Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G009806.11ON55855829910.0
Kpol_1032.26.11ON53953416850.0
TPHA0M002106.11ON54555216190.0
ZYRO0F00506g6.11ON55056915600.0
SAKL0E00902g6.11ON54455315380.0
TDEL0G046006.11ON52853515290.0
NCAS0F002006.11ON54956715270.0
NDAI0K028906.11ON56156215270.0
Smik_5.296.11ON55557015230.0
YEL058W (PCM1)6.11ON55756615010.0
Suva_5.106.11ON55357115000.0
Skud_5.316.11ON55757314850.0
CAGL0B03597g6.11ON54056014570.0
Ecym_30146.11ON55156614440.0
Kwal_56.223556.11ON54155714420.0
KLTH0C11506g6.11ON54454214330.0
KAFR0L003406.11ON54055114180.0
ACR015W6.11ON55255713870.0
KNAG0E009406.11ON53855113780.0
KLLA0D00858g6.11ON54153413371e-180
CAGL0M02981g8.840ON617961134e-05
TDEL0B005708.840ON6301321028e-04
NDAI0K004108.840ON62635970.004
KNAG0J002708.840ON62595970.004
Kpol_1068.88.840ON63230960.006
KLLA0D01573g8.840ON60730940.008
TBLA0B032508.840ON64328920.013
Kwal_27.102588.840ON62030920.016
Ecym_46118.840ON63031910.019
Smik_13.4918.840ON62228910.019
ZYRO0G14190g8.840ON61028900.026
YMR278W (PGM3)8.840ON62228900.028
Skud_13.4508.840ON62228890.032
Suva_13.4668.840ON62228890.033
TPHA0I002508.840ON62928880.047
ABL126W8.840ON62428860.070
ACL031C7.271ON61471860.084
SAKL0D01474g8.840ON62428850.092
NCAS0C004108.840ON62549850.093
KLTH0C03872g8.840ON62134850.10
KAFR0B039208.840ON62428850.11
TBLA0B074905.111ON1091129724.1
TPHA0C007608.332ON770135715.1
Ecym_6363na 1ON56478705.5
KLTH0A05016g7.271ON61974705.9
KNAG0B027107.323ON476120697.1
Kpol_1037.73.178ON414155698.2
TBLA0H005608.442ON221658699.1
TBLA0C016001.455ON1514107699.3
NDAI0C036905.25ON1122125699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G00980
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...  1156   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   653   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   628   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   605   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   597   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   593   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   592   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   592   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   591   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   582   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   582   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   576   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   565   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   560   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   560   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   556   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   550   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   538   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   535   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   519   e-180
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    48   4e-05
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    44   8e-04
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    42   0.004
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    42   0.004
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    42   0.006
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    41   0.008
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    40   0.013
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    40   0.016
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    40   0.019
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    40   0.019
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    39   0.026
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    39   0.028
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.032
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    39   0.033
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    39   0.047
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    38   0.070
ACL031C Chr3 complement(309369..311213) [1845 bp, 614 aa] {ON} S...    38   0.084
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    37   0.092
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.093
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.10 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    37   0.11 
TBLA0B07490 Chr2 complement(1779793..1783068) [3276 bp, 1091 aa]...    32   4.1  
TPHA0C00760 Chr3 complement(147219..149531) [2313 bp, 770 aa] {O...    32   5.1  
Ecym_6363 Chr6 complement(712942..714636) [1695 bp, 564 aa] {ON}...    32   5.5  
KLTH0A05016g Chr1 (417016..418875) [1860 bp, 619 aa] {ON} simila...    32   5.9  
KNAG0B02710 Chr2 complement(522102..523532) [1431 bp, 476 aa] {O...    31   7.1  
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    31   8.2  
TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {...    31   9.1  
TBLA0C01600 Chr3 (373518..378062) [4545 bp, 1514 aa] {ON} Anc_1....    31   9.3  
NDAI0C03690 Chr3 complement(842417..845785) [3369 bp, 1122 aa] {...    31   9.8  

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/558 (100%), Positives = 558/558 (100%)

Query: 1   MVFQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGK 60
           MVFQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGK
Sbjct: 1   MVFQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGK 60

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLI 120
           AVGVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLI
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLI 120

Query: 121 ELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLE 180
           ELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLE
Sbjct: 121 ELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLE 180

Query: 181 KDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKT 240
           KDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKT
Sbjct: 181 KDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKT 240

Query: 241 NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRV 300
           NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRV
Sbjct: 241 NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRV 300

Query: 301 VFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNY 360
           VFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNY
Sbjct: 301 VFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNY 360

Query: 361 LQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQ 420
           LQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQ
Sbjct: 361 LQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQ 420

Query: 421 IENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLA 480
           IENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLA
Sbjct: 421 IENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLA 480

Query: 481 KLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD 540
           KLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD
Sbjct: 481 KLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD 540

Query: 541 DVNKLCQEVLDATAESVN 558
           DVNKLCQEVLDATAESVN
Sbjct: 541 DVNKLCQEVLDATAESVN 558

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/534 (60%), Positives = 408/534 (76%), Gaps = 22/534 (4%)

Query: 11  TDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASH 70
           + LF K C TK+H Y YGTAGFRD A+IL+TVMFTTG VACLRS+S  GKAVGVM+TASH
Sbjct: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62

Query: 71  NPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKL----IELNSNK 126
           NPP DNGVKIVEPNG+ML Q WEP+AT+LAN+A+    D+L  +V  K+     E  S  
Sbjct: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKV 122

Query: 127 VPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLP-K 185
            P ++VGRDSRES + LLECL   +    +AKI++Y LLTTPQLHFLTN  N++K    +
Sbjct: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQ 182

Query: 186 ETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVR 245
           E+ YY++F  +W+++ +++N     T     SL ID+ANGIGGPK++ LLK W    KV 
Sbjct: 183 ESSYYNYFIESWNKITALHN----ITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKVT 238

Query: 246 LINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQ 305
           L+NN W++P+ LN NCGAD+VKTNQKLPNG++ +    S++N ++CS+DGDADR+VFY+Q
Sbjct: 239 LVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGN----STENDLYCSYDGDADRIVFYFQ 294

Query: 306 DPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNL 365
           D Q   F+LLDGDKISTLFA  I+  L  A ++  ++I LGVVQTAYANGSSTNYLQ  L
Sbjct: 295 D-QDKQFHLLDGDKISTLFAKLIAKLLNDANLN--SKISLGVVQTAYANGSSTNYLQGTL 351

Query: 366 KIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTP 425
            +PV+CAKTGVKHLHHEA T YDIGVYFEANGHGTIIFS++FY++  +++ A S+     
Sbjct: 352 NVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSES---- 407

Query: 426 KLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVP 485
              A+ TL  LS LINQTVGDAISDM+GV++VL+I+  + Q W+ EYTDLPN L K++VP
Sbjct: 408 --IAVNTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVP 465

Query: 486 DRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS 539
           DRSVF TTDQERKL SP GLQSKI+K ++++ NGRSFVRASGTEDAVRVYAEAS
Sbjct: 466 DRSVFITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEAS 519

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/552 (58%), Positives = 393/552 (71%), Gaps = 22/552 (3%)

Query: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72
           +F   C T+NH Y YGTAGFRD A +LDTVM TTG +ACLRS++ DGKAVGVM+TASHN 
Sbjct: 9   VFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQ 68

Query: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLAS-QGKIDELVQFVNAKLIE--LNSNKVPT 129
           P DNGVKIVEP+GSML Q WEP AT+LAN AS      E   ++  K  +  ++S   P 
Sbjct: 69  PCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPV 128

Query: 130 LIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPK--ET 187
           L+VGRDSR+S   LL+CL   ++ L   KI+DY LLTTPQLHFLTNA N  K      E 
Sbjct: 129 LVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTED 188

Query: 188 DYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVRLI 247
           DYY  F +AW  + +++      +      L ID+ANGIGGPK+  L + W    +  L+
Sbjct: 189 DYYSFFMDAWVSITALHGIKVLQSPR----LYIDAANGIGGPKVSKLFEVWPQAGQFTLV 244

Query: 248 NNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDP 307
           NN+W+ P  LNN+CGADYVKTNQ+LP  I  D   +S    ++CSFDGDADR+VFYYQD 
Sbjct: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNI--DPAADSDPATLYCSFDGDADRIVFYYQDA 302

Query: 308 QSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKI 367
           Q N+F+LLDGDKISTLFA FIS QLK AG+    +I +GVVQTAYANG+STNYL+  L I
Sbjct: 303 Q-NSFHLLDGDKISTLFALFISKQLKKAGL--TEKISMGVVQTAYANGNSTNYLENVLNI 359

Query: 368 PVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKL 427
           PV+CAKTGVKHLHHEA T YD+G+YFEANGHGTI+FS  F++        ES ++   + 
Sbjct: 360 PVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFE------TCESLLKENNES 413

Query: 428 RALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDR 487
             +KTL   + LINQTVGDAISDM+GV+AVL+I+  TP  W+KEYTDLPN L K+VVPDR
Sbjct: 414 LEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDR 473

Query: 488 SVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS--DDVNKL 545
           S+F TTDQERKL +P G Q+KI+ IVAKY+NGRSFVRASGTEDAVRVYAEAS   D   L
Sbjct: 474 SLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAAL 533

Query: 546 CQEVLDATAESV 557
            +EV  A   SV
Sbjct: 534 NEEVSKAVLASV 545

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/569 (55%), Positives = 391/569 (68%), Gaps = 36/569 (6%)

Query: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64
           L +   T L  + C   +  Y YGTAGFR  AA LDTV+F TG +ACLRSL+  G  +GV
Sbjct: 2   LAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGV 61

Query: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLAN-LASQGKIDELVQFVNAKLIE-- 121
           MVTASHNPPVDNGVK+VEP+GSM+ + WEP+AT+LAN LA +G   E  Q  ++ L    
Sbjct: 62  MVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQREL 121

Query: 122 ----------LNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLH 171
                      N   VPTL+VGRDSRES   LL CL   + +LF AKI D  LLTTPQLH
Sbjct: 122 KGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLH 181

Query: 172 FLTNAYNLEKDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM 231
           FLT+          E+ YY HF  AWD +  ++    S  +  I SL ID+ANGIG PK+
Sbjct: 182 FLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPT--ISSLTIDAANGIGAPKV 239

Query: 232 ENLLKYWKTNYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHC 291
           + LL  W    +V  IN+ W  PE LN+ CGAD+VK+NQ+ P G      N+S+   + C
Sbjct: 240 QELLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF-----NDSTG--LGC 292

Query: 292 SFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTA 351
           S+DGDADRVVFYY + ++N F LLDGD+IS LFA+F +  LK AG+  ++E+ LGVVQTA
Sbjct: 293 SYDGDADRVVFYYIN-EANEFCLLDGDRISGLFAHFFAGILKQAGL--QSELSLGVVQTA 349

Query: 352 YANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKII 411
           YANG+ST YLQ+ L++PV+CAKTGVKHLHHEA T+YDIG+YFEANGHGTIIFS  FYK+I
Sbjct: 350 YANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI 409

Query: 412 NQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKE 471
                     E   +  A++TL+  S LINQTVGDAISDM+GV+A L+I  WTP+ W +E
Sbjct: 410 K---------EQKERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQE 460

Query: 472 YTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDA 531
           +TDLPN+LAK+VVPDRSVF TTDQER+LT P GLQ KI++ V  ++ GRSFVRASGTEDA
Sbjct: 461 FTDLPNRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDA 520

Query: 532 VRVYAEAS--DDVNKLCQEVLDATAESVN 558
           VRVYAEA+  +DV KL   V +   +SV 
Sbjct: 521 VRVYAEAASLEDVEKLSNTVKELVVKSVQ 549

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/553 (56%), Positives = 398/553 (71%), Gaps = 23/553 (4%)

Query: 12  DLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHN 71
           +L+ K CKT    YTYGTAGFR KA +LDTVMFTTG +A +RS+   G+ VGVM+TASHN
Sbjct: 9   ELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHN 67

Query: 72  PPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIEL--NSNKVPT 129
           PP DNGVKIV+P G ML Q WEP AT+LAN AS+GK  EL++ ++  + +L  +  +   
Sbjct: 68  PPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK-QELIKALDKLITKLGIDDTESAK 126

Query: 130 LIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNL-EKDLPKETD 188
           + + RDSRES   LL+ + +G+  L + ++VD+ LLTTPQLHFLT  YN       +E+ 
Sbjct: 127 ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGSSSKVEEST 186

Query: 189 YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM-ENLLKYWKTNYKVRLI 247
           YY  F++AW ++  +++  S         +IID+ANGIGGPK+ E LLK    +  V +I
Sbjct: 187 YYSAFSSAWTKICGLHDINSLPYR-----VIIDAANGIGGPKVSEMLLKNKFFSSTVSVI 241

Query: 248 NNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDP 307
           NN W+ PE LN +CGADYVKTNQ  P G++ +  NE     I+CSFDGDADR+VFYY D 
Sbjct: 242 NNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENE----CIYCSFDGDADRIVFYYHDE 297

Query: 308 QSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKI 367
           +S  FNLLDGDKISTLFA F    L  AG   ENE+KLGVVQTAYANGSST YL   L++
Sbjct: 298 KSK-FNLLDGDKISTLFAKFFKELLVAAGA--ENELKLGVVQTAYANGSSTEYLSSILEV 354

Query: 368 PVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKL 427
           PV+C  TGVKHLHHEA   YDIG+YFEANGHGT+IFS+ F+K I++K+  E Q E T K 
Sbjct: 355 PVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLK-EPQDEKTAK- 412

Query: 428 RALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDR 487
            ALKTL + + LINQTVGDAISDM+ V+AVL IL W+PQ W++EYTDLPNKL K++VPDR
Sbjct: 413 -ALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDR 471

Query: 488 SVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS--DDVNKL 545
           SVF+T++ ER+L SP GLQ KI+  V ++E+GRSFVRASGTEDAVRVYAEA+  +  ++L
Sbjct: 472 SVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRL 531

Query: 546 CQEVLDATAESVN 558
              V D  + SV+
Sbjct: 532 AASVSDLVSRSVS 544

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/535 (56%), Positives = 377/535 (70%), Gaps = 32/535 (5%)

Query: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72
           L  + C T+ + Y YGTAGFRD +  LDTVMF TG VACLRS   +GK VGVM+TASHNP
Sbjct: 8   LIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNP 67

Query: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELNSNKV---PT 129
             DNGVK+VEP+GSML Q WE  AT+LANL +   +++    + AK+ +L S +    P 
Sbjct: 68  SGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLED----IKAKVGQLTSGESSVRPQ 123

Query: 130 LIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPKETDY 189
           LIVGRDSR S   LL CL   +  LFDAKI DY LLTTPQLHFLTN   +      E  Y
Sbjct: 124 LIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQAY 183

Query: 190 YHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVRLINN 249
           + HF  AWDQ+ ++          K+ ++++D ANGIGGPKM  LL  W    +  +IN+
Sbjct: 184 FAHFLGAWDQIAALQ-------PVKLPNVVVDCANGIGGPKMSALLTQWGFAKQCSVIND 236

Query: 250 NWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQS 309
               PE LN+ CGAD+VKT+Q+LPNG+      + + N ++CSFDGDADRVVFYY D Q+
Sbjct: 237 KCDEPELLNHGCGADFVKTSQRLPNGV------KPNANDLYCSFDGDADRVVFYYLD-QN 289

Query: 310 NTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIPV 369
             F+LLDGDKISTLFA F++  LK   +D  + + +GVVQTAYANGSST YLQ NL++PV
Sbjct: 290 LGFHLLDGDKISTLFAYFVAKLLKQCKLD--SILSMGVVQTAYANGSSTKYLQDNLQVPV 347

Query: 370 ACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLRA 429
           +C KTGVKHLHHEA   YDIG+YFEANGHGT++FS  F++ +       +  + TP+L  
Sbjct: 348 SCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVT------NHADQTPEL-- 399

Query: 430 LKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDRSV 489
            K LK L+ LINQTVGDAISDMM V+AVL+IL W+P  W++E+TDLPNKL K+VV DRS 
Sbjct: 400 -KILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSA 458

Query: 490 FETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASDDVNK 544
           F TTDQER+L SPAGLQ KI++ VA+ ++GRSFVRASGTEDAVRVYAEA+    K
Sbjct: 459 FTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEK 513

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/567 (53%), Positives = 400/567 (70%), Gaps = 34/567 (5%)

Query: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64
           +D S    +++  C T+++ YTYGTAGFRDKA+ LDTVMF TG +AC RS+   G  VGV
Sbjct: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62

Query: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFV----NAKLI 120
           MVTASHNPP+DNGVK+VEP G+ML Q+WEP+ T LAN+A+    +++  F+         
Sbjct: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122

Query: 121 ELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLE 180
               NK P+LI+G DSRESS  L + L   ++++++A I +Y L+TTPQLHF+T+ +N +
Sbjct: 123 PFQENK-PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181

Query: 181 -----KDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLL 235
                 D+    +YY++FN +W +   + +  S  +    E+LIIDSANGIGGPK+ +L+
Sbjct: 182 YNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKS---FENLIIDSANGIGGPKVTDLI 238

Query: 236 KYWKTNYK--VRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSF 293
             W +  +  V +INN+W+ P  LNN+CGADYVKTNQKLP GI     N S+ N +HCSF
Sbjct: 239 STWPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQ----NPSNLN-LHCSF 293

Query: 294 DGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYA 353
           DGDADR+VFYY       F+LLDGDKI+TLFA F+S  LK   +   +++KLGVVQTAYA
Sbjct: 294 DGDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNL--TDKLKLGVVQTAYA 351

Query: 354 NGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQ 413
           NGSSTNYL   LK+PV+C KTGVKHLHHEA T+YDIG+YFEANGHGT++FSE F +++  
Sbjct: 352 NGSSTNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVL-- 409

Query: 414 KINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYT 473
                   +N PK  A +TL +   +INQTVGDA++DM+GV+ VL++   TP  W++ Y 
Sbjct: 410 --------QNEPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYK 461

Query: 474 DLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVR 533
           DLPNKLAK++VPDRSVF TT+QER+LTSP GLQ KI+  V+K  NGRSFVRASGTEDAVR
Sbjct: 462 DLPNKLAKVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVR 521

Query: 534 VYAEAS--DDVNKLCQEVLDATAESVN 558
           VYAEA+  ++  KL QEV      SV+
Sbjct: 522 VYAEAATQEETEKLSQEVCKFVLSSVS 548

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/562 (55%), Positives = 396/562 (70%), Gaps = 37/562 (6%)

Query: 14  FHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSL----SHDGKAVGVMVTAS 69
           F++IC+TKN+ YTYGTAGFRD A  LDTVMFTTG VACLRSL    S+   A+GVMVTAS
Sbjct: 16  FNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTAS 75

Query: 70  HNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLI----ELNSN 125
           HNPP DNGVKI+EPNGSML Q+WEP AT  AN+A+    DE  Q +   ++    +LN  
Sbjct: 76  HNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLENDLNIK 135

Query: 126 KVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPK 185
           + PTLI+G DSR+SS +L+  + + +  +F+AKI++Y  +TTPQLHFLTN         +
Sbjct: 136 QPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNL-TNTTGTAE 194

Query: 186 ETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLL----KYWKTN 241
           E +YY HFN    QL S+        +   ++LIID+ANGIG P++E LL    K+   N
Sbjct: 195 EINYYDHFNKYLSQLQSL----YPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPPLN 250

Query: 242 YK--VRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADR 299
            K  +++INN+ K P  LN NCGADYVKTNQKLP GI  DI    + + + CS+DGDADR
Sbjct: 251 IKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDI---DANSTLFCSYDGDADR 307

Query: 300 VVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTN 359
           +VFYY DP +N FNLLDGDKI+TLFA F S  L +A +++   +KLGVVQTAYANGSSTN
Sbjct: 308 IVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHI--LKLGVVQTAYANGSSTN 365

Query: 360 YLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAES 419
           Y+   LK+PV+C KTGVKHLHHEA T+YDIG+YFEANGHGT+IFS+ F+  +       +
Sbjct: 366 YISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSEL-------T 418

Query: 420 QIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKL 479
           +++ +   R +KTL + S LINQTVGDA+SDM+ V+AVL+IL  +P  W+KEY DLPNKL
Sbjct: 419 KLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKL 478

Query: 480 AKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS 539
           AK++VPDRS F TTDQERKL  P GLQ  + + VA    GRSFVRASGTEDAVRVYAEA 
Sbjct: 479 AKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAK 538

Query: 540 DD------VNKLCQEVLDATAE 555
                     K+CQ V+++  +
Sbjct: 539 TQEETEWLSKKVCQLVIESVTQ 560

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/570 (53%), Positives = 396/570 (69%), Gaps = 32/570 (5%)

Query: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62
            ++D  + ++L+ K C+TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ V
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGK-----IDELVQFVNA 117
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS          EL + +  
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 118 KLIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAY 177
           + I L+++ VP ++VGRDSRESS  LL CL    + +F A+++D   +TTPQLH++T+  
Sbjct: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 178 NLEK------DLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM 231
           N  +      ++  E DYY  F  A+++L S        +   +  L ID+ANGIGGP++
Sbjct: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLS---VPRLFIDAANGIGGPQL 237

Query: 232 ENLL--KYWKTNY-KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNV 288
           + LL  K W     ++ +IN+    PE LN  CGADYVKTNQ+LP G++      SS + 
Sbjct: 238 KKLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSP-----SSHDS 292

Query: 289 IHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVV 348
           ++CSFDGDADRVVFYY D +S  F+LLDGDKISTLFA F+S QL+LA +  EN +++GVV
Sbjct: 293 LYCSFDGDADRVVFYYVDSESQ-FHLLDGDKISTLFAKFLSKQLELAHL--ENSLRIGVV 349

Query: 349 QTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFY 408
           QTAYANGSSTNY++  L+ PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE F+
Sbjct: 350 QTAYANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH 409

Query: 409 KIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIW 468
           ++I  +++          + ALKTL   S LINQTVGDA+SDM+ V+A LAI+   P  W
Sbjct: 410 QVIKSELS-----RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDW 464

Query: 469 NKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGT 528
           +KEYTDLPNKL K +VPDRS+F+T DQERKL +P GLQ+KI+ ++AKY  GRSFVRASGT
Sbjct: 465 DKEYTDLPNKLVKCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGT 524

Query: 529 EDAVRVYAEASD--DVNKLCQEVLDATAES 556
           EDAVR+YAE  D   +++ C E+++    S
Sbjct: 525 EDAVRIYAECQDSSQLDQFCNEIVELVKAS 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/566 (54%), Positives = 392/566 (69%), Gaps = 32/566 (5%)

Query: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62
            ++D  +   L+   C+TKN  ++YGTAGFR  A  LDTVMF+TG +A LRSL   G+ V
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLAS------QGKIDELVQFVN 116
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS      + ++ EL + + 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRV-ELAKLIE 119

Query: 117 AKLIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNA 176
            + I+LN+  VP ++VGRDSRESS  LL CL      +F A+++D   +TTPQLH++T+ 
Sbjct: 120 HEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDL 179

Query: 177 YN---LEKD---LPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPK 230
            N   LE D   +  E DYY  F  A+++L +        +   +  L ID+ANGIGGP+
Sbjct: 180 SNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLS---VPKLFIDTANGIGGPQ 236

Query: 231 MENLLKY--WKTNY-KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKN 287
           ++ LL    W     +V +IN+    PE LN  CGADYVKTNQ+LP G++      SS +
Sbjct: 237 LKKLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLS-----PSSFD 291

Query: 288 VIHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGV 347
            ++CSFDGDADRVVFYY D  S  F+LLDGDKISTLFA F+S QL+LA +  E+ +K+GV
Sbjct: 292 SLYCSFDGDADRVVFYYVDSGSK-FHLLDGDKISTLFAKFLSKQLELAHL--EHSLKIGV 348

Query: 348 VQTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENF 407
           VQTAYANGSST Y++  L  PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE F
Sbjct: 349 VQTAYANGSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKF 408

Query: 408 YKIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQI 467
           ++ I  +++      +T    AL+TLK  S LINQTVGDAISDM+ V+A LAIL  +P  
Sbjct: 409 HRTIKSELSKSKLNGDT---LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMD 465

Query: 468 WNKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASG 527
           W++EYTDLPNKL K +VPDRS+F+TTDQERKL +P GLQ KI+ +VAKY  GRSFVRASG
Sbjct: 466 WDEEYTDLPNKLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASG 525

Query: 528 TEDAVRVYAEASDD--VNKLCQEVLD 551
           TEDAVRVYAE  D   + + C EV++
Sbjct: 526 TEDAVRVYAECKDSSKLGQFCDEVVE 551

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/571 (53%), Positives = 396/571 (69%), Gaps = 34/571 (5%)

Query: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62
            ++D  +   L+ + C TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ V
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLAS-QGKIDE----LVQFVNA 117
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS     DE    LV+ +  
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 118 KLIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAY 177
           + I+L++   P ++VGRDSRESS  LL CL      +F A +VD   +TTPQLH++TN  
Sbjct: 121 EKIDLDA--APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178

Query: 178 NLEK------DLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM 231
           N  +       +  E DYY  F NA+++L +            +  L +D+ANGIGGP++
Sbjct: 179 NKRQREGGSAQVATEQDYYSFFINAFNELFTT---CQIEKRLSVPKLFVDTANGIGGPQL 235

Query: 232 ENLL--KYWKT-NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNV 288
           + LL  K W   + ++ ++N+    P+ LN  CGADYVKTNQ+LP G++      SS + 
Sbjct: 236 KKLLASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLS-----PSSPDS 290

Query: 289 IHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVV 348
           ++CSFDGDADRVVFYY DP+S  F+LLDGDKISTLFA F+S QL+LA +   + +K+GVV
Sbjct: 291 LYCSFDGDADRVVFYYVDPESK-FHLLDGDKISTLFAKFLSKQLELANL--TDSLKIGVV 347

Query: 349 QTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFY 408
           QTAYANGSST+Y++  L  PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFS+ F+
Sbjct: 348 QTAYANGSSTSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFH 407

Query: 409 KIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIW 468
           + I  ++   S+ + +  L AL TL+  + LINQTVGDAISDM+ V+A L+IL+  P  W
Sbjct: 408 QTIESEL---SRAQGS--LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDW 462

Query: 469 NKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGT 528
           +KEYTDLPNKL K +VPDRS+F+TTDQERKL +PAGLQ+KI+ ++ KY  GRSFVRASGT
Sbjct: 463 DKEYTDLPNKLVKCIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGT 522

Query: 529 EDAVRVYAEASD--DVNKLCQEVLDATAESV 557
           EDAVRVYAE  D   +++ C EV++    SV
Sbjct: 523 EDAVRVYAECQDPTKLDQFCNEVVEYVKSSV 553

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/573 (53%), Positives = 389/573 (67%), Gaps = 34/573 (5%)

Query: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62
            ++D  +   L+ + C+TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ V
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLAS-----QGKIDELVQFVNA 117
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS     +    ELV+ +  
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 118 KLIELN-SNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNA 176
           + I+L  SN  P ++VGRDSRESS  LL CL      +F A+++D   +TTPQLH++T+ 
Sbjct: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 177 YNLEKD-------LPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGP 229
            N  +           E DYY  F  A+++L +   D     S  +  L ID+ANGIGGP
Sbjct: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFT-TYDMEKRLS--VPKLFIDTANGIGGP 237

Query: 230 KMENLL--KYWKT-NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSK 286
           +++ LL  K W   + ++ +IN+    P+ LN+ CGADYVKTNQ+LP G++      SS 
Sbjct: 238 QLKKLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSP-----SSF 292

Query: 287 NVIHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLG 346
             ++CSFDGDADRVVFYY D +   F+LLDGDKISTLFA F+S QL++A +  E  +K+G
Sbjct: 293 ESLYCSFDGDADRVVFYYVDSELK-FHLLDGDKISTLFAKFLSKQLEMANL--ERSLKIG 349

Query: 347 VVQTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSEN 406
           VVQTAYANGSST Y++  L  PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE 
Sbjct: 350 VVQTAYANGSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEK 409

Query: 407 FYKIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQ 466
           F+    Q I +E    N   L ALKTL   + LINQTVGDA+SDM+ V+A LAIL   P 
Sbjct: 410 FH----QTIESELSKPNGHTL-ALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPM 464

Query: 467 IWNKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRAS 526
            W++EY DLPNKL K +VPDRS+F+TTDQERKL +P GLQSKI+ ++AKY  GRSFVRAS
Sbjct: 465 NWDEEYKDLPNKLVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRAS 524

Query: 527 GTEDAVRVYAEASD--DVNKLCQEVLDATAESV 557
           GTEDAVRVYAE  D   +++ C E++     SV
Sbjct: 525 GTEDAVRVYAECQDMSKLDQFCNEIVGYVKASV 557

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/560 (56%), Positives = 387/560 (69%), Gaps = 41/560 (7%)

Query: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72
           L++K C T++  YTYGTAGFR  A ILD+VMFTTG +A LRS+S     VGVM+TASHNP
Sbjct: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64

Query: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELN--SNKVPTL 130
           P DNGVKIVE +GSML QDWEP+AT LAN  S          +NA + ELN      P +
Sbjct: 65  PRDNGVKIVESDGSMLLQDWEPLATRLAN--SVADYHTFESTLNAIMQELNISPGHAPQI 122

Query: 131 IVGRDSRESSTSLLECLKEGSLKLF-DAKIVDYELLTTPQLHFLT-NAYNLEKDLPKETD 188
           +VG DSRESS  LL  L +G   +  DA+I ++ LLTTPQLHFLT N  + E        
Sbjct: 123 VVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFEDY------ 176

Query: 189 YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNY----KV 244
           YY +F +AW+QL  +       + +K   L+ID+ANGIGGP+   +L Y +T+     K+
Sbjct: 177 YYRYFLDAWNQLFELYGIEGFKSFDK---LVIDTANGIGGPQFLKMLSYSQTDLPHLQKI 233

Query: 245 RL-----INNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADR 299
           RL      NN+W  P  LN+ CGAD+VKTNQ+LP GI  D  N      ++CSFDGDADR
Sbjct: 234 RLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN------LYCSFDGDADR 287

Query: 300 VVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTN 359
           VVFYY D  S TF+LLDGDKISTL A FI+  LK AG+    E+KLGVVQTAYANGSST 
Sbjct: 288 VVFYYVD-DSLTFHLLDGDKISTLLAYFINALLKEAGL--AEELKLGVVQTAYANGSSTT 344

Query: 360 YLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAES 419
           Y+ + L++PV+ AKTGVKHLHHEA T YDIGVYFEANGHGT+IFS++FY++I      E 
Sbjct: 345 YVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVI------ED 398

Query: 420 QIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKL 479
           ++      ++  TL++LS LINQT+GDAISDM+ ++ VL IL W+P  W+ EYTDLPNKL
Sbjct: 399 RLAKNAHDKSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKL 458

Query: 480 AKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS 539
            K+VVPDRS+F TTDQER+L SPAGLQ KI+ +VA    GRSF+RASGTEDAVRVYAEA 
Sbjct: 459 TKVVVPDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQ 518

Query: 540 --DDVNKLCQEVLDATAESV 557
             +   KL  EV DA  E+V
Sbjct: 519 TVEATEKLSTEVTDALIETV 538

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/566 (53%), Positives = 389/566 (68%), Gaps = 40/566 (7%)

Query: 7   LSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMV 66
           + + + L+ K C ++   Y YGTAGFR KA ILDTV+FTTG +ACLRS+   G+ VG M+
Sbjct: 4   VEEVSKLYDKHCCSRFK-YIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMI 62

Query: 67  TASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGK---IDELVQFVNAKLIELN 123
           TASHNPP DNGVK+V+P G ML Q+WE  AT+LAN AS GK   +  L + +N   I+ +
Sbjct: 63  TASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKAD 122

Query: 124 SNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDL 183
           S     ++V RDSRES + LL+ L +G+    +  IVDY++LTTPQLHFLT   N + + 
Sbjct: 123 SE--ARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMES 180

Query: 184 PK-----ETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYW 238
            +     E  YY HF +A  +L  + N            L+ID+ANG+GG K E L  + 
Sbjct: 181 ERVIEVNEAFYYSHFLSALKELTELFN-----IPGLPYPLVIDAANGVGGAKAEEL--FM 233

Query: 239 KTNY---KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGIT--TDIINESSKNVIHCSF 293
           K  +      +IN NW + + LN+ CGADYVKTNQ LP GI+  TDI      N +HCSF
Sbjct: 234 KNTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDI------NSLHCSF 287

Query: 294 DGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYA 353
           DGDADRV+FYY+D     F+LLDGDKISTLFA F    L +AGI  ++ +KLGVVQTAYA
Sbjct: 288 DGDADRVIFYYRDVD-GMFHLLDGDKISTLFAKFFQSMLPVAGI--QDNVKLGVVQTAYA 344

Query: 354 NGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQ 413
           NGSST YL + L +PV+C  TGVK+LH +A   YD+G+YFEANGHGT+IFSENF   +++
Sbjct: 345 NGSSTRYLSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSK 404

Query: 414 KINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYT 473
           ++  E  +    K+ ALKTL+  S LINQTVGDA+SDMM V+AVL IL WTPQ W+ EYT
Sbjct: 405 RLK-EGSLSAESKM-ALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYT 462

Query: 474 DLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVR 533
           DLPN L K+VVPDRS+F+TT+ ER+L SP GLQ++I+K++  Y+N RSFVRASGTEDAVR
Sbjct: 463 DLPNTLMKVVVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVR 522

Query: 534 VYAEA-----SDDVN-KLCQEVLDAT 553
           +YAEA     +DD++ K+ Q V+ AT
Sbjct: 523 IYAEAATKEQADDLSIKISQLVISAT 548

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/557 (53%), Positives = 387/557 (69%), Gaps = 34/557 (6%)

Query: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64
           LD      L+   C T  H Y YGTAGFR KA +LDTVMFTTG VA LRS+  +GK VGV
Sbjct: 2   LDTKALKSLYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKL--IEL 122
           M+TASHNPP DNGVKIV+P G ML Q WE  ATDLAN ASQG   E V  V   +  +E+
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQG-FSEFVASVERLMTKLEV 119

Query: 123 NSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKD 182
            SN   +++V RDSRES   LL     G   L + K+ D+ LLTTPQLHFLT+  N   +
Sbjct: 120 GSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSN---E 176

Query: 183 LPKETD-----YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLL-- 235
           LPK T+     YY +F +AW ++  +      S   K+E   ID+ANGIG P +  +L  
Sbjct: 177 LPKGTEIGKSLYYDNFLSAWVEIAELCK--IDSLPYKLE---IDAANGIGAPVVTEMLSQ 231

Query: 236 -KYWKTNYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFD 294
            K++K  + V  +N+ W+ P+SLN+ CGAD+VKTNQKLP+GI         +N I CSFD
Sbjct: 232 HKFFKGAFAV--VNDEWETPDSLNHLCGADFVKTNQKLPHGIAPG----GERNRICCSFD 285

Query: 295 GDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYAN 354
           GDADR+VFYY   ++  F+LLDGDK++TLFA F    L+ AG+  ++E++LGVVQTAYAN
Sbjct: 286 GDADRIVFYYCG-KNGDFHLLDGDKMATLFAKFFQELLRDAGL--QDELELGVVQTAYAN 342

Query: 355 GSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQK 414
           GSST Y++Q L I V C  TGVKHLHHEA  +YDIGVYFEANGHGT++FS  F  +I++K
Sbjct: 343 GSSTAYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRK 401

Query: 415 INAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTD 474
           ++   ++E+    ++LK L + + LINQTVGDAISDM+ V+AVL+IL W+P+ W++EYTD
Sbjct: 402 LS--EKLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTD 459

Query: 475 LPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRV 534
           LPNKL K++VPDR+VF+T + ER+L SPAG+Q KI+ +VA +  GRSFVRASGTEDAVRV
Sbjct: 460 LPNKLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRV 519

Query: 535 YAEAS--DDVNKLCQEV 549
           YAEA+   +   L Q+V
Sbjct: 520 YAEAATPQETEALSQQV 536

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/542 (54%), Positives = 379/542 (69%), Gaps = 26/542 (4%)

Query: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64
           LD      L+   CK+    Y YGTAGFR KA +LDTVMFTTG +A LRS+  +G+ VGV
Sbjct: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVN-AKLIELN 123
           M+TASHNPP DNGVKIV+P G ML Q WE  ATDLAN A+Q     L    N    + L+
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120

Query: 124 SNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDL 183
           ++ + +L V RDSRES   LL  L  GS  L + +I DY LLTTPQLHFLT+  N   +L
Sbjct: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRN---EL 177

Query: 184 PKETD-----YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYW 238
           P +T      YY  F +AWD + ++      S   K+E   ID+ANGIG P+++ +L   
Sbjct: 178 PNDTAIDRFFYYKEFLSAWDDITALC--GIQSLPYKLE---IDAANGIGAPRVKEMLSTH 232

Query: 239 KTNYKV-RLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDA 297
           K    V R++N++W+ P SLN+ CGADYVKTNQ+LP GI  +  N+  +  I CSFDGDA
Sbjct: 233 KFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQAN--NDCQR--ICCSFDGDA 288

Query: 298 DRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSS 357
           DR+VFY+ D +   F LLDGDK++TLFA F   Q  L+  + +  + LGVVQTAYANGSS
Sbjct: 289 DRIVFYFCDSEGQ-FRLLDGDKMATLFAKF--FQDILSSANLQERLSLGVVQTAYANGSS 345

Query: 358 TNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINA 417
           T+Y+++ L IPV C  TGVKHLHHEA   YDIGVYFEANGHGT++FS+ F +++N  ++ 
Sbjct: 346 THYIERVLGIPVTCTPTGVKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSN 404

Query: 418 ESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPN 477
           + Q +++  L++L+ L   + LINQTVGDAISDMMGV+AVL+IL WTPQ WN+EYTDLPN
Sbjct: 405 KHQSDSS--LQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPN 462

Query: 478 KLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAE 537
           KL K++VPDR+VF+TT+ ER+L SP GLQ KIN +VA+Y   RSFVRASGTEDAVRVYAE
Sbjct: 463 KLVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAE 522

Query: 538 AS 539
           AS
Sbjct: 523 AS 524

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/551 (52%), Positives = 381/551 (69%), Gaps = 25/551 (4%)

Query: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64
            D+++    F K C T+NH YTYGTAGFR  A+ LDTVMFTTG VA LRSL   GK +GV
Sbjct: 2   FDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGV 61

Query: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELNS 124
           M+TASHNPP DNGVKIVEP+G+ML + WE IATDLAN+AS G     V  ++  + +LN 
Sbjct: 62  MITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNI 121

Query: 125 NK--VPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKD 182
           ++   P LIVG DSRESS  L+ECL+  +  +FD  ++++ L+TTPQLH+LT    L+ D
Sbjct: 122 DETTTPRLIVGHDSRESSPYLMECLQAAA-PVFDTIVINHTLITTPQLHYLT---MLQND 177

Query: 183 LPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYW-KTN 241
           +  E DYY  F+ +W+ L S+  D + + +N    LI+D ANG+G  +    L Y  +  
Sbjct: 178 VVTEVDYYKFFSTSWNNLFSLYPDLNLTFNN----LIVDGANGVGSVQFSKFLPYLPQLA 233

Query: 242 YKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVV 301
               +IN+    P+ LN +CGAD+VKTNQKLPNG    I+N +  + ++ SFDGDADR+V
Sbjct: 234 TLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNG----IVNPNPSD-LYASFDGDADRIV 288

Query: 302 FYYQDPQSNTFNLLDGDKISTLFAN-FISMQLKLAGIDYENEIKLGVVQTAYANGSSTNY 360
           FYY D  +  F+LLDGDKIST+     ISM   L   +  N+I LGVVQTAYANGSST Y
Sbjct: 289 FYYVD-NNKKFHLLDGDKISTILTKCLISM---LRESELLNDINLGVVQTAYANGSSTKY 344

Query: 361 LQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQ 420
           + ++LK+PV C KTGVKHLHH A +++DIG+YFEANGHGT++FS  FY+++ + I+  S 
Sbjct: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSS 404

Query: 421 IENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLA 480
            E   K R   +L   S LINQTVGD+++D++ V+A L+IL  +P  W+ EY DLPN L 
Sbjct: 405 SEKIHKARL--SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLT 462

Query: 481 KLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD 540
           K  V +R VF+TTD ERKLTSP+GLQ KI+  V+KY++GRSFVRASGTEDAVR+YAEA  
Sbjct: 463 KCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKT 522

Query: 541 --DVNKLCQEV 549
             +V  L +EV
Sbjct: 523 KAEVEALSKEV 533

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/557 (51%), Positives = 377/557 (67%), Gaps = 37/557 (6%)

Query: 15  HKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNPPV 74
           H+ C     VY YGTAGFR +A +L  V+F TG +ACLRSL   G  VGVM+TASHNPP 
Sbjct: 14  HRGC---GRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPE 70

Query: 75  DNGVKIVEPNGSMLSQDWEPIATDLANLASQGK---IDELVQFVNAKLIELNSNKVPTLI 131
           DNGVK+V+P+G ML+ +WE  AT LAN ASQG+   +D L   V+   ++L       ++
Sbjct: 71  DNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLDLALRA--RVV 128

Query: 132 VGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLP--KETDY 189
           V RDSR S   LL+ L +G+  L D ++VD  +LTTPQLHFLT A N        +E  Y
Sbjct: 129 VARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLY 188

Query: 190 YHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKT-NYKVRLIN 248
           Y HF  A ++L +++   +         L++D+ANG+G  K   L +       +V +IN
Sbjct: 189 YAHFVAALEELAALHGLETLPFP-----LVVDTANGVGALKARELFRRSPLFKNRVSIIN 243

Query: 249 NNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQ 308
           +NW + E LN+ CGADYVKT Q LP GI+ D++ ES    + CS+DGDADRV+FYY D Q
Sbjct: 244 DNWSQHELLNSGCGADYVKTKQCLPQGISADLLRES----LFCSYDGDADRVIFYYIDGQ 299

Query: 309 SNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIP 368
              F+LLDGDKISTL A F+   L  AGI+  +++ LGVVQTAYANGSST YL + L++P
Sbjct: 300 ER-FHLLDGDKISTLIAKFLQSALLTAGIN--DDVCLGVVQTAYANGSSTRYLSEVLEVP 356

Query: 369 VACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLR 428
           V+C  TGVKHLH EA  +YD+G+YFEANGHGT+IFSE+F       +  E  +EN P L 
Sbjct: 357 VSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHF------TLTVERALEN-PALS 409

Query: 429 A-----LKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLV 483
           A     L+TLK  + LINQT+GDAI+DM+ V+A+L+IL+W+P+ W+K+YTDLPN L K+V
Sbjct: 410 AKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVV 469

Query: 484 VPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS--DD 541
           VPDRS+F+TT+ E++LTSPAGLQ  I+ IV  Y++GRSFVRASGTEDAVR+YAEA+    
Sbjct: 470 VPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQ 529

Query: 542 VNKLCQEVLDATAESVN 558
            ++L  +V     ES N
Sbjct: 530 ADELATKVSTLVVESTN 546

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/551 (50%), Positives = 362/551 (65%), Gaps = 27/551 (4%)

Query: 13  LFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNP 72
           +F  +C TK + YTYGTAGFRDKAA+LDTVMF TG VA LRS   +G  VGVMVTASHNP
Sbjct: 9   VFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNP 68

Query: 73  PVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELNSNKVPTLIV 132
           P DNGVK+V+P G ML + WEP+AT LANLA+ G  D+  ++  + + E N      L V
Sbjct: 69  PEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNYTGGARLCV 128

Query: 133 GRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTT--PQLHFLTNAYNLEKD-LPKETDY 189
           G D+RESS  LL+ L + +L +    I   +   T  PQLH+LT   +L++D +     Y
Sbjct: 129 GHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLT---SLQRDGVTDAAAY 185

Query: 190 YHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNY-KVRLIN 248
             HF   W +L           +   + L ID+ANG+G  +++   K W  +  K RL+N
Sbjct: 186 NDHFQGCWQKLFP-----DGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLN 240

Query: 249 NNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQ 308
            ++  PE+LN  CGAD+VKTN +LP+ +        +   ++CSFDGDADR+VFY+   +
Sbjct: 241 TDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV--K 298

Query: 309 SNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIP 368
           +  F+LLDGDKISTLFA FI      AG D  +++ +GVVQTAYANG+ST Y+   L IP
Sbjct: 299 NKQFHLLDGDKISTLFAKFIGQLTARAGAD--DKLTVGVVQTAYANGNSTRYIASELGIP 356

Query: 369 VACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLR 428
            AC KTGVKHLHH A T+YDIG+YFEANGHGT++FS+ F +++    +            
Sbjct: 357 SACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTND--------- 407

Query: 429 ALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVPDRS 488
           A  TL   S LINQTVGDAI+DM+GV+AVL  L WTP++W  EYTDLPN L K+VVPDRS
Sbjct: 408 AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRS 467

Query: 489 VFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD--DVNKLC 546
           +FETTDQER+L SP GLQ KI+  V +++  RSFVRASGTE+AVR+Y EA D  +V +L 
Sbjct: 468 IFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELS 527

Query: 547 QEVLDATAESV 557
           ++V +A   SV
Sbjct: 528 KQVTEAVLNSV 538

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  519 bits (1337), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 281/534 (52%), Positives = 365/534 (68%), Gaps = 25/534 (4%)

Query: 12  DLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHN 71
           DL+ + CK + H YTYGTAGFR   ++LDTVMFTTG VA LRS+    K VGVM+TASHN
Sbjct: 5   DLYEQYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHN 63

Query: 72  PPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQG--KIDELVQFVNAKLIELNSNKVPT 129
           PP DNGVK+VEP G ML Q+WEPIAT LAN AS    +++  +Q + A+L  +++ ++  
Sbjct: 64  PPEDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAEL-NIDTTQLAN 122

Query: 130 LIVGRDSRESSTSLLECLKEGSLKLFDA-KIVDYELLTTPQLHFLTNAYNL--EKDLPKE 186
           + V RDSRES   LL  LK G + +F A KI+D+ELLTTPQLHFL  + N   +    ++
Sbjct: 123 ITVARDSRESGPRLLAALKAG-ISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRD 181

Query: 187 TDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYKVRL 246
           + YY HF + W+QL  +        +     L ID ANGIG  K++ L+       +  L
Sbjct: 182 STYYDHFVSIWNQLTQLYE-----VTELPFHLTIDCANGIGADKVKQLISQAGHMLENSL 236

Query: 247 --INNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYY 304
             +N   K  + LN +CGAD+VKTNQ  P             + ++CSFDGDADRVVFYY
Sbjct: 237 TAVNGETKTFQLLNESCGADFVKTNQTFPANC------NPKPSQLYCSFDGDADRVVFYY 290

Query: 305 QDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQN 364
            D + N F+LLDGDKI+TL A  I+  L+  G+   + +KLGVVQTAYANGSST Y+   
Sbjct: 291 VDGKENKFHLLDGDKIATLLAKLIADLLRDCGL--SDTLKLGVVQTAYANGSSTKYITDK 348

Query: 365 LKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENT 424
           LKIPV+C KTGVKHLHHEA +RYDIG+YFEANGHGT+IFS  F + ++ ++   S   N 
Sbjct: 349 LKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSG--NE 406

Query: 425 PKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVV 484
            + ++L +LK+LS LINQTVGDAISDM+ V+A L+I N  P+ W+  Y DLPN+L K++V
Sbjct: 407 QQYKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIV 466

Query: 485 PDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEA 538
           PDRSVF +T+ ER+L SP GLQ+KI+ +V ++ N RSFVRASGTEDAVRVYAEA
Sbjct: 467 PDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEA 520

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 14/96 (14%)

Query: 54  SLSHDGKAVGVMVTASHNPPVDNGVKIVEPNG------------SMLSQDWEPIATD--L 99
           S+ H   +VGVM+TASHNP +DNG K+   NG              ++ + EP +TD   
Sbjct: 140 SVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNF 199

Query: 100 ANLASQGKIDELVQFVNAKLIELNSNKVPTLIVGRD 135
             + S  + D  +++V  +++    N V   ++ RD
Sbjct: 200 TKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD 235

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 58/132 (43%), Gaps = 30/132 (22%)

Query: 24  VYTYGTAGFR-------DKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNPPVDN 76
           V T+  AGF+       DK      V FT   V         G +VGVM+TASHNP +DN
Sbjct: 123 VATFLQAGFKVIFLNDGDKFVHTPIVPFTVNEV---------GASVGVMITASHNPKMDN 173

Query: 77  GVK--------IVEPNGSMLSQDWE------PIATDLANLASQGKIDELVQFVNAKLIEL 122
           G K        I+ P+ S ++Q  E      P A     L  +G   + + +   ++IE 
Sbjct: 174 GYKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIER 233

Query: 123 NSNKVPTLIVGR 134
            + K+   +V R
Sbjct: 234 YTKKMGQSLVDR 245

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 54  SLSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSML 88
           S++H   ++GVM+TASHNP +DNG K+   NG  +
Sbjct: 146 SVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI 180

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 54  SLSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSMLS---------------QDWEPIATD 98
           ++ H   +VGVM+TASHNP +DNG K+   NG  +                + WEP + D
Sbjct: 146 TVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP-SWD 204

Query: 99  LANLASQGKIDELVQFVNAKLIELNSNKVPTLIVG 133
              +    + ++ + +V  ++ +L +      ++G
Sbjct: 205 WPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIG 239

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSML 88
           G +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQI 183

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSML 88
           G +VG+M+TASHNP +DNG K+   NG  +
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQI 180

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           +VGVMVTASHNP +DNG K+   NG  +
Sbjct: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQI 192

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSML 88
           G + GVM+TASHNP +DNG K+   NG  +
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQI 181

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSMLS 89
           G + G+M+TASHNP +DNG K+   NG  ++
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQIT 190

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           +VGVMVTASHNP +DNG K+   NG  +
Sbjct: 150 SVGVMVTASHNPKMDNGYKVYYSNGCQI 177

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 146 SVGVMITASHNPKLDNGYKVYYANGCQI 173

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 150 SVGVMITASHNPKMDNGYKVYYSNGCQI 177

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           ++GVM+TASHNP +DNG K+   NG  +
Sbjct: 156 SIGVMITASHNPEMDNGYKVYYNNGCQI 183

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 294 DGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQT 350
           D DADR     ++P ++ F  L G++I  LFA F+  Q  +   D++++  L ++ +
Sbjct: 333 DPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINS 389

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           + GVM+TASHNP +DNG K+   NG  +
Sbjct: 158 SCGVMITASHNPKMDNGYKVYYANGCQI 185

>ACL031C Chr3 complement(309369..311213) [1845 bp, 614 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER080W
          Length = 614

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 85  GSMLSQDWEPIATDLANLASQGKIDELVQFVN---AKLIELNSNKVPTLIVGRDSRESST 141
           G +L +DW P+A+D A+ + + K++ ++Q ++   AKL E       +L   +D RES+ 
Sbjct: 224 GRLLMKDWMPLASDSADGSHKEKLNSVIQPISEFQAKLAETEFTAFGSLYFAKDYRESNE 283

Query: 142 SLLECLKEGSL 152
              +   +G L
Sbjct: 284 PAYKSDTDGDL 294

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           + G+M+TASHNP +DNG K+   NG  +
Sbjct: 154 SAGIMITASHNPKMDNGYKVYYSNGCQI 181

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 12/49 (24%)

Query: 61  AVGVMVTASHNPPVDNGVK--------IVEPN----GSMLSQDWEPIAT 97
           +VGVM+TASHNP +DNG K        I+ P+      M+ ++ EP +T
Sbjct: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 55  LSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSML 88
           + H   + G+M+TASHNP +DNG K+   NG  +
Sbjct: 149 IDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88
           A GVM+TASHNP  DNG K+   NG  +
Sbjct: 156 ACGVMITASHNPKDDNGYKVYYSNGCQI 183

>TBLA0B07490 Chr2 complement(1779793..1783068) [3276 bp, 1091 aa]
           {ON} Anc_5.111 YGR218W
          Length = 1091

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 418 ESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVL-AILNWTPQIWNKEYTDLP 476
           E  + NTP  R  + L  ++ ++N+ VG  I    GV+ +L ++ + T  + NK++T+ P
Sbjct: 802 EDYMNNTPDARDAEVLNCMTTVVNK-VGPMIPQ--GVILILQSVFDCTLNMINKDFTEYP 858

Query: 477 NKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYA 536
               +     R++ E +        PA  +  ++ I   +++    V  +G + A+    
Sbjct: 859 EHRVEFYKLLRAINEKSFNALLQLPPAAFKLFVDAICWAFKHINRDVEVNGLQIAI---- 914

Query: 537 EASDDVNKL 545
           +  D+++KL
Sbjct: 915 DLVDNIDKL 923

>TPHA0C00760 Chr3 complement(147219..149531) [2313 bp, 770 aa] {ON}
           Anc_8.332
          Length = 770

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 16/135 (11%)

Query: 33  RDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNPPV--DNGVKIVEP-NGSMLS 89
           R  +  L  ++F   F  CL+ LS+    +  + +   +  +  DN    +E  N   L+
Sbjct: 29  RKSSRSLSILIFVVYFF-CLKVLSYSVHYLTTISSPCSDENIFDDNEAYFLEKLNQKNLA 87

Query: 90  QDWEPIATDLANLASQGKIDELVQFVNAKLIELNSNKVPTLIVGRDSRESSTSLLECLKE 149
            +W  + T + +LA QG++  LV F  +K  E            +  +ES   LL    +
Sbjct: 88  GNWSQVYTSIPHLAGQGEV--LVNFTISKFEEYGL---------KVEKESYDVLLNYPVD 136

Query: 150 GSLKL-FDAKIVDYE 163
             LKL +D K+V +E
Sbjct: 137 NGLKLVYDEKVVTFE 151

>Ecym_6363 Chr6 complement(712942..714636) [1695 bp, 564 aa] {ON}
           similar to Ashbya gossypii AFR072W
          Length = 564

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 219 IIDSANGIGGPKMENLLKYWKTNYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITT 278
           +IDS NG  G + E ++K  + +  V ++NN  K P S N    AD+++T+   P G  T
Sbjct: 82  VIDSTNGSKGSEKE-IVKGKRGSINV-ILNNRDKLPVSANPITHADHIRTHSIRPRG--T 137

Query: 279 DIINESSKNVIHCSFDGD 296
            I + SS  V+     GD
Sbjct: 138 VIASRSSGAVLMVGGIGD 155

>KLTH0A05016g Chr1 (417016..418875) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40053 Saccharomyces cerevisiae YER080W FMP29
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 619

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 85  GSMLSQDWEPIATDL----ANLASQGK-IDELVQFVNAKLIELNSNKVPTLIVGRDSRES 139
           G +L +DW P+  D     A+++   K ID L QF  +KL+ +  N+  +L   +D  +S
Sbjct: 228 GRLLMRDWNPLEDDASDKKAHISKLNKVIDPLSQF-QSKLLSVEFNQFGSLYFAKDYPDS 286

Query: 140 STSLLECLKEGSLK 153
                E  K  SLK
Sbjct: 287 EGPAYEGEKNESLK 300

>KNAG0B02710 Chr2 complement(522102..523532) [1431 bp, 476 aa] {ON}
           Anc_7.323 YLR212C
          Length = 476

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 22/120 (18%)

Query: 164 LLTTPQLHFLTNAYNLEKDLPKETDYYHHF-----NNAWDQLISINNDASSSTSNK---- 214
           L+ +P LHFLT ++      P  +DY  H      N A+D L+ + +  +S  SNK    
Sbjct: 260 LVPSPDLHFLTPSFT-----PFTSDYVAHEKEYRQNTAYDVLLDLIDGNNSLVSNKNNKP 314

Query: 215 -----IESLI--IDSANGIGG-PKMENLLKYWKTNYKVRLINNNWKRPESLNNNCGADYV 266
                  +LI  +D ++      K++  L +   +  V  +N   + P   N N G DYV
Sbjct: 315 VYFNTFSTLIGTLDRSDITRAISKLQTRLHFAPWSSSVIHVNCGRRSPYLTNKNIGGDYV 374

>Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON}
           (15938..17182) [1245 nt, 415 aa]
          Length = 414

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 61/155 (39%), Gaps = 21/155 (13%)

Query: 97  TDLANLASQGKIDELVQFVNAKLIELNSNKVPTLIVGRDSRESSTSLLE------CLKEG 150
           T+L N    GK D + ++ +  L  +  + V T +    SR S+  LL+        K  
Sbjct: 273 TELQNRIKSGKFDRIPEYYSNGLNAIIHSMVDTNL---KSRPSTFELLQDIQVRTARKSL 329

Query: 151 SLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLPKET-DYYHHFNNAWDQL-ISINNDAS 208
            L+ F+  ++DYE              N+EK L K++ +Y        DQ  I++     
Sbjct: 330 QLERFEKNLLDYE----------RELVNIEKILEKQSYEYEREIAQLKDQFVIAVEERVR 379

Query: 209 SSTSNKIESLIIDSANGIGGPKMENLLKYWKTNYK 243
                K      DS  G    ++     +WKT YK
Sbjct: 380 EVLEGKKVGKAPDSIRGYYDKRLPKPAYHWKTRYK 414

>TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {ON}
           Anc_8.442 YDR227W
          Length = 2216

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 32/58 (55%)

Query: 270 QKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANF 327
           QK+ N  T  I N +++NV++ S   +A+  + Y  D  +++ N++  + I+ +  N 
Sbjct: 691 QKVSNASTQHITNNTAQNVVNTSTQSEANTSIQYMTDASTDSINVITQNVINAIARNM 748

>TBLA0C01600 Chr3 (373518..378062) [4545 bp, 1514 aa] {ON} Anc_1.455
           YEL022W
          Length = 1514

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 20/107 (18%)

Query: 430 LKTLKVLSALINQTVGDAISD--MMGVMAVLAILNWTPQIWNKEYTDLPNKLAK--LVVP 485
           LK + +L +++N   GD +SD  +  V+ +L  L+     +NKE TD+  K A+  L+  
Sbjct: 168 LKVIILLHSIVNSPTGDLLSDSILYEVLQILMSLS-----FNKERTDVLRKAAETSLISM 222

Query: 486 DRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAV 532
              +F      RKL S     SK      KY N  S++ +   +D +
Sbjct: 223 TSRIF------RKLNSIKPALSK-----HKYINDESYITSDLKDDII 258

>NDAI0C03690 Chr3 complement(842417..845785) [3369 bp, 1122 aa] {ON}
           Anc_5.25 YGR274C
          Length = 1122

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 57/125 (45%), Gaps = 19/125 (15%)

Query: 85  GSMLSQDWEPIATDLANLASQGKIDEL--------VQFVNAKLIELNSNKVPTLIVGRDS 136
           G++LS++   I + L N+  Q   D          V    AK  ELN N    L++  +S
Sbjct: 431 GALLSEESTGIPSSLKNILEQNDEDWNWNEENLINVNLKQAKTAELNMNDENLLLIRNES 490

Query: 137 RES---STSLLECLKEGSL--KLFDAKIVDYELLT---TPQLHFLTNAYNLEKDLPK--- 185
           R S    T LL  L E S+  K++ +   +Y++L     P++    +  N+E  LP    
Sbjct: 491 RTSMINDTKLLPPLNERSILTKIYISNDNEYDILKRTHQPKVRSTISNLNIEHSLPALKL 550

Query: 186 ETDYY 190
           ++ YY
Sbjct: 551 QSPYY 555

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,495,555
Number of extensions: 2831954
Number of successful extensions: 10623
Number of sequences better than 10.0: 105
Number of HSP's gapped: 10919
Number of HSP's successfully gapped: 106
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)