Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G009906.12ON78783404e-43
NCAS0F002106.12ON79791158e-09
Kpol_1032.36.12ON78841071e-07
ZYRO0F00528g6.12ON77771019e-07
ACR014C6.12ON7082896e-05
Kwal_56.223596.12ON9181862e-04
TDEL0G045906.12ON7485819e-04
KAFR0L003506.12ON7125810.001
KLTH0C11484g6.12ON8982800.002
Skud_5.306.12ON7483730.014
Ecym_30156.12ON7082710.032
TPHA0M002206.12ON7880690.055
Smik_5.286.12ON7483670.12
SAKL0E00924g6.12ON9790650.31
KNAG0E009306.12ON10926640.43
YEL059C-A (SOM1)6.12ON7483630.51
KLLA0D00880g6.12ON7142556.4
SAKL0B09680g7.94ON59236576.9
NOTE: 1 genes in the same pillar as TBLA0G00990 were not hit in these BLAST results
LIST: Suva_5.9

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G00990
         (78 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...   135   4e-43
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    49   8e-09
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    46   1e-07
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    44   9e-07
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    39   6e-05
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    38   2e-04
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    36   9e-04
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    36   0.001
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    35   0.002
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    33   0.014
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    32   0.032
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    31   0.055
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    30   0.12 
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    30   0.31 
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    29   0.43 
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    29   0.51 
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    26   6.4  
SAKL0B09680g Chr2 complement(816974..818721,818784..818814) [177...    27   6.9  

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score =  135 bits (340), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 66/78 (84%), Positives = 66/78 (84%)

Query: 1  MAPPVTIQTKEELDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKRI 60
          MAPPVTIQTKEELDILEKVNRKNR            YSITQYECFDNDKGQIECFPFKRI
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRI 60

Query: 61 FQQVGEYRREITDETTNM 78
          FQQVGEYRREITDETTNM
Sbjct: 61 FQQVGEYRREITDETTNM 78

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 48.9 bits (115), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 1  MAPPVTIQTKEELDILEKV-NRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPPV +  K+++ +   + N +              + +TQ++C   + GQ  CFPFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 60 IFQQVGEYRREITDETTNM 78
          +FQ+    R E+T+  +NM
Sbjct: 61 VFQECQGVRTEVTNVDSNM 79

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 16/84 (19%)

Query: 1  MAPPVTIQTKEELDILEKV-----NRKNRXXXXXXXXXXXXYSITQYEC-FDND-KGQIE 53
          MAPP  IQ++EE+   +K      N+K +             SITQ++C F+N  +G+  
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLT---------SITQFQCRFENSYEGEYI 51

Query: 54 CFPFKRIFQQVGEYRREITDETTN 77
          C PFKR+F++    R E+TD  TN
Sbjct: 52 CLPFKRLFEECSGIRIEVTDRFTN 75

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 43.5 bits (101), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 1  MAPPVTIQTKEELDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKRI 60
          MAPP  I T E++        + R             S+TQ+ C     G+  C PFKR+
Sbjct: 1  MAPPTPILTSEQVS-----RERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRV 55

Query: 61 FQQVGEYRREITDETTN 77
          F++   +  E+TD  TN
Sbjct: 56 FEKCLGHALEVTDADTN 72

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 38.9 bits (89), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 16/82 (19%)

Query: 1  MAPPVTIQTKEELDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKRI 60
          MAPP  + T+EE+      +R                S+TQ EC  + +G + C PF+R+
Sbjct: 1  MAPPTPVLTREEVAPALATSRD-----------CVLASLTQNECHFDGRGYV-CVPFQRL 48

Query: 61 FQQVGEYRR----EITDETTNM 78
          F++    +R    EIT+  TNM
Sbjct: 49 FRECTLNKRRVRIEITERNTNM 70

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 37.7 bits (86), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 1  MAPPVTIQTKEELDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKRI 60
          MAPP  +  KEEL+ L +                   S+TQ EC + D  Q  C PFKR+
Sbjct: 1  MAPPTVVFGKEELEPLLR----------NVMATCIFKSLTQSEC-NFDGHQYVCVPFKRV 49

Query: 61 FQQV----GEYRREITDETTN 77
          F++        R E+TD  TN
Sbjct: 50 FKECKVDGKSIRIEVTDRNTN 70

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 35.8 bits (81), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 38/85 (44%), Gaps = 20/85 (23%)

Query: 1  MAPPVTIQTKEELDILEKVNRKNRXXXXXXXXXXXXYSITQYEC--FDNDKGQIECFPFK 58
          MAPP  +  +EEL   E    KN              S+TQ++C       G  EC PFK
Sbjct: 1  MAPPTPVLAREELP--EIPQSKN----------CVLKSLTQFQCQLRPAGSGLYECVPFK 48

Query: 59 RIFQQV----GEY--RREITDETTN 77
          R+FQ+     G +  R E+T   TN
Sbjct: 49 RLFQECRDPSGRFKSRIEVTSPLTN 73

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 35.8 bits (81), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 37 YSITQYECFDNDKGQIECFPFKRIF 61
          YS+ QY C     G +ECFPFKR+F
Sbjct: 26 YSLVQYNCEYRVGGTLECFPFKRMF 50

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 17/82 (20%)

Query: 1  MAPPVTIQTKEEL-DILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPP  +  KEEL  I EK                   ++ Q EC  N    + C PFKR
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEP-----------CFLKALVQNECEFNGHEYV-CTPFKR 48

Query: 60 IFQQVGEYRR----EITDETTN 77
          +F++ G  +R    E+TD+ TN
Sbjct: 49 LFKECGAGKRIVRIEVTDQDTN 70

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 32.7 bits (73), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 16/83 (19%)

Query: 1  MAPPVTIQTKEE-LDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPP TI+++++ L  L  ++   R              + Q+EC   +   + CFPFKR
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLK---------ELVQWECQFREADYV-CFPFKR 50

Query: 60 IFQQV-----GEYRREITDETTN 77
          +F++           E+TD  TN
Sbjct: 51 LFERCIAPDKSATDYEVTDTYTN 73

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 32.0 bits (71), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 18/82 (21%)

Query: 1  MAPPVTIQTKEELD-ILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPP  I T++E++ IL +                   S+ Q EC  +    + C PFKR
Sbjct: 1  MAPPTPIITRDEVEPILSRTK------------DCILASLIQNECHFDGHNYV-CIPFKR 47

Query: 60 IFQQVGEYRR----EITDETTN 77
          +F++    +R    E+TD +TN
Sbjct: 48 LFEECTLNKRRVRIEVTDISTN 69

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 31.2 bits (69), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 1  MAPPVTIQTKEELDI-LEKVNRKNRXXXXXXXXXXXXYSITQYEC--FDNDKGQIECFPF 57
          MAP   +  +E +   L+   ++NR             ++TQYEC   D +  +  C PF
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELK-------ALTQYECQFVDLESNRYICRPF 53

Query: 58 KRIFQQVGEYRREITDETTN 77
          KR+F+       E T + TN
Sbjct: 54 KRLFEVCAGTSYETTAQPTN 73

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 30.4 bits (67), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 16/83 (19%)

Query: 1  MAPPVTIQTKEE-LDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPP TI+++++ L  L  ++ +                + Q+EC       + C PFKR
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLK---------ELVQWECQFKGADYV-CSPFKR 50

Query: 60 IFQQVGEYRR-----EITDETTN 77
          +F+   E+ +     E+TD  TN
Sbjct: 51 LFEHCVEHGKPATNYEVTDTYTN 73

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 29.6 bits (65), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 40/90 (44%), Gaps = 25/90 (27%)

Query: 1  MAPPVTIQTKEELD-ILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPP  +  K+EL+ +L+KV                  S+ Q EC  N +  I C PFKR
Sbjct: 1  MAPPTPVFGKDELESLLKKVK-----------PPCTLKSLIQNECTFNGEEYI-CVPFKR 48

Query: 60 IFQQV--------GEYRR----EITDETTN 77
          +F++         G   R    EITD  TN
Sbjct: 49 LFKECLLDSKTKDGRTSRTVRIEITDRHTN 78

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 29.3 bits (64), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 39 ITQYECFDNDKGQIECFPFKRIFQQV 64
          + Q+ C +ND  Q +C PF+R+F+Q 
Sbjct: 27 LVQFRC-ENDGTQWQCAPFRRLFEQC 51

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 28.9 bits (63), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 16/83 (19%)

Query: 1  MAPPVTIQTKEE-LDILEKVNRKNRXXXXXXXXXXXXYSITQYECFDNDKGQIECFPFKR 59
          MAPP TI+T+++ L  L  ++ +                + Q+EC      +  C PFKR
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLK---------ELVQWEC-QFKGAEYVCSPFKR 50

Query: 60 IFQQV-----GEYRREITDETTN 77
          +F+            E+TD  TN
Sbjct: 51 LFEHCIAPDKSATNYEVTDTYTN 73

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 25.8 bits (55), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 38 SITQYECFDNDKGQIECFPFKRIFQQ-VGEYRREITDETTNM 78
          S+ Q EC  N    + C PFKR+F+Q + +  R +  E TN+
Sbjct: 27 SLVQNECAFNGNDYV-CTPFKRLFEQCMVKDGRVLNIEVTNL 67

>SAKL0B09680g Chr2 complement(816974..818721,818784..818814) [1779
           bp, 592 aa] {ON} some similarities with uniprot|P31385
           Saccharomyces cerevisiae YAL013W DEP1 Transcriptional
           modulator involved in the regulation of structural genes
           involved in phospholipid biosynthesis also participates
           in regulation of metabolically unrelated genes as well
           as maintenance of mating efficiency and sporulation
          Length = 592

 Score = 26.6 bits (57), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 10/36 (27%), Positives = 19/36 (52%)

Query: 41  QYECFDNDKGQIECFPFKRIFQQVGEYRREITDETT 76
           + EC D +     CF  +  +++V + + E+  ETT
Sbjct: 433 ELECIDKETKATRCFTHQDFYRKVSDLKHELLGETT 468

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,037,620
Number of extensions: 198979
Number of successful extensions: 308
Number of sequences better than 10.0: 18
Number of HSP's gapped: 304
Number of HSP's successfully gapped: 18
Length of query: 78
Length of database: 53,481,399
Length adjustment: 50
Effective length of query: 28
Effective length of database: 47,748,099
Effective search space: 1336946772
Effective search space used: 1336946772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)