
           +LGTLD  I+  I+ AADEVA+G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG
Sbjct: 96  NLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 155

Query: 123 QLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKI 182
           +LGSK VHPNNHVNQSQS+ND+FPT MHI+A  E+  KL+PEL+ L+DAL+ K  EF+ I
Sbjct: 156 ELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSI 215

Query: 183 VKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKD 242
           VKIGRTHLQDATPLTLGQEFSGYVQQVENGI RVQ+SL +L F+AQGGTAVGTG+NTK  
Sbjct: 216 VKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVG 275

Query: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSG 302
           FD LVA+++S ETG+ F+TAPNKFEALA+HDAIVE SGALNTLACSLFKI+QDIR+LGSG
Sbjct: 276 FDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSG 335

Query: 303 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTY 362
           PRCGYGEL LP NEPGSSIMPGKVNPTQNEAM Q C+QVMGNNS ITFAG+ GQFELN Y
Sbjct: 336 PRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVY 395

Query: 363 KPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAA 422
           KPLMISNLL+SIRLLTD+  SFRIHC+  ++AN+DKI++ LN+SLMLVTALNPKIGYDAA
Sbjct: 396 KPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAA 455

Query: 423 TAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
             +AK+AH   +TLKE+AL+  +LT ++FDEW++PE+M+ P
Sbjct: 456 AKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/459 (73%), Positives = 402/459 (87%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R E D FGE+ VPA+KYWGAQTQR+  NF IGG RERMP PL+ A+G+LKKS AIVNESL
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           G LDPK+SKAIQ+AADEVA G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIEILGG++
Sbjct: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNN  NQSQS+ND+FPT MHI+A  ++  +L+PEL  L++AL+ KS EF  IVK
Sbjct: 149 GSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQVENGI RV ++L  L F+AQGGTAVGTG+NTK  FD
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
           + +A+QIS ETG++F+TAPNKFEALA+HDAIVECSGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGY EL LPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITF G+ GQFELN +KP
Sbjct: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MI+NLLNSIRL+ D+  SFRIHC+ GI+ANE +I++LL +SLMLVTALNPKIGYDAA+ 
Sbjct: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE+M+ P
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/461 (73%), Positives = 399/461 (86%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R E D FGE+ VP +KYWGAQTQR+L NF IGGERE++P P+I A+GILKKS AIVNE L
Sbjct: 35  RAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERL 94

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLD +++K I  AADEV++G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE++GG+L
Sbjct: 95  GTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKL 154

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSKTVHPNNHVNQSQS+ND+FPT MHI+A+ E+  KLLPEL  L+++L  KS EFN IVK
Sbjct: 155 GSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVK 214

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +L +LKF+AQGGTAVGTG+NTK  FD
Sbjct: 215 IGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFD 274

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
            L+A+QIS ETGI F+TAPNKFEALA+HDAIVE SGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 275 KLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPR 334

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q CIQVMGN+S ITFAG+ GQFELN YKP
Sbjct: 335 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKP 394

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           L+ISNLL+SIRLLTD+  SFR+HCI G++AN + I + LN+SLMLVTALNP IGYD A+ 
Sbjct: 395 LLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASK 454

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465
           IAK+AH   +TLKE+AL+  LLT EQF EW++PE M+ P +
Sbjct: 455 IAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPKQ 495

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/459 (72%), Positives = 394/459 (85%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           RIE DGFGE++VPANKYWGAQT+R+  NF IGG RERMP+P++ A+G+LKKS AIVNE  
Sbjct: 37  RIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEGY 96

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLDP+ISK IQEAADEV +G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG L
Sbjct: 97  GTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 156

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK VHPNNHVNQ+QS+NDSFPT MHI+AV E+   L+PE+  LRDAL+ KS +F  IVK
Sbjct: 157 GSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIVK 216

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+++SL NLKF+AQGGTAVGTG+NT+  F 
Sbjct: 217 IGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGFA 276

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A+QIS ETG+ FKTAPNKFEALA+HDAIVE SGA+ T+A SLFKI+QDIR+LGSGPR
Sbjct: 277 EKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGPR 336

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGK+NPTQNEA+ Q C Q++GNN  I FAG  GQFELN +KP
Sbjct: 337 CGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFKP 396

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           +MISNLL+SIRLL D   SFRIHC+ GI+ANE++I  L+N+SLMLVTALNPKIGYD AT 
Sbjct: 397 VMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEATK 456

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AHK G+TLKE+A++   LT  +FDEW+VPE M+ P
Sbjct: 457 VAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/460 (72%), Positives = 395/460 (85%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R+E DGFGE++VPANKYWGAQT+R+  NF IGG RERMPE ++ A+G+LKK  AIVN  L
Sbjct: 25  RVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTEL 84

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           G LDP  SK IQ+AADEVA G LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE+ GG L
Sbjct: 85  GGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGVL 144

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK +HPNNH N +QS+ND+FPT MHI+AV ++   LLPEL  LRDAL  KS EF  IVK
Sbjct: 145 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIVK 204

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++ +  NL+F+AQGGTAVGTG+NTK  + 
Sbjct: 205 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGWA 264

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
             +A +IS ETG+ FKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LGSGPR
Sbjct: 265 ERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPR 324

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+A+TFAGASGQFELN +KP
Sbjct: 325 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFKP 384

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           ++ISNLL+S++LL D+  SFR+HC+ GI+ANE KI++LL+ SLMLVTALNPKIGYDAAT 
Sbjct: 385 VLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAATK 444

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPS 464
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE M+ PS
Sbjct: 445 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGPS 484

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/463 (71%), Positives = 401/463 (86%)

Query: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60
           + E R+E D FGE++VPA+KYWGAQTQR+  NF IGG+RERMPE ++ A+GILKK+ A V
Sbjct: 41  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100

Query: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120
           NE+ G LDPK++ AI++AADEVA G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE+L
Sbjct: 101 NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160

Query: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180
           GG+LGSK+VHPNNH+N SQS+ND+FPT MHI+AV  +   LLP L  L+D+L+ KS EF 
Sbjct: 161 GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220

Query: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240
            IVKIGRTHLQDATPLTLGQEFSGYVQQV NGI RV+++L +LK +AQGGTAVGTG+NTK
Sbjct: 221 DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280

Query: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300
             +   VA +++ ETGI+F+TAPNKFEALA+HDA+VE SGALNTLA SLFKI+QDIR+LG
Sbjct: 281 IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340

Query: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+ Q C+QV GN+SAITFAGASGQFELN
Sbjct: 341 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400

Query: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420
            +KP+MISNLL+SI LL+D+  SFR+HC+ GI+AN + I KLL+ESLMLVTALNPKIGYD
Sbjct: 401 VFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460

Query: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           AA+ +AK+AHKNG+TLKE+AL+  +LTAE+FD W+VPE M+ P
Sbjct: 461 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/460 (70%), Positives = 391/460 (85%)

Query: 4   TRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNES 63
           TR E D FGE++VPANKYWGAQTQR+  NF IGGERERMPEP+I A+G  KK+ AIVN S
Sbjct: 40  TRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNS 99

Query: 64  LGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQ 123
           LGTLD  +  AI +AA+EV++G LNEHFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG 
Sbjct: 100 LGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 159

Query: 124 LGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIV 183
           LGSK VHPNNHVNQSQS+ND+FPT MHI+A+ E+   LLP L  LR+ L  K+ EF KI+
Sbjct: 160 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKII 219

Query: 184 KIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDF 243
           KIGRTHLQDATPLTLGQEFSGY QQ+ N I R++ +L  L++IAQGGTAVGTG+NTK  F
Sbjct: 220 KIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGF 279

Query: 244 DILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGP 303
               A+Q+S +T + F T+PNKFE+LA+HDAIV    +LNTLACSLFKISQDIR+L SGP
Sbjct: 280 AEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGP 339

Query: 304 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYK 363
           RCGYGELS+PENEPGSSIMPGKVNPTQNEAMCQAC+QVMGNNS I+FAGASGQFELNTYK
Sbjct: 340 RCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYK 399

Query: 364 PLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAAT 423
           PLMI+NLL+S RLL+D+  SF +HC  GI+AN+DKI++LL+ESLMLVT+LNPKIGYDAA+
Sbjct: 400 PLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAAS 459

Query: 424 AIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
            +AK+AH  G+TLK++AL+  +L+++QFDEW+ PE+M+ P
Sbjct: 460 KVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/459 (69%), Positives = 397/459 (86%)

Query: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64
           R+E D FGE++VP+NKYWGAQTQR+  NF IGGERE++P P+I A+GILKKS AIVN+SL
Sbjct: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74

Query: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124
           GTLDP I+  I +A+DEV +G LN+HFPLVVFQTGSGTQTNMN NEVISNRA E++G +L
Sbjct: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134

Query: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184
           GSK +HPNNHVNQSQS+ND+FP+ MHI+AV E+   L+P+L +L+++L +K+ E+  IVK
Sbjct: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194

Query: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+Q SL +LKF+AQGGTAVGTG+NTK  FD
Sbjct: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254

Query: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304
            ++A+++S ETGI+F+TAPNKFEALA+HDAIV  S A+ T+A SLFKI+QDIR+LGSGPR
Sbjct: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314

Query: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364
           CGYGEL LPENEPGSSIMPGKVNPTQNEAM Q  +Q+MGNN  I  AG+ GQFELN YKP
Sbjct: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374

Query: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424
           LMI+NLLNSIRL++D+C+SF+IHC+ G++AN DKIN+ L++SLMLVTALNPKIGYDAA+ 
Sbjct: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434

Query: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463
           +AK+AH   +TLKE+AL+  LLT E+FD+W++PE+M+ P
Sbjct: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 109/282 (38%), Gaps = 34/282 (12%)

Query: 70  KISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKTV 129
           K+   +++   E A G    H             ++ +++     R  EI+G ++  K  
Sbjct: 63  KVHHGLEQIEKEWAAGEFARH------------PSDEDIHTANERRLGEIIGREISGK-- 108

Query: 130 HPNNHVNQSQSTNDSFPTAMHISAVREVVFK-LLPELEKLRDALKDKSIEFNKIVKIGRT 188
                V+  +S ND   T M I   R+++ + LLP L+     L  ++ E   ++  G T
Sbjct: 109 -----VHTGRSRNDQVATDMRIYC-RDILNEVLLPALQAFIKVLTTRAKEEIDVLMPGYT 162

Query: 189 HLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTAVGTGINTKKDFDILV 247
           HLQ A P+      S Y         R++  +  L     G G   G      ++F    
Sbjct: 163 HLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALAGHPYGIDREF---- 218

Query: 248 AKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCG 306
                L  G+ F+    N   A++  D +VE           + + S+D+  + S    G
Sbjct: 219 -----LARGLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-IIYSTAEFG 272

Query: 307 YGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
           + +LS      GSS+MP K NP   E +     +V G  S  
Sbjct: 273 FIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFGELSGF 313

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 89/233 (38%), Gaps = 20/233 (8%)

Query: 114 NRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALK 173
            R  EI+G  +  K       V+  +S ND   T M I     +   +LP L  L   + 
Sbjct: 93  RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVIL 145

Query: 174 DKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTA 232
            ++ E   ++  G THLQ A P+      S Y         R+Q  +  L     G G  
Sbjct: 146 QRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGAL 205

Query: 233 VGTGINTKKDFDILVAKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNTLACSLFK 291
            G      ++F         L  G+ F     N   A+A  D +VE     +     + +
Sbjct: 206 AGHPYGIDREF---------LAAGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISR 256

Query: 292 ISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
            ++D+  + S    G+ +LS      GSS+MP K NP   E +     +V G 
Sbjct: 257 FAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQ 307

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 116/294 (39%), Gaps = 42/294 (14%)

Query: 64  LGTLDPK----ISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEI 119
           +G LD +    I K + E   E + G   EH              + +++     R  E+
Sbjct: 52  IGLLDVEELSLIHKGLLEIESEWSSGKFEEH------------PDDEDIHTANERRLGEL 99

Query: 120 LGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVV-FKLLPELEKLRDALKDKSIE 178
           +G  +  K       V+  +S ND   T M I   RE++  K+LP +      L +++ E
Sbjct: 100 IGTAVAGK-------VHTGRSRNDQVATDMRIYC-REILNEKILPAVSSFIRVLINRARE 151

Query: 179 FNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVG---T 235
              ++  G THLQ A P+      S Y         R++  +  L     G  A+     
Sbjct: 152 EVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPY 211

Query: 236 GINTKKDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQD 295
           GI+ K      +A+Q+    GI      N   A++  D ++E     +     + + ++D
Sbjct: 212 GIDRK-----YLAEQLGF-NGI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAED 261

Query: 296 IRFLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
           +    +     +G ++L +    GSS+MP K NP   E +     +V G  S  
Sbjct: 262 LIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGF 312

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 94/237 (39%), Gaps = 29/237 (12%)

Query: 114 NRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALK 173
            R  EI+G  +  K       V+  +S ND   T M I   RE +  L   LE L  A+ 
Sbjct: 96  RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-REALDNLAKILEDLIGAIL 147

Query: 174 DKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTA 232
            +S +    +  G THLQ A P+      + Y         R++     L     G G  
Sbjct: 148 QRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGAL 207

Query: 233 VGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLF-- 290
            G      ++F   +A+++     I      N  +A++  D +VE         CSLF  
Sbjct: 208 AGHPYGIDREF---LAERLGFSDVI-----GNSLQAVSDRDFVVEI-----MFWCSLFMN 254

Query: 291 ---KISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
              + S+D+  + S     + +LS      GSS+MP K NP   E +     +V G+
Sbjct: 255 HISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 89/237 (37%), Gaps = 20/237 (8%)

Query: 114 NRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALK 173
            R  EI+G  +  K       V+  +S ND   T + I     +  KL P L  L   L 
Sbjct: 94  RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLI 146

Query: 174 DKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTA 232
            +  E   I+  G THLQ A P+      S Y       + R++  L        G G  
Sbjct: 147 KRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSPLGAGAL 206

Query: 233 VGTGINTKKDFDILVAKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNTLACSLFK 291
            G      ++F         L  G+EF     N   A++  D +VE           + +
Sbjct: 207 AGHPYGIDREF---------LAEGLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISR 257

Query: 292 ISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
            ++D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ S  
Sbjct: 258 FAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLSGF 312

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 90/232 (38%), Gaps = 20/232 (8%)

Query: 115 RAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKD 174
           R  EI+G  +  K       V+  +S ND   T + I     +  KL P+L+ L D +  
Sbjct: 95  RLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIK 147

Query: 175 KSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTAV 233
           +  E   ++  G THLQ A P+      S Y         R++  +  +     G G   
Sbjct: 148 RGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALA 207

Query: 234 GTGINTKKDFDILVAKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNTLACSLFKI 292
           G      ++F         L  G+ F     N   A++  D IVE           + + 
Sbjct: 208 GHPYGIDREF---------LAAGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRF 258

Query: 293 SQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
           ++D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 259 AEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 96/235 (40%), Gaps = 18/235 (7%)

Query: 115 RAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKD 174
           R  EI+G ++  K       V+  +S ND   T + I     +  KLL  LE L + L +
Sbjct: 95  RLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLIN 147

Query: 175 KSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTAV 233
           ++ E  + +  G THLQ A P+      S Y         R+      L     G G   
Sbjct: 148 RAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSPLGAGALA 207

Query: 234 GTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKIS 293
           G      +++   +A+++  ++ I      N   A++  D +VE           + + +
Sbjct: 208 GHPYGIDREY---LAEKLGFDSVI-----GNSLVAVSDRDFVVEILFWSTLFMNHISRFA 259

Query: 294 QDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
           +D+  + S    G+ +LS      GSS+MP K N    E +     +V GN S +
Sbjct: 260 EDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGNLSGL 312

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 87/216 (40%), Gaps = 11/216 (5%)

Query: 130 HPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTH 189
           H +  V+  +S ND   T M +     +  K+ P L +L   L  ++ E   ++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 190 LQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTAVGTGINTKKDFDILVA 248
           LQ A P+      S Y         R++  +  L     G G   G      +++     
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGALAGHPYGIDREY----- 217

Query: 249 KQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYG 308
             ++ E G +     N   A++  D +VE     +     + ++++D+  + S    G+ 
Sbjct: 218 --LACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDL-IIYSTAEFGFV 273

Query: 309 ELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
           +L+      GSS+MP K NP   E +     +V G 
Sbjct: 274 KLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 89/237 (37%), Gaps = 20/237 (8%)

Query: 114 NRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALK 173
            R  E++G  +  K       V+  +S ND   T + I     +  KLLP L+ L   L 
Sbjct: 92  RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKSLIQVLV 144

Query: 174 DKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTA 232
            +      I+  G THLQ A P+      S Y         R++  L  L     G G  
Sbjct: 145 KRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSPLGAGAL 204

Query: 233 VGTGINTKKDFDILVAKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNTLACSLFK 291
            G      ++F         L  G+ F     N   A++  D +VE           + +
Sbjct: 205 AGHPYGIDREF---------LANGLGFNGVIGNSLVAVSDRDFVVELLFWGTLFMNHISR 255

Query: 292 ISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
            ++D+  + S    G+  LS      GSS+MP K N    E +     +V GN S +
Sbjct: 256 FAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLSGL 310

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 91/232 (39%), Gaps = 18/232 (7%)

Query: 114 NRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALK 173
            R  EI+G  +  K       V+  +S ND   T M I     +   LL  L++L   + 
Sbjct: 95  RRLGEIIGTGIAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKELISVIC 147

Query: 174 DKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTA 232
            ++ E   I+  G THLQ A P+      S Y         R+Q  L  L     G G  
Sbjct: 148 RRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSPLGAGAL 207

Query: 233 VGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKI 292
            G      ++F   +A+ +     I      N   A++  D +VE     +     + + 
Sbjct: 208 AGHPYGIDREF---LAQDLGFSGVI-----GNSLVAVSDRDFVVEIMFWGSLFMNHISRF 259

Query: 293 SQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
           S+D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 260 SEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 309

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 109/282 (38%), Gaps = 34/282 (12%)

Query: 70  KISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKTV 129
           KI   +++  +E  +G    H            +++ +++     R  E++G  +  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 130 HPNNHVNQSQSTNDSFPTAMHISAVREVV-FKLLPELEKLRDALKDKSIEFNKIVKIGRT 188
                V+  +S ND   T M I   RE++  K+ P ++ L + L +++ +   I+  G T
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYC-REILNEKIFPAMKSLINVLVNRAEKEIDILMPGYT 162

Query: 189 HLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTAVGTGINTKKDFDILV 247
           HLQ A P+      S Y       + R++     L     G G   G      + F    
Sbjct: 163 HLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALAGHPYGIDRQF---- 218

Query: 248 AKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCG 306
                L  G+ F     N   A++  D +VE           + + S+D+  + S    G
Sbjct: 219 -----LAEGLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFG 272

Query: 307 YGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
           + +LS      GSS+MP K N    E +     +V G  S  
Sbjct: 273 FIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGELSGF 313

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 93/232 (40%), Gaps = 18/232 (7%)

Query: 114 NRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALK 173
            R  EI+G  +  K       V+  +S ND   T M I     V  KLLP L++L   + 
Sbjct: 94  RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMV 146

Query: 174 DKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQG-GTA 232
            ++ +    +  G THLQ A P+      S Y       + R++  L        G G  
Sbjct: 147 KRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSPLGAGAL 206

Query: 233 VGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKI 292
            G      ++F   +A+++  +  I      N   A++  D +VE           + + 
Sbjct: 207 AGHPYGIDREF---LAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGTLFMNHISRF 258

Query: 293 SQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
           ++D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 259 AEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 90/237 (37%), Gaps = 22/237 (9%)

Query: 115 RAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKD 174
           R  EI+G  +  K       V+  +S ND   T + I     +V KLLP +  L   +  
Sbjct: 95  RLGEIIGTHIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITK 147

Query: 175 KSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVG 234
           ++     I+  G THLQ A P+      S Y         R++  L  L     G  A+ 
Sbjct: 148 RAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA 207

Query: 235 ---TGINTKKDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFK 291
               GI+          + +S E G       N   A++  D IV+           + +
Sbjct: 208 GHPYGID---------RQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISR 257

Query: 292 ISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAI 348
            S+D+  + S    G+ +LS      GSS+MP K N    E +     +V G  S  
Sbjct: 258 FSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGQLSGF 312

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 92/243 (37%), Gaps = 20/243 (8%)

Query: 104 TNMNVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLP 163
           ++ +++     R  EI+G  +  K       V+  +S ND   T M I     +  KLLP
Sbjct: 84  SDEDIHTANERRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLP 136

Query: 164 ELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNL 223
            +  L   L  ++      +  G THLQ A P+      S Y         R++  L  L
Sbjct: 137 FMADLIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERL 196

Query: 224 KFIAQG-GTAVGTGINTKKDFDILVAKQISLETGIEF-KTAPNKFEALASHDAIVECSGA 281
                G G   G      ++F         L  G+ F     N   A++  D +VE    
Sbjct: 197 NVSPLGAGALAGHPYGIDREF---------LAEGLNFGGVIGNSLVAVSDRDFVVELMFW 247

Query: 282 LNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQV 341
                  + + ++D+  + S    G+ +LS      GSS+MP K N    E +     +V
Sbjct: 248 GTLFMNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRV 305

Query: 342 MGN 344
            G+
Sbjct: 306 FGD 308

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 112/286 (39%), Gaps = 38/286 (13%)

Query: 76  QEAADEVAKG--SLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQLGSKTVHPNN 133
           QE  DE+ +G   +   +    F    G +     NE    R  EI+G  +  K      
Sbjct: 59  QEELDEIHRGLEIIRGEWASNSFVEKDGDEDIHTANE---RRLGEIIGRHIAGK------ 109

Query: 134 HVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDA 193
            V+  +S ND   T M I   RE +  +   L+ L  A+  ++ +    +  G THLQ A
Sbjct: 110 -VHTGRSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRA 167

Query: 194 TPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVG---TGINTKKDFDILVAKQ 250
            P+      + Y         R++     L     G  A+     GI+ +      +A++
Sbjct: 168 QPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDREH-----IAER 222

Query: 251 ISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLF-----KISQDIRFLGSGPRC 305
           +  +  I      N  +A++  D +VE         CSLF     + S+D+  + S    
Sbjct: 223 LGFDGVI-----GNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEF 271

Query: 306 GYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFA 351
            + +LS      GSS+MP K NP   E +     +V G+ S    +
Sbjct: 272 NFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGSLSGFMMS 316

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 90/240 (37%), Gaps = 20/240 (8%)

Query: 107 NVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELE 166
           +++     R  EI+G  +  K       V+  +S ND   T + I     V   L P L+
Sbjct: 87  DIHTANERRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALK 139

Query: 167 KLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFI 226
            L D L  ++     I+  G THLQ A P+      S Y         R+   L  L   
Sbjct: 140 GLVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQS 199

Query: 227 AQG-GTAVGTGINTKKDFDILVAKQISLETGIEFKTA-PNKFEALASHDAIVECSGALNT 284
             G G   G      ++F         L  G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALAGHPYGIDREF---------LAEGLGFNSVIGNSMVAVSDRDFIVELMFWGTL 250

Query: 285 LACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
               + + ++D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 92/240 (38%), Gaps = 20/240 (8%)

Query: 107 NVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELE 166
           +++     R  EI+G  +  K       V+  +S ND   T + I     +  KL P + 
Sbjct: 87  DIHTANERRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 167 KLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFI 226
            L + L  ++ E   I+  G THLQ A P+      S Y       + R++  L      
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 227 AQG-GTAVGTGINTKKDFDILVAKQISLETGIEFK-TAPNKFEALASHDAIVECSGALNT 284
             G G   G      ++F         L  G+ F     N   A++  D +VE       
Sbjct: 200 PLGAGALAGHPYGIDREF---------LAEGLGFDGVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 285 LACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
               + + ++D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 10/187 (5%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    L+P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLP--ENEPGSSIMPGKVNP 328
           S    ++    L++ A +  K++ DIR L +       EL  P  +++ GSS M  K NP
Sbjct: 241 SRKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNP 295

Query: 329 TQNEAMC 335
            + E +C
Sbjct: 296 MRCERVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 10/187 (5%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    ++P+L  + D L   ++E+  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDLVIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLP--ENEPGSSIMPGKVNP 328
           S    ++    L++ A +  K++ DIR L +       EL  P  +++ GSS M  K NP
Sbjct: 241 SRKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNP 295

Query: 329 TQNEAMC 335
            + E +C
Sbjct: 296 MRCERVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 77/185 (41%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    ++P+L  + D L   ++++  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDLVIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L++ A S  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 77/185 (41%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    L+P+L  + D L   ++E+  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDILIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 90/240 (37%), Gaps = 20/240 (8%)

Query: 107 NVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELE 166
           +++     R  E++G  +  K       V+  +S ND   T + I     V   L P L+
Sbjct: 87  DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALK 139

Query: 167 KLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFI 226
            L D L  ++     I+  G THLQ A P+      S Y         R+   L  L   
Sbjct: 140 GLVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 227 AQG-GTAVGTGINTKKDFDILVAKQISLETGIEFKTA-PNKFEALASHDAIVECSGALNT 284
             G G   G      ++F         L  G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALAGHPYGIDREF---------LAEGLGFNSVIGNSLVAVSDRDFIVELMFWGTL 250

Query: 285 LACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
               + + ++D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 76/185 (41%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    ++P+L  + D L   ++E+  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDIIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L + A +  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 90/240 (37%), Gaps = 20/240 (8%)

Query: 107 NVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELE 166
           +++     R  E++G  +  K       V+  +S ND   T + I     V   L P ++
Sbjct: 87  DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 167 KLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFI 226
            L D L  ++     I+  G THLQ A P+      S Y         R+   L  L   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQS 199

Query: 227 AQG-GTAVGTGINTKKDFDILVAKQISLETGIEFKTA-PNKFEALASHDAIVECSGALNT 284
             G G   G      ++F         L  G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALAGHPYGIDREF---------LAEGLGFNSVIGNSLVAVSDRDFIVELMFWGTL 250

Query: 285 LACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
               + + ++D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 78/185 (42%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    ++P+L  + + L D ++++  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDLIIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 77/185 (41%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    L+P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDILIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 88/190 (46%), Gaps = 16/190 (8%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    L+P+L  + + L   +I++  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 LRDAYDILIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGTAVGTGIN----TKKDFDILVA--KQISLETGIEFKTAPNKFE 267
                +  ++ F    GT  GT  +       D D + A  K+++  +G +    P   +
Sbjct: 181 RNFVRARNDIGFRGVKGTT-GTQASFLALFHGDHDKVEALDKRVAELSGFDI-IYPVTGQ 238

Query: 268 ALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLP--ENEPGSSIMPGK 325
              S    ++  G L++ A +  K++ DIR L +       EL  P   ++ GSS M  K
Sbjct: 239 TY-SRKVDIDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYK 292

Query: 326 VNPTQNEAMC 335
            NP + E +C
Sbjct: 293 RNPMRCERVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 85/193 (44%), Gaps = 22/193 (11%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + D L   ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 LRDAYDVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGT--------AVGTGINTK-KDFDILVAKQISLET--GIEFKTA 262
                +  +L      GT        A+  G + K ++ D  V + +  +T   +  +T 
Sbjct: 181 RNFVRARNDLGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTY 240

Query: 263 PNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIM 322
             K +        ++    L + A +  K++ DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 323 PGKVNPTQNEAMC 335
             K NP + E +C
Sbjct: 290 AYKRNPMRCERVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 87/193 (45%), Gaps = 22/193 (11%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 LRDAYDIVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGT--------AVGTGINTK-KDFDILVAKQISLET--GIEFKTA 262
              + +  ++      GT        A+  G + K ++ D  V + +  +T   +  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTY 240

Query: 263 PNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIM 322
             K +        ++    L++ A S  K++ DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 323 PGKVNPTQNEAMC 335
             K NP + E +C
Sbjct: 290 AYKRNPMRCERVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 82/193 (42%), Gaps = 22/193 (11%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + D L   ++ +  +  +G TH Q A   TLG+  + ++Q +   +
Sbjct: 121 LRDAYDVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGT--------AVGTGINTK-KDFDILVAKQISLET--GIEFKTA 262
                +  ++      GT        A+  G + K ++ D  V + +  ET   +  +T 
Sbjct: 181 RNFDRARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTY 240

Query: 263 PNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIM 322
             K +        ++    L + A +  K++ DIR L +       E    + + GSS M
Sbjct: 241 SRKID--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAM 289

Query: 323 PGKVNPTQNEAMC 335
             K NP + E +C
Sbjct: 290 AYKRNPMRCERVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + + L + ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 LRDAYDLVIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGT--------AVGTGINTK-KDFDILVAKQISLET--GIEFKTA 262
              + +  ++      GT        A+  G + K ++ D  V + +  +T   +  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTY 240

Query: 263 PNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIM 322
             K +        ++    L + A +  K++ DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 323 PGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQF 357
             K NP + E +C +  + +G+  + T   AS Q+
Sbjct: 290 AYKRNPMRCERVC-SLARHLGSLLSDTVQTASVQW 323

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    L+P+L  + + L   ++++  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 LRDAYDILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L + A +  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 90/240 (37%), Gaps = 20/240 (8%)

Query: 107 NVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELE 166
           +++     R  E++G  +  K       V+  +S ND   T + I     V   L P L+
Sbjct: 87  DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 167 KLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFI 226
            L + L  ++     ++  G THLQ A P+      S Y         R+   L  L   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 227 AQG-GTAVGTGINTKKDFDILVAKQISLETGIEFKTA-PNKFEALASHDAIVECSGALNT 284
             G G   G      ++F         L  G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALAGHPYGIDREF---------LAEGLGFNSVIGNSLVAVSDRDFIVELMFWGTL 250

Query: 285 LACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGN 344
               + + ++D+  +      G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 76/185 (41%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    ++P+L  + D L   + E+  +  +G TH Q A   T+G+  + ++Q++    
Sbjct: 121 LRDAYDIIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F T         
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K NP +
Sbjct: 241 SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 80/186 (43%), Gaps = 8/186 (4%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGTAVGTGINTKKDF----DILVAKQISLETGIEFKTAPNKFEAL 269
              + +  ++      GT  GT  +    F    D + A    +   + F          
Sbjct: 181 RNFERARNDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTGQT 239

Query: 270 ASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 329
            S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K NP 
Sbjct: 240 YSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 330 QNEAMC 335
           + E +C
Sbjct: 297 RCERVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 83/190 (43%), Gaps = 16/190 (8%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILV-AKQISLETGIEFKTAPNKFEAL--- 269
              + +  ++      GT   TG  T+  F  L       +E   E  T    F+ +   
Sbjct: 181 RNFERARNDIGLRGVKGT---TG--TQASFLALFHGNHDKVEALDERVTELLGFDKVYPV 235

Query: 270 ----ASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGK 325
                S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 326 VNPTQNEAMC 335
            NP + E +C
Sbjct: 293 RNPMRCERVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 16/190 (8%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 IRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILV-AKQISLETGIEFKTAPNKFEAL--- 269
              + +  ++      GT   TG  T+  F  L       +E   E  T    F+ +   
Sbjct: 181 RNFERARNDIGLRGVKGT---TG--TQASFLALFHGNHDKVEALDERVTELLGFDKVYPV 235

Query: 270 ----ASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGK 325
                S    ++    L++ A +  K++ DIR L +       E    + + GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYK 292

Query: 326 VNPTQNEAMC 335
            NP + E +C
Sbjct: 293 RNPMRCERVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 83/190 (43%), Gaps = 16/190 (8%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    ++P+L  + + L   ++E+  +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 LRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILV-AKQISLETGIEFKTAPNKFEAL--- 269
              + +  ++      GT   TG  T+  F  L       +E   E  T    F+ +   
Sbjct: 181 RNFERARNDIGLRGVKGT---TG--TQASFLALFHGNHDKVEALDERVTELLGFDKVYPV 235

Query: 270 ----ASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGK 325
                S    ++    L++ A +  K++ DIR L +       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 326 VNPTQNEAMC 335
            NP + E +C
Sbjct: 293 RNPMRCERVC 302

>YDR097C Chr4 complement(640109..643837) [3729 bp, 1242 aa] {ON}
           MSH6Protein required for mismatch repair in mitosis and
           meiosis, forms a complex with Msh2p to repair both
           single-base & insertion-deletion mispairs; potentially
           phosphorylated by Cdc28p
          Length = 1242

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 55/119 (46%), Gaps = 10/119 (8%)

Query: 114 NRAIEILGGQLGSKTV-HPNNHVNQSQSTNDSFPTAMHISAVRE---VVFKLLPELEKLR 169
           NRAI  +G ++  K + HP    N  +S  DS  + +    +RE   + F  LP+LE++ 
Sbjct: 644 NRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERML 703

Query: 170 DALKDKSI---EFNKIVKIGRT--HLQDATPLT-LGQEFSGYVQQVENGITRVQNSLTN 222
             +  ++I   +F K++    T   LQD+     L  + S Y+     G+     S TN
Sbjct: 704 ARIHSRTIKVKDFEKVITAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTN 762

>Suva_2.256 Chr2 complement(439531..443268) [3738 bp, 1245 aa] {ON}
           YDR097C (REAL)
          Length = 1245

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 10/119 (8%)

Query: 114 NRAIEILGGQLGSKTV-HPNNHVNQSQSTNDSFPTAMHISAVRE---VVFKLLPELEKLR 169
           NRAI  +G ++  K + HP  H +  +   DS  + +   A+RE   V F  LP+LE++ 
Sbjct: 647 NRAITPMGKRMMKKWLMHPLLHKHDIEKRLDSVDSLLQDIALREELEVTFSKLPDLERML 706

Query: 170 DALKDKSI---EFNKIVKIGRTHLQDATPL---TLGQEFSGYVQQVENGITRVQNSLTN 222
             +  ++I   +F K++    T +Q  + L    L  + S Y+     G+     + TN
Sbjct: 707 ARIHSRTIKVKDFEKVITAFETIVQLQSSLQNNNLKGDVSDYISSFPKGLVEGVENWTN 765

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 74/185 (40%), Gaps = 6/185 (3%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQV---E 210
           +R+    ++P+L  + + L   + E+  +  +G TH Q A   TLG+  + ++Q++    
Sbjct: 121 MRDAYDIIIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 211 NGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFDILVAKQISLETGIEFKTAPNKFEALA 270
               R +N +         GT          D D + A    +   + F           
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTY 240

Query: 271 SHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 330
           S    ++  G+ ++   +  K++ DIR L +       E    + + GSS M  K NP +
Sbjct: 241 SRKIDIDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMR 297

Query: 331 NEAMC 335
            E +C
Sbjct: 298 CERVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 84/193 (43%), Gaps = 22/193 (11%)

Query: 154 VREVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGI 213
           +R+    L+P+L  + + L   ++    +  +G TH Q A   TLG+  + ++Q++   +
Sbjct: 121 LRDAYDILIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 214 TRVQNSLTNLKFIAQGGT--------AVGTGINTK-KDFDILVAKQISLET--GIEFKTA 262
              + +  ++      GT        A+  G + K +  D  V + +  +T   +  +T 
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTY 240

Query: 263 PNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPRCGYGELSLPENEPGSSIM 322
             K +        ++    L++ A +  K++ DIR L +       E    +++ GSS M
Sbjct: 241 SRKID--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAM 289

Query: 323 PGKVNPTQNEAMC 335
             K NP + E +C
Sbjct: 290 AYKRNPMRCERVC 302

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 73/163 (44%), Gaps = 25/163 (15%)

Query: 42  MPEPLILAYGILKKSVAIVNESLGTLDPKI-SKAIQEAADEVAK-GSLNEHFPLVVFQTG 99
           +PE  I A G         N +L +  P + S A+ E + E +K   ++   P  V  T 
Sbjct: 434 VPESFIGALG--------QNRTLASPAPNVESDAVTELSKESSKVEDISSQSPKYV-ATE 484

Query: 100 SGTQTNMNVNEVISNRAIEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVF 159
            G+QT  N N+VI    IEI   +L       NN +N+++          ++S   E+  
Sbjct: 485 LGSQTEENSNDVIHEEIIEIYNDEL-------NNTINKTEEPEKD--EVKYVSLDTEIDI 535

Query: 160 KLLPELEKLRDALK-DKSIEFNKIV----KIGRTHLQDATPLT 197
           + +    K RD LK D+ I+ +K +    K+G    +DA  +T
Sbjct: 536 QTVQSPTKSRDDLKSDEQIKHSKDIVKQGKMGEVSAKDAIYIT 578

>NDAI0E02420 Chr5 (501925..503391) [1467 bp, 488 aa] {ON} Anc_8.615
           YPL120W
          Length = 488

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 15/99 (15%)

Query: 128 TVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEK-----------LRDALKDKS 176
           T  P N  ++  ++ DS  +   + + R  +F+ L +LEK           L+D L+ K 
Sbjct: 186 TTEPENSSDKKSASTDSLISIEDLKSTRNSLFEELLKLEKEDEELDRQIEDLKDELEQKG 245

Query: 177 I-EFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIT 214
           + + N++ ++ +THL+    L   QE      Q ++ +T
Sbjct: 246 MKDLNEMAEVNKTHLEQ---LQFIQEVQSLQNQYDSALT 281

>SAKL0F08712g Chr6 (666544..667830) [1287 bp, 428 aa] {ON} some
           similarities with uniprot|P40523 Saccharomyces
           cerevisiae YIL055C Hypothetical ORF
          Length = 428

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 388 CIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATAIAKDAHKNGLTLKEAALKSKLLT 447
           CIV ++ N+ ++NKLL E        +P +GY     I   +H N +     +      +
Sbjct: 112 CIVTLKRNDSQLNKLLVELNSSQWEYHPLVGY----VIPPPSHHNPMAPATPSHPPPASS 167

Query: 448 AEQFDEWIVPESMVHP 463
            + F ++++P  M+ P
Sbjct: 168 LQFFPQFMMPPQMMIP 183

>Skud_4.355 Chr4 complement(617056..620799) [3744 bp, 1247 aa] {ON}
           YDR097C (REAL)
          Length = 1247

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 114 NRAIEILGGQLGSKTV-HPNNHVNQSQSTNDSFPTAMHISAVRE---VVFKLLPELEKLR 169
           NRAI  +G ++  K + HP  H N  ++  DS  + +    +RE     F  LP+LE++ 
Sbjct: 649 NRAITPMGKRMMKKWLMHPLLHKNDIENRLDSIDSLLQDITLREDLESTFSKLPDLERML 708

Query: 170 DALKDKSI---EFNKIVKIGRTHLQDATPL-------TLGQEFSGYVQQVENGITRVQNS 219
             +  ++I   +F K++    T +Q  + L        + Q  S + +++  G+    N+
Sbjct: 709 ARIHSRTIKVRDFEKVITALETIVQLQSSLQNNNLKGDVSQYISSFPEELVEGVENWTNA 768

Query: 220 LTNLKFIAQGGTAVGTGINTKKD 242
               + I +       G + + D
Sbjct: 769 FERQRAINENVIVPQRGFDVEFD 791

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 56  SVAIVNESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNR 115
           S A+ ++ L   DP  +K + E +D+   G     F L     G G +   +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 116 AIEILGG-----QLGSKTVH-PNNHVNQSQST 141
            +E   G     QL +K+ H PN H N+++S+
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>Smik_4.338 Chr4 complement(606613..610359) [3747 bp, 1248 aa] {ON}
           YDR097C (REAL)
          Length = 1248

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 10/119 (8%)

Query: 114 NRAIEILGGQLGSKTV-HPNNHVNQSQSTNDSFPTAMHISAVRE---VVFKLLPELEKLR 169
           NRAI  +G ++  K + HP    +  ++  DS  + +    +RE   + F  LP+LE++ 
Sbjct: 650 NRAITPMGKRMMKKWLMHPLLRKSDIENRLDSVDSLLQDITLREELEMTFSKLPDLERML 709

Query: 170 DALKDKSI---EFNKIVKIGRTHLQDATPL---TLGQEFSGYVQQVENGITRVQNSLTN 222
             +  ++I   +F K++    T +Q    L    L  + S Y+  + NG+     + TN
Sbjct: 710 ARIHSRTIKVKDFEKVITAFETIVQLQRTLQNNVLKGDVSKYISSIPNGLLEGVENWTN 768

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa]
           {ON} similar to uniprot|P53067 Saccharomyces cerevisiae
           YGL241W
          Length = 1009

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECS-GALNTLACSLFKIS 293
           +D ++++++  E GI F+T    F  + S+DA  E    ALN L C + ++S
Sbjct: 155 YDDVISEEMFFEEGIGFETLKIVFHVMNSYDANWEAKVAALNLLHCCILQMS 206

>KAFR0A02370 Chr1 (489885..493505) [3621 bp, 1206 aa] {ON} Anc_8.235
           YDR097C
          Length = 1206

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 9/115 (7%)

Query: 114 NRAIEILGGQL-GSKTVHPNNHVNQSQSTNDSFPTAMHISAVR---EVVFKLLPELEKLR 169
           NRAI  +G ++  +  +HP    N  +   DS    M  + +R   EV F  LP+LE++ 
Sbjct: 609 NRAITPMGKRMMRTWLMHPLLQKNDIEKRLDSVDILMSDAELRDKLEVAFSKLPDLERML 668

Query: 170 DALKDKSIEFNKIVKI--GRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTN 222
             +   +I+    VK+  G   + D        E  G ++Q    I++V +SL +
Sbjct: 669 ARIHSSTIKVKDFVKVIQGFEDICDLLKTISKTELEGALKQY---ISQVPSSLYD 720

>ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} similar
           to uniprot|P48361 Saccharomyces cerevisiae YGR097W ASK10
           Component of the RNA polymerase II
          Length = 1130

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 155 REVVFKLLPELEKLRDALKDKSIEFNKIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIT 214
           +E+   LLP +E LR  L+ K  E  ++    RT++ +   +T GQ  + Y+  V+   T
Sbjct: 285 KEINMNLLPRIEDLRRDLQSKIKEIKELSGDFRTNINEHVAIT-GQLLNRYISSVKYMTT 343

Query: 215 RVQNS 219
            V +S
Sbjct: 344 NVADS 348

>Kpol_1058.39 s1058 complement(110901..114551) [3651 bp, 1216 aa]
           {ON} complement(110901..114551) [3651 nt, 1217 aa]
          Length = 1216

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 66  TLDPKISKAIQEAADEVAKGSLN-------EHFPLVVFQTGSGTQTNMNVNEV--ISNRA 116
           ++DP+  K  + A D + K  LN       EH    +       +    +NE+  +SN+ 
Sbjct: 167 SIDPR-PKVRKRAVDAIVKILLNPPAAPSAEHLGSALIAAFCLKELTSILNEISTMSNKK 225

Query: 117 IEILGGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKL 161
           ++  GG+L SK +H    +++  STN  +PTA HI  + + + ++
Sbjct: 226 LKTQGGELNSKLIHILKLISRIVSTN-QWPTA-HIDQLCDCLLEV 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,385,967
Number of extensions: 1992938
Number of successful extensions: 6281
Number of sequences better than 10.0: 92
Number of HSP's gapped: 6487
Number of HSP's successfully gapped: 92
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)