Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G009706.22ON55954627590.0
KAFR0A050706.22ON56454420710.0
Kpol_1037.276.22ON54654420660.0
NCAS0D021606.22ON56354420590.0
Smik_15.1716.22ON54454420510.0
Suva_15.1776.22ON54454420400.0
Skud_15.1636.22ON54454420390.0
CAGL0E02629g6.22ON54854420180.0
TDEL0G044706.22ON54254320170.0
NDAI0C026306.22ON58054520200.0
KNAG0F028906.22ON56354720040.0
YOR002W (ALG6)6.22ON54454419930.0
ZYRO0C07744g6.22ON54754419720.0
KLTH0C11176g6.22ON53654319640.0
KLLA0D01221g6.22ON56654219650.0
Ecym_30276.22ON54954319270.0
SAKL0E01364g6.22ON54154219140.0
Kwal_56.224376.22ON53654419100.0
ACR004W6.22ON56354619080.0
TPHA0J003506.22ON55954519030.0
TBLA0A093105.669ON5464273191e-30
TPHA0J013805.669ON5754353182e-30
Smik_15.2475.669ON5774183164e-30
CAGL0L10450g5.669ON5504193093e-29
Suva_8.1185.669ON5764173084e-29
YOR067C (ALG8)5.669ON5774243069e-29
KLTH0F17666g5.669ON5554183041e-28
NDAI0F005105.669ON5704222997e-28
Skud_15.2345.669ON5772622943e-27
ZYRO0A11506g5.669ON5564222924e-27
Kwal_55.217425.669ON5554182909e-27
KLLA0F16621g5.669ON5614342881e-26
TDEL0B025405.669ON5694172862e-26
Kpol_1018.735.669ON6212622846e-26
KAFR0D024405.669ON5754272821e-25
NCAS0G004505.669ON5704212764e-25
SAKL0G00836g5.669ON5614152685e-24
ADR210C5.669ON5722902596e-23
Ecym_40515.669ON6044152552e-22
KNAG0L019205.669ON5682712428e-21
YBR184Wna 1ON52380714.9
KNAG0A071902.571ON48983706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G00970
         (559 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...  1067   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   802   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   800   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   797   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   794   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   790   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   790   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   781   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   781   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   782   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   776   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   772   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   764   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   761   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   761   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   746   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   741   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   740   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   739   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   737   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   127   1e-30
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   127   2e-30
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   126   4e-30
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   123   3e-29
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   123   4e-29
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   122   9e-29
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   121   1e-28
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   119   7e-28
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   117   3e-27
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   117   4e-27
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   116   9e-27
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   115   1e-26
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   114   2e-26
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   114   6e-26
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   113   1e-25
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   110   4e-25
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   107   5e-24
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   104   6e-23
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   102   2e-22
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    98   8e-21
YBR184W Chr2 (597363..598934) [1572 bp, 523 aa] {ON} Putative pr...    32   4.9  
KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa] ...    32   6.3  

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score = 1067 bits (2759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/546 (96%), Positives = 526/546 (96%)

Query: 14  PGEEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDF 73
           PGEEEAFYASPLFDFLYPFRPVGSQWLTEYV            SLGSYSGKGTPPMFGDF
Sbjct: 14  PGEEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDF 73

Query: 74  EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG 133
           EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG
Sbjct: 74  EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG 133

Query: 134 YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM 193
           YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM
Sbjct: 134 YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM 193

Query: 194 LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK 253
           LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK
Sbjct: 194 LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK 253

Query: 254 SLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIF 313
           SLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIF
Sbjct: 254 SLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIF 313

Query: 314 PFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFL 373
           PFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFL
Sbjct: 314 PFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFL 373

Query: 374 IPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPL 433
           IPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPL
Sbjct: 374 IPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPL 433

Query: 434 LRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNIL 493
           LRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNIL
Sbjct: 434 LRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNIL 493

Query: 494 WKXXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRN 553
           WK        VMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRN
Sbjct: 494 WKIIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRN 553

Query: 554 KTLNDL 559
           KTLNDL
Sbjct: 554 KTLNDL 559

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/544 (70%), Positives = 438/544 (80%), Gaps = 15/544 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           EE FYASPL+DFLYPFRP G+QWL +Y+             LGSYSG G  PMFGDFEAQ
Sbjct: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWMEITQHLPISKWYWFDLQYWGLDYPP TAYHSY  GK+GSF  P WF LN SRG E 
Sbjct: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
           +  G+K+YMR TV++SEAVFY PA++YF+KW GKHRNQSPIGQ+IAA AILFQPSLMLID
Sbjct: 155 E--GIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLID 212

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYNSVMLGLTVYAINNLLD+FY  A++CFVLS+CFKQM+LYY+PIFFGYLLSKSL 
Sbjct: 213 HGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLF 272

Query: 257 HPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
            P   NI R + +A  T+V+FV M+ P+Y+FG             GL NLIQ + RIFPF
Sbjct: 273 FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGG------------GLENLIQSVHRIFPF 320

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCVTN++IKY+  FTQ+QLQ YSL AT++GFLP+++ I LYP+K L+P
Sbjct: 321 ARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLP 380

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           YALAACSMSFFLFSFQVHEK+IL+PL+PITLLYTSTDWNVLS+VCWINNVALFTLWPLL+
Sbjct: 381 YALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLK 440

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL+LQY VC+ LSNWL+GNFSF+TPKFLP  LTPGPSIS I ++Y R SLLPHNILWK
Sbjct: 441 KDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWK 500

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    M     LD F +PPTNYPD+WI LNC +GFG F+ FW+W  Y +  +RNKT
Sbjct: 501 VVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKT 560

Query: 556 LNDL 559
           L DL
Sbjct: 561 LMDL 564

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/544 (69%), Positives = 442/544 (81%), Gaps = 13/544 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           EE+F+ASPL+DFL PFRPV +QWLTEY+             LGSYSG G PPMFGDFEAQ
Sbjct: 15  EESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQ 74

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWMEITQHLPISKWY+FDL+YWGLDYPP TAYHSY  G +GSF N  WFALN SRGYES
Sbjct: 75  RHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYES 134

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
           ++N LKTYMR TVI+SE +FYIP V+YFTKW+G+HR QS IGQ+IAAAAILFQPSLMLID
Sbjct: 135 ENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLID 194

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYNSVMLGLTVYAINNLLDEFY PAA+CFVLS+CFKQMALYY+PIFFGYLL +SL 
Sbjct: 195 HGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLF 254

Query: 257 HPS-CNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
                NISRF+ +AISTV +F  M+ P+Y+FG             GL N+IQ + RIFPF
Sbjct: 255 SRKFFNISRFLSIAISTVFAFFSMYAPLYVFG------------GGLRNVIQSVHRIFPF 302

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARG+FEDKVANFWCVTN+ IKY+ L+TQ++LQ YSL+AT++GFLP+++TI  YP+K L+P
Sbjct: 303 ARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLP 362

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           YALAACSMSF+LFSFQVHEK+IL+PL+PITLLYTSTDWNVLS V W+NNV LFTLWPLL+
Sbjct: 363 YALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLK 422

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL LQY VC+FLSNWLIGNFSFITPKFLP  LTPGP + N +D Y R SLLPHNILWK
Sbjct: 423 KDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWK 482

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                   VM  + + ++F  PP  YPD+W+++NC +GFGCF+LFWLWN YKI  + NKT
Sbjct: 483 IIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKT 542

Query: 556 LNDL 559
           L  L
Sbjct: 543 LQYL 546

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/544 (70%), Positives = 439/544 (80%), Gaps = 13/544 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           EE+FYASPL+D LYPFRP GSQW+TEY              LG +SG G PPMFGDFEAQ
Sbjct: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWMEITQHLPI KWYWFDL+YWGLDYPP TAYHSY  GK+GSFFNP+WFAL+SSRGYE+
Sbjct: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
            D  LKT+MR TV++SEA+FYIP VVYF KWLGKHR QSPIGQFIAAAAIL QPSL+LID
Sbjct: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYNSV LGLTVYAINNLLDEFY  AA+CFVLS+CFKQM LYYSPIFF YLLSKSL 
Sbjct: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269

Query: 257 HPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
            P   NI RF+ +AI+TV SF++M+GP+Y+FG             GLNN++Q I RIFPF
Sbjct: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ----------GLNNVLQSIHRIFPF 319

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCVTNV+ KY+ LFTQ++LQ YSLV T++GFLP+M+ I  YP+K+L+P
Sbjct: 320 ARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLP 379

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           YAL+ACSM+F+LFSFQVHEK+IL+PL+PITLLYTSTD NVLS V W+NN+ LFTLWPLL+
Sbjct: 380 YALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLK 439

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL LQY+VC  LSNWLIGNFSFITP FLP  LTPGPS+S I ++Y   SLLP NI WK
Sbjct: 440 KDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWK 499

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    MGA+ +LD F  PP  YPDLW+ILNCT+GFGCF LFW+WN YK+  M  K+
Sbjct: 500 VIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKS 559

Query: 556 LNDL 559
           L+ L
Sbjct: 560 LHHL 563

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/544 (68%), Positives = 441/544 (81%), Gaps = 12/544 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
            EE+FYASP++DFLYPFRPVG+QWL EY+             LG YSGKG+PP+ GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEA 72

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHWMEITQHLP+SKWYW+DLQYWGLDYPP TA+HSY  G +GSFFNP WFAL+ SRG+E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFE 132

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
           S DNGLKTYMR TVI+S+ +FY PAV+YFTKWLG++RNQSPIGQ IAA+AILFQPSLMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLI 192

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQYNSVMLGLT YAINNLLDE+Y  AA+CFVLS+CFKQMALYY+PIFF YLLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
           + P  NI+R  +++ +T+ +F +M  P+Y  G             GL N+ QCI RIFPF
Sbjct: 253 LFPKFNIARLTVISFATLATFALMLAPLYFLG------------GGLKNIYQCIHRIFPF 300

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCVTNV +KY+E F+ +QLQ YSLVAT+IGFLP+M+   L+P+K L+P
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLP 360

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           Y L ACSMSFFLFSFQVHEK+IL+PL+PITLLY+STDWNVLSLV WINNVALFTLWPLL+
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           +DGL LQY V + LSNWLIGNFSFITP+FLP  LTPGPSIS+I+ DYRR SLLP+N++WK
Sbjct: 421 RDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    MG    LDLF  PP+ YPDLW++LNCTVGF CF +FW+W+ YKI    +K+
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKS 540

Query: 556 LNDL 559
           + DL
Sbjct: 541 MKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/544 (68%), Positives = 438/544 (80%), Gaps = 12/544 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
            EE+FYASP++DFLYPFRPVG+QWL EY+             LG YSGK TPP+ GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEA 72

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHWMEITQHLP+SKWYW+DLQYWGLDYPP TA+HSY  G +G+FFNP WFAL+ SRG+E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFE 132

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
           S DNGLKTYMR TVI+S+ +FY PAV+YFTKWLG++RNQSPIGQ IAAAAILFQPSLMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLI 192

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQYNSVMLGLT YAINNLLDE+Y  AA+CFVLS+CFKQMALYY+PIFF YLLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
             P  NI+R  ++A +T+ +F +MF P+Y  G             GL N+ QCI R+FPF
Sbjct: 253 FFPKFNIARLTVIAFATLATFSLMFAPLYFLG------------GGLRNIYQCIHRMFPF 300

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCV+N+ +KY+E F+ +QLQ YSLVAT++GFLP+M+   L+P+K L+P
Sbjct: 301 ARGIFEDKVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLP 360

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           Y L ACSMSFFLFSFQVHEK+IL+PL+PITLLY+STDWNVLSLV WINNVALFTLWPLL+
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL LQY V + L+NWLIGNFSFITP+FLP  LTPGPSIS+I+ DYRR SLLP+N++WK
Sbjct: 421 KDGLHLQYVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    MG    LDLF  PP  YPDLW++LNC VGF CF +FW+W+ YKI    NK+
Sbjct: 481 SFIIGTYIAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKS 540

Query: 556 LNDL 559
           + DL
Sbjct: 541 MKDL 544

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/544 (68%), Positives = 440/544 (80%), Gaps = 12/544 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
            EE+FYASP++DFLYPFRPVG+QWL EY+             LG YSGK +PP+ GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEA 72

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHWMEITQHLP+SKWYW+DLQYWGLDYPP TA+HS  FG +G+FFNP WFAL+ SRG+E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFE 132

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
           S DNGLKTYMR TVI+S+ +FY PAV+YFTKWLG++RNQSPIGQ IAAAAILFQPSLMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLI 192

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQYNSVMLGLT YAINNLLDE+Y  AA+CFVLS+CFKQMALYY+PIFF YLLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
           + P  NI+R  ++A +T+ +F V+  P+Y  G             GL N+ QCI RIFPF
Sbjct: 253 LFPKFNIARLTVIAFATLATFSVILAPLYFLG------------GGLRNIHQCIYRIFPF 300

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           +RGIFEDKVANFWCVTN+ +KY++ FT +QLQ YSLVAT+IGFLP+MI   L+P+K L+P
Sbjct: 301 SRGIFEDKVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLP 360

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           Y L ACSMSFFLFSFQVHEK+IL+PL+PITLLY+STDWNVLSLV WINNVALFTLWPLL+
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL LQY V + LSNWLIGNFSFITP+FLP  LTPGPSIS+I+ DYRR SLLP+N++WK
Sbjct: 421 KDGLHLQYTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    MG   +LDLF  PP+ YPDLW++LNC VGF CF +FW+W+ YKI    NK+
Sbjct: 481 SFIIGTYIAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKS 540

Query: 556 LNDL 559
           + DL
Sbjct: 541 VKDL 544

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/544 (68%), Positives = 437/544 (80%), Gaps = 16/544 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           EE+FYASPL+DFL+PFRP GSQWLTE++             LG YSG    PM GDFEAQ
Sbjct: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWMEITQHLPISKWY++DL+YWGLDYPP TA+HSY  GKLG+F NPDWFAL+SSRG E+
Sbjct: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
              GLK YMRFTV+LSEA+FY+PAVVYFTKWLG+ RNQSPIGQFIAAAAILFQPSLMLID
Sbjct: 140 --QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLID 197

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYNS+MLG TVYAINNLLDEFY PAAICFVLS+CFKQM+LYY+PIFF YLL +S+ 
Sbjct: 198 HGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMF 257

Query: 257 HPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
            P   NI RFI ++I+T+V+F  MF P Y+FG             GL+ L Q +RRIFPF
Sbjct: 258 FPKLFNIPRFISISIATLVTFTAMFSPFYIFG-------------GLDGLAQTVRRIFPF 304

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCV N ++K++ LFT +QL+ YSL+ T++GF P+MI I LYPRK L+P
Sbjct: 305 ARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLP 364

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           YALAACSMSF+LFSFQVHEK+IL+PL+PITLL+TS DWNVLS+V WINNVALFTLWPLL+
Sbjct: 365 YALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLK 424

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           ++GL LQYFVC+FLSNWLIGNFSFITP+FLP F+TPGPSIS++ D+YRR SLLPH+I WK
Sbjct: 425 REGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWK 484

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    M A   LDLF + P  +PDLW+ILNCT+GF  F LFWLW  YK   +  K 
Sbjct: 485 LIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKN 544

Query: 556 LNDL 559
           + DL
Sbjct: 545 IQDL 548

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/543 (68%), Positives = 434/543 (79%), Gaps = 14/543 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           EE+FYASPL+DFLYPFRP GSQWLTEYV              GSYSG+ +PPMFGDFEAQ
Sbjct: 14  EESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMFGDFEAQ 73

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWMEITQHL  S+WYWFDL+YWGLDYPP TAYHSY  GK+GSF  P+WF LN SRG E+
Sbjct: 74  RHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNESRGIET 133

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
            D  LKT+MRFTV+LSE +FYIPAVVYFTKWLGKHR +SPIGQFI+AAAILFQPSLMLID
Sbjct: 134 PD--LKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSLMLID 191

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYN VMLGLTVYAIN+L +EFY  AAICFVLS+CFKQMALYY+PIFF YLLSKSL 
Sbjct: 192 HGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLSKSLF 251

Query: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316
            P  N  R   +A++TV+SF  M+ P+Y+FG             GL N+IQ + RIFPFA
Sbjct: 252 SPRFNFPRLFAIAVATVLSFAAMYAPLYIFGG------------GLANVIQSVHRIFPFA 299

Query: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376
           RGIFEDKVANFWCVTNV  KY+ +F QEQLQ YSL+AT++GFLP++I IFLYP+K +I Y
Sbjct: 300 RGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICY 359

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           ALA CSMSF+LFSFQVHEK+IL+PL+PITLLYTS++W+VLS+  WINNV LFTL+PLL+K
Sbjct: 360 ALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKK 419

Query: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKX 496
           DGL LQYFVC+ LSNWL+GNFSF+TPKFLP FLTPGPS+S++D +YRR S LP N++WK 
Sbjct: 420 DGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKI 479

Query: 497 XXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556
                   MG + ++D    PP +YPDLW++LNC +GFGCF LFWLW+ Y +  M  KTL
Sbjct: 480 IIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTL 539

Query: 557 NDL 559
             L
Sbjct: 540 QQL 542

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/545 (68%), Positives = 436/545 (80%), Gaps = 12/545 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
            +E+FYASPL+DFLYPFRP GSQW+TEY+             LG YSG  TPPMFGDFEA
Sbjct: 47  SKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEA 106

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHWMEITQ+LPIS+WYWFDLQYWGLDYPP TA+HSY  GK+GSFF P+WF L  SRGYE
Sbjct: 107 QRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYE 166

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
             D  LKT+MR TV+ SE++ YIPAVVYFTKWLGK RNQSPIGQFIA AAILFQPSL+LI
Sbjct: 167 GQD--LKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILI 224

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQ+NSVMLGLTVY +NNLLDEFY  AA+CFVLS+CFKQMALYYSPIFF YLLSKSL
Sbjct: 225 DHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSL 284

Query: 256 VHPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFP 314
            HP   NI RF  ++ +T+ +F  MFGPIY FG  +          G+ NL+Q I+RIFP
Sbjct: 285 FHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENG---------GITNLLQSIKRIFP 335

Query: 315 FARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLI 374
           FARGIFEDKVANFWCVTNV+ KY+  FTQEQLQ YSL+ T+I FLP+M+ I LYPRK+L+
Sbjct: 336 FARGIFEDKVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLL 395

Query: 375 PYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434
            YAL+ACSMSF+LFSFQVHEK+IL+PL+PITLLYTSTD NVLS V W+NN+ LFTLWPLL
Sbjct: 396 LYALSACSMSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLL 455

Query: 435 RKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILW 494
           +KDGL LQY+VC  LSNWLIGNFSFITP+FLP  LTPGPSI  + ++YRR +LLP N +W
Sbjct: 456 KKDGLSLQYWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIW 515

Query: 495 KXXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNK 554
           K        +MG +  +D F +PP+ YPDLW+ILNCT+GFGCF+LFWLWN YK+  M  K
Sbjct: 516 KVIIVLSYVMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKK 575

Query: 555 TLNDL 559
            ++ L
Sbjct: 576 NIHQL 580

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/547 (67%), Positives = 436/547 (79%), Gaps = 16/547 (2%)

Query: 14  PGEEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDF 73
           P  EE FYASP++DFLYPFR  GSQW+TEY+             LGSYSG  TPPMFGDF
Sbjct: 32  PEVEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDF 91

Query: 74  EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG 133
           EAQRHWMEITQHLP+S+WYWFDLQYWGLDYPPFTAYHSY  GK+G+F  P WF L++SRG
Sbjct: 92  EAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRG 151

Query: 134 YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM 193
            E+D  G+K+YMRFTV+LSE +FYIPA+VYFTKW+G+ + QSPIGQF+AAAAILFQP+LM
Sbjct: 152 METD--GIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLM 209

Query: 194 LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK 253
           LIDHGHFQYN VMLGLTVYAINNLLD FY  AA+CFVLS+CFKQMALYY+PIFF  LLSK
Sbjct: 210 LIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSK 269

Query: 254 SLVHPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRI 312
           SL  P   NI RF+ VA +T+ S  VMF P+Y+FG             G+ N++Q I RI
Sbjct: 270 SLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFG-------------GVGNVLQSIHRI 316

Query: 313 FPFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKF 372
           FPFARGIFEDKVANFWCVTNV  KY+ +FTQ +LQFYSLVAT++GF P+ + +  YP+KF
Sbjct: 317 FPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKF 376

Query: 373 LIPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWP 432
           LIPY LAACSM+FFLFSFQVHEK+IL+PL+P TLL+TST+WN LS+V W+NNVALFTLWP
Sbjct: 377 LIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWP 436

Query: 433 LLRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNI 492
           LL+KDGL LQY VC  + NWL+GNFSFITP+FLP  LTPGPSISNI ++YRR SLLPHNI
Sbjct: 437 LLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNI 496

Query: 493 LWKXXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMR 552
           +WK         M  + +L+     P+ YPDLW+ LNCTVGFGCF+LFW+W  YK+I +R
Sbjct: 497 IWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLR 556

Query: 553 NKTLNDL 559
           NKT+ +L
Sbjct: 557 NKTIQEL 563

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/544 (68%), Positives = 440/544 (80%), Gaps = 12/544 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
            EE+FYASP++DFLYPFRPVG+QWL EY+             LG YSGKG+PP++GDFEA
Sbjct: 13  AEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEA 72

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHWMEITQHLP+SKWYW+DLQYWGLDYPP TA+HSY  G +GSFFNP WFAL  SRG+E
Sbjct: 73  QRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFE 132

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
           S DNGLKTYMR TVI+S+ +FY PAV+YFTKWLG++RNQSPIGQ IAA+AILFQPSLMLI
Sbjct: 133 SPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLI 192

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQYNSVMLGLT YAINNLLDE+Y  AA+CFVLS+CFKQMALYY+PIFF YLLS+SL
Sbjct: 193 DHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSL 252

Query: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
           + P  NI+R  ++A +T+ +F ++F P+Y  G             GL N+ QCI RIFPF
Sbjct: 253 LFPKFNIARLTVIAFATLATFAIIFAPLYFLG------------GGLKNIHQCIHRIFPF 300

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCVTNV +KY+E FT +QLQ YSL+AT+IGFLP+MI   L+P+K L+P
Sbjct: 301 ARGIFEDKVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLP 360

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           Y L ACSMSFFLFSFQVHEK+IL+PL+PITLLY+STDWNVLSLV WINNVALFTLWPLL+
Sbjct: 361 YVLIACSMSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLK 420

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL LQY V + LSNWLIGNFSFITP+FLP  LTPGPSIS+I+ DYRR SLLP+N++WK
Sbjct: 421 KDGLHLQYAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWK 480

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    MG    LD F  PP+ YPDLW++LNC VGF CF +FWLW+ YKI    +K+
Sbjct: 481 SFIIGTYIAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKS 540

Query: 556 LNDL 559
           + DL
Sbjct: 541 MKDL 544

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/544 (67%), Positives = 439/544 (80%), Gaps = 14/544 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
            EE+FYASPL+DFLYPF+PVGSQWL EY+             LG YSG+   PM GDFEA
Sbjct: 18  AEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDFEA 77

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHW+EITQHLPIS+WY+FDL+YWGLDYPP TAYHSY  GKLGS  NPDWFALN SRG E
Sbjct: 78  QRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRGLE 137

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
           S+D  LKTYMRFTVILSE +FYIPAVVYFTKW+G+HR  SP+GQFIAAAAILFQP+LMLI
Sbjct: 138 SND--LKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLI 195

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQYN VMLG TVYAIN+L+DEFY PAA CFVLS+CFKQMALYYSPIFF YLL + +
Sbjct: 196 DHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCV 255

Query: 256 VHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315
                   RF+ +A++T+ +F+VM+ P+Y+ GS S             N++Q + RIFPF
Sbjct: 256 FKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGS------------QNVLQSVHRIFPF 303

Query: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375
           ARGIFEDKVANFWCVTN+ +KY++LFTQ+QLQ YSL+AT +GFLP+++ + LYP+K L+P
Sbjct: 304 ARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVP 363

Query: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
           +ALAACSMSFFLFSFQVHEK+IL+PL+PITLLYTST+W+VLSLV WINNV LFTLWPLL+
Sbjct: 364 FALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLK 423

Query: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495
           KDGL LQY VC+   NWLIGNFSF+TP FLP FLTPGPS+S++D +YRR SLLP +I+WK
Sbjct: 424 KDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWK 483

Query: 496 XXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555
                    MGA+ +LD+F  PP NYPDLW+ILNCT+GFGCFMLFWLWN YK+  +  ++
Sbjct: 484 LIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQS 543

Query: 556 LNDL 559
           L  L
Sbjct: 544 LQQL 547

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/543 (66%), Positives = 430/543 (79%), Gaps = 15/543 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           +E+F+ASPL+DFL PFRPV +Q+  EYV             LGS+SG+ T PM GDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWME+T +LP+S+WYWFDLQYWGLDYPP TAYHSY  GKLGS  NP+WFAL SSRG E+
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
            +  LK YMRFTVILSEA  YIPAV+YFTKW G  R QSPIGQ+IAAAAILFQPSL+LID
Sbjct: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYNSVMLGLTVYAINNLLD F+GPAAICF+LSLCFKQMAL+YSPIFF YLLS+SL 
Sbjct: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246

Query: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316
            PS   SRF+ VA+STV++F +MF P+Y+FG             G+ N++Q I RIFPF+
Sbjct: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFG-------------GMKNVLQSIHRIFPFS 293

Query: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376
           RGIFEDKVANFWCV+NV++KY + FTQ+QLQ  S  AT  GFLPS   + LYP+K +IPY
Sbjct: 294 RGIFEDKVANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPY 353

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
            LAACSM+FFLF FQVHEKSIL+PL+PI+LL+ STDWNVL++V WINNVALFTLWPLL+K
Sbjct: 354 GLAACSMAFFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKK 413

Query: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKX 496
           D L LQY +   LSNWLIGNFSF+TP+FLP F+TPGPS+SN+ + YRR S LP+NI+WK 
Sbjct: 414 DKLALQYGIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKI 473

Query: 497 XXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556
                  VM  + ILDLF QPP   PDLW+++NC +GF CF +FWLWNNYK+  MRNK++
Sbjct: 474 LIITSYIVMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSI 533

Query: 557 NDL 559
            DL
Sbjct: 534 LDL 536

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/542 (68%), Positives = 432/542 (79%), Gaps = 15/542 (2%)

Query: 18  EAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQR 77
           EAF+ASP++DFL PFRPVG+QW  +YV             LG YSG  TPPMFGDFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 78  HWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYESD 137
           HWMEITQHLP+ +WYW+DLQYWGLDYPP TAYHSY  GKLGSFF   WF L SSRGYES 
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 138 DNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLIDH 197
           +  LK+YMRFTVI+SE + YIPAV+YFTKW+GK+R+QSPIGQ+IAAAAILFQP+L+L+DH
Sbjct: 160 N--LKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDH 217

Query: 198 GHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLVH 257
           GHFQYN VMLG+TVY +NNLLD FY   AICFVLSLCFKQMALYYSPIFF YLLSKS   
Sbjct: 218 GHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYS 277

Query: 258 PSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFAR 317
           P  N+ R   +++ST ++F+  FGPIY+FG             G  NL+Q + RIFPFAR
Sbjct: 278 PGINLPRLFAISVSTALAFIGSFGPIYIFG-------------GYKNLVQSMHRIFPFAR 324

Query: 318 GIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPYA 377
           GIFEDKVANFWCV+N+ IKYR LFTQ+ LQ YSL+AT+IG LPS I  FLYP++ L+PYA
Sbjct: 325 GIFEDKVANFWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYA 384

Query: 378 LAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKD 437
           LAACSMSFFLFSFQVHEK+ILLPL+PITLLYTS DWNVLSLVCWINNVALFTLWPLL+KD
Sbjct: 385 LAACSMSFFLFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKD 444

Query: 438 GLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKXX 497
            LVLQY V +  SNWLIGNFSF+TP+FLP FLTPGPSIS+ID DYRR SLLP +++W+  
Sbjct: 445 NLVLQYGVMFMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLI 504

Query: 498 XXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTLN 557
                  MG +  LD +  PP+ YPDLW++ NC++GF CF+ FW+WNNYK+ +MRN TL 
Sbjct: 505 IVGSYIAMGIIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQ 564

Query: 558 DL 559
           DL
Sbjct: 565 DL 566

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/543 (64%), Positives = 427/543 (78%), Gaps = 15/543 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           EE+F+ASPL+DFLYP RPV +QW  +Y+             LG YSGKG  P+FGDFEAQ
Sbjct: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQ 81

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWMEIT  LPIS+WY++DL+YWGLDYPP TAYHSY  G+LGSF N  WF LN+SRG+ES
Sbjct: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
            D  LK++MR TV+LSE V YIPAV+YFT+W+G+HRNQSPIGQ++A AAILFQPSL+LID
Sbjct: 142 ID--LKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILID 199

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYN VMLGL VY INNLLDEFYG AAICFVLSL FKQMALYYSP+ F YL S+S  
Sbjct: 200 HGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAY 259

Query: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316
           +P  N  RF  +AI+T+++F  ++ P+ LFG                N+IQ + R+FPF+
Sbjct: 260 YPRFNFPRFAGIAIATLLTFGALYAPLCLFGD-------------FRNIIQSVYRVFPFS 306

Query: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376
           RGIFEDKVANFWCVTNV+IKYREL+TQ+QLQFY L+ T I   P+ I IFLYP+KFL+PY
Sbjct: 307 RGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPY 366

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           ALAACSM+FFLFSFQVHEK+IL+PL+PITLL+ ST+W+VLS+V WINNVALFTLWPLL+K
Sbjct: 367 ALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKK 426

Query: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKX 496
           DGL+LQY + + LSNWL+GNFSF+TP FLP FLTPGPS+S++ DDYRR SLLP NI W+ 
Sbjct: 427 DGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRI 486

Query: 497 XXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556
                   M  + +LDL+ QPP NYPD+W++  C +GF CF  FWLWN Y++ +MRN +L
Sbjct: 487 IIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSL 546

Query: 557 NDL 559
           N+L
Sbjct: 547 NEL 549

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/542 (66%), Positives = 425/542 (78%), Gaps = 15/542 (2%)

Query: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEAQ 76
           +E+F+ASPLFDFL PFRPV +QW  +Y+             LGS+SG   PPM GDFEAQ
Sbjct: 14  KESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEAQ 73

Query: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136
           RHWME+T +LP+S+WYW+DL YWGLDYPP TAYHSY  GKLG  F+P WF L  SRG ES
Sbjct: 74  RHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQES 133

Query: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196
            D  LK+YMRFTV+LSE + YIP V+YF KW+GKHR Q+PIGQ+IAAAAILFQPSL+LID
Sbjct: 134 MD--LKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILID 191

Query: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256
           HGHFQYNSVMLGLTVYAINNLLDE+Y PAAICFVLS+CFKQMALYY+PIFF YLLSKSL 
Sbjct: 192 HGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKSLF 251

Query: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316
            P  N+ R + VA +T++SF  MF P+Y++G             G+ N++Q I RIFPF+
Sbjct: 252 SPLFNLPRLLAVAAATLISFAAMFFPLYMWG-------------GIRNVLQSIHRIFPFS 298

Query: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376
           RGIFEDKVANFWC +N+ IKY+ L+TQ QLQ YSL AT +GFLP+ I IF YP+K LIPY
Sbjct: 299 RGIFEDKVANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPY 358

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           AL ACSMSFFLFSFQVHEK+IL+PL+PITLLYTSTDWNVLS+V WINN+A FTLWPLL+K
Sbjct: 359 ALTACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKK 418

Query: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKX 496
           DGLVLQY     LSNWLIGNFSF+TP+FLP FLTPGPS S++ ++YRR SLLP NI WK 
Sbjct: 419 DGLVLQYATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKL 478

Query: 497 XXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556
                   MG + +LD + QPP  YPDLW++LNC++GF  F LFW+WN YK+  +RNKTL
Sbjct: 479 IIVASYISMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTL 538

Query: 557 ND 558
            D
Sbjct: 539 YD 540

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/544 (65%), Positives = 421/544 (77%), Gaps = 15/544 (2%)

Query: 15  GEEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFE 74
            + E F+ASPL+DFL PFRPV +Q+  EYV             LGS+SG+ + P+ GDFE
Sbjct: 7   SKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFE 66

Query: 75  AQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGY 134
           AQRHWME+T HLP+S+WYW+DLQYWGLDYPP TAYHSY  GKLGS  N +WFAL SSRG 
Sbjct: 67  AQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGI 126

Query: 135 ESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLML 194
           E+ D  +K YMRFTVILSEA  YIPAV+YFTKW G  R QSPIGQ+IAAAAILFQPSL+L
Sbjct: 127 ENPD--IKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184

Query: 195 IDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKS 254
           IDHGHFQYNSVMLGLTVY+INNLLD +YGPAAICFVLSLCFKQMALYYSP+FF YLLS+ 
Sbjct: 185 IDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSEC 244

Query: 255 LVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFP 314
           L+ PS N+ RF+ VA STV+SF ++F P+Y+FG             G  N++Q I RIFP
Sbjct: 245 LISPSLNVPRFLSVAFSTVISFCIIFSPLYVFG-------------GTKNVLQSIHRIFP 291

Query: 315 FARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLI 374
           F+RGIFEDKVANFWCV+NV+ KY + +TQ++LQ +S++AT  GFLPS + +  YP+K +I
Sbjct: 292 FSRGIFEDKVANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMI 351

Query: 375 PYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434
           P+ALAACSM+FFLFSFQVHEKSIL+PL+PITLLY STDWNVLS+V WINNVALFTLWPLL
Sbjct: 352 PFALAACSMAFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLL 411

Query: 435 RKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILW 494
           +KD L LQY +   LSNWLIGNFSF+TP+FLP F+TPGPSIS + + YRR S LP N  W
Sbjct: 412 KKDHLTLQYGILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFW 471

Query: 495 KXXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNK 554
           K        +M A+ ILD F   P   PDLW++LNC +GF CF +FWLW +YK+  MRN 
Sbjct: 472 KLIIVASYLIMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNT 531

Query: 555 TLND 558
            L D
Sbjct: 532 NLQD 535

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/546 (63%), Positives = 427/546 (78%), Gaps = 15/546 (2%)

Query: 14  PGEEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDF 73
           PG +EAF+ASPL+DFLYP RPV +QW  +Y+             LG YSG G PPMFGDF
Sbjct: 33  PGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDF 92

Query: 74  EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG 133
           EAQRHWME+TQH+P+SKWY+  LQYWGLDYPP TAYHSY  GKLGS+ +P+WF+L++SRG
Sbjct: 93  EAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRG 152

Query: 134 YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM 193
           YES+D  LK+YMR TVILSE  FYIPAV+YFT+W+G+ R QSPIGQ+IA AAILFQP+L+
Sbjct: 153 YESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALI 210

Query: 194 LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK 253
           LIDHGHFQYN VMLGLTV AINNLLD++Y  AA+ FV SL FKQMALYY+P+ F YLLS+
Sbjct: 211 LIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSR 270

Query: 254 SLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIF 313
           S+ +P  NI RF+ VA++T+++F V++ P+YL G+ S+             + Q I R+F
Sbjct: 271 SIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISA-------------IFQSIHRVF 317

Query: 314 PFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFL 373
           PF RG+FEDKVANFWCVTNV++KY+  +T  QL+F+SLV T    LPS+I  FLYP+KF+
Sbjct: 318 PFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFM 377

Query: 374 IPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPL 433
           +PYALAACSMSFFLF FQVHEK+IL+PL+PITLLYTSTDWNVLS+V WINN+ALFTLWPL
Sbjct: 378 LPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPL 437

Query: 434 LRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNIL 493
           L+KDGL LQY + + LSNWLIGNFSFITP FLP  LTPGPS+S++ D YRR SLLP NI+
Sbjct: 438 LKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNII 497

Query: 494 WKXXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRN 553
           W+         +GA+ I +L++ P    PD+W++ NC VG   F LFW+WNNYK+  MRN
Sbjct: 498 WRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRN 557

Query: 554 KTLNDL 559
            T++DL
Sbjct: 558 STISDL 563

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/545 (64%), Positives = 426/545 (78%), Gaps = 15/545 (2%)

Query: 16  EEEAFYASPLFDFLYPFRPVGSQWLTEYVXXXXXXXXXXXXSLGSYSGKGTPPMFGDFEA 75
           + E FYASPL+ FL PF+   +QWL+ Y+             LG YSG    PMFGDFEA
Sbjct: 29  DTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEA 88

Query: 76  QRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYE 135
           QRHWMEITQHLPIS+WY++DLQYWGLDYPP TAYHSY  G +G FFNP WF L +SRG E
Sbjct: 89  QRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGME 148

Query: 136 SDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLI 195
             +  LKT+MR T I+SE +FYIPA++YFT W+GK R QSP+GQ+IAAAAILFQP LMLI
Sbjct: 149 MKE--LKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLI 206

Query: 196 DHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSL 255
           DHGHFQYNSVMLGLTVYAINNLLD+ Y PAAI FV+S+CFKQM+LYY+PIFF YLL +SL
Sbjct: 207 DHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSL 266

Query: 256 VHPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFP 314
                 N+SRF+ +AI+T+VSF  +F P+Y+FG             G  N+IQ + RIFP
Sbjct: 267 FKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG------------GKRNIIQSVHRIFP 314

Query: 315 FARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLI 374
           FARGIFEDKVANFWCVTNV++KY+  +TQ++LQ YSL+ T++GFLP+M+TI  +P+K L+
Sbjct: 315 FARGIFEDKVANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLL 374

Query: 375 PYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434
           PY+LAAC+MSFFLFSFQVHEK+IL+PL+PITLLYTSTDWNVLSLV WINNVALFTLWPLL
Sbjct: 375 PYSLAACAMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLL 434

Query: 435 RKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILW 494
           +KDG+VLQY VC+ LSNWLIGNFSF TP+FLP  LTPGP I N++  YRR SLLP+NI+W
Sbjct: 435 KKDGVVLQYGVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIW 494

Query: 495 KXXXXXXXXVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNK 554
           K        VM A+Q L+LF +PP  YPD++++LNCT+GF CF  FWLWN YK+  + +K
Sbjct: 495 KIIIVLSYIVMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSK 554

Query: 555 TLNDL 559
            L  L
Sbjct: 555 NLQYL 559

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 112/427 (26%), Positives = 197/427 (46%), Gaps = 64/427 (14%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPPF AY  +F  +    F  +   L+  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 132 RGYESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPS 191
              E   + +  + R TVI+SE + ++   V+        + QS    F+ A++I+  P 
Sbjct: 103 PEGEFGWSTI-VFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPG 157

Query: 192 LMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLL 251
            ++IDH HFQYN  + G+ + +I    ++ Y    + + ++LCFK + LY +P +F +LL
Sbjct: 158 FLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLL 217

Query: 252 SKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGL------NNL 305
              ++    N   F   +   ++  VV +G +   G       I+  V G+       ++
Sbjct: 218 RAYVL----NFQDFKFKSYKDLI-LVVQWGNLMKLGG------IVVCVMGVCFGPFWRDM 266

Query: 306 IQCIRRIFPFARGIFEDKVA-NFWCVTNVVIK----------YRELFTQEQLQ------- 347
            Q + R+FPF+RG+     A NFW + + V K          + +    ++++       
Sbjct: 267 NQLLSRLFPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNN 326

Query: 348 ---------FYSLVATLIGFLPSMITIFLYPRKFLIPY-----------ALAACSMSFFL 387
                    F+ ++  +   L  ++T+F Y    ++P            +L  C  + FL
Sbjct: 327 GSRGLVEDVFFVILPQIQPNLTFVLTLF-YQVLAVVPVLFDPSFKRFIGSLTLCGFASFL 385

Query: 388 FSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKDGLVLQYFVCY 447
           F + VHEK+ILL ++P + L    D  +LS    + +    +L+PLL K    L    C 
Sbjct: 386 FGWHVHEKAILLVIIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFKGQDFL--LKCL 442

Query: 448 FLSNWLI 454
           +L  W I
Sbjct: 443 YLIVWCI 449

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  127 bits (318), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 119/435 (27%), Positives = 195/435 (44%), Gaps = 72/435 (16%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT +LPISKWY+ +   W LDYPPF AY  +   +    F P+    +  
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSR----FAPEIVKNDGC 119

Query: 132 RG-YESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILF 188
               E    GL T  + R TVI+SE + +     Y      K R Q     F+ A++I+ 
Sbjct: 120 LDIVEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVL 175

Query: 189 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFG 248
            P  ++IDH HFQYN  +  + + +I     + Y   A+ + +SLCFK + LY +P +F 
Sbjct: 176 SPGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFV 235

Query: 249 YLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQC 308
           +LL   ++    N   F   +   + S V+ +  ++      S    I     +  L Q 
Sbjct: 236 FLLRAYVL----NFENFKFKSYMDLQS-VIQWKRLFKLAGIVSGIFTICFAPFIFQLPQV 290

Query: 309 IRRIFPFARGIFEDKVA-NFWC--------VTNVVIKY---------------------- 337
           + R+FPF+RG+     A NFW         +T V++++                      
Sbjct: 291 LSRLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPILPKTAAE 350

Query: 338 -RELFTQE--------QLQFYSLVATLIGFLPSMITIFLYPRKFLIPY-----------A 377
            RE   Q         Q  F+ ++  +   L  ++T+F Y    +IP            +
Sbjct: 351 IRERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLF-YQILAVIPLLFDPSYKRFIGS 409

Query: 378 LAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKD 437
           L  C M+ +LF + VHEK+I+L ++P + L  S D  +L     +      +L+PLL ++
Sbjct: 410 LTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVS-DRRLLISFMLVTAAGYVSLFPLLFEN 468

Query: 438 G---LVLQYFVCYFL 449
               L + Y  C+F+
Sbjct: 469 QDFLLKILYTFCWFI 483

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  126 bits (316), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 114/418 (27%), Positives = 188/418 (44%), Gaps = 67/418 (16%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LPIS+WY+     W LDYPPF AY  +F  +       D   L+  
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
              E    GL T  + R TVI SE + Y    +Y        R+QS    F+ A++I+  
Sbjct: 126 ---EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLS 178

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P  ++IDH HFQYN  +  + + +I    ++ Y   A  +  ++CFK + LY +P +F +
Sbjct: 179 PGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVF 238

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCI 309
           LL   ++    N++ F   +    + F++ +  ++  GS       I  V   + + Q +
Sbjct: 239 LLRAYVL----NVNNFKFKSYKDFL-FLIRWANLFKLGSIVIGIFTICFVPFAHQMPQVL 293

Query: 310 RRIFPFARGIFEDKVA-NFWC--------VTNVVIK--YRELFTQE-------------- 344
            R+FPF+RG+     A NFW         +T V++K  Y   F  +              
Sbjct: 294 SRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEI 353

Query: 345 ---------------QLQFYSLVATLIGFLPSMITIFLYPRKFLIPY-----------AL 378
                          Q  F+ ++  +   L  ++T+F Y    ++P            +L
Sbjct: 354 NERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTLF-YQNLAVLPLLFDPSFKRFVGSL 412

Query: 379 AACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
             C ++ FLF + VHEK+I+L ++P T L    D  +L     + +    +L+PLL K
Sbjct: 413 TLCGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYPLLYK 469

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  123 bits (309), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 183/419 (43%), Gaps = 67/419 (15%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  +F  +    F P +   +  
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPSYVKSDGC 91

Query: 132 RG-YESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILF 188
               E    G+ T  + R TVI SE + ++   VY        R QS    F+ A++I  
Sbjct: 92  LDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAI 147

Query: 189 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFG 248
            P  ++IDH HFQYN  +  + + +I    ++ Y      + ++LCFK + LY +P +F 
Sbjct: 148 SPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFV 207

Query: 249 YLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQC 308
           +LL   ++    N+  F   +   ++ F+V +  +   GS       +A    + +L Q 
Sbjct: 208 FLLRAYVL----NLKDFKFKSYRDLI-FIVKWRHLVKLGSVVIATFAVAFGPFIFDLPQL 262

Query: 309 IRRIFPFARGIFEDKVA-NFWCVTNVVIKYRELFTQEQLQFYSLVATLIG---------- 357
           + R+FPF+RG+     A NFW + + + K   +   +    Y L +  I           
Sbjct: 263 LTRLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNE 322

Query: 358 ----------------------FLPSMI------TIFLYPRKFLIPY-----------AL 378
                                  LP ++         LY    ++P            ++
Sbjct: 323 IKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSM 382

Query: 379 AACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRKD 437
             C ++ FLF + VHEK+I+L ++P + L  S D  +LS    + +    +L+PLL + 
Sbjct: 383 TLCGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLLYES 440

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  123 bits (308), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 110/417 (26%), Positives = 191/417 (45%), Gaps = 66/417 (15%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+S+WY+     W LDYPPF AY  +F  +       D   L+  
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
              E    GL T  + R TVI SE + +    +Y        R+QS    F+ A++I+  
Sbjct: 126 ---EVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLS 178

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P  ++IDH HFQYN  +  + + +I    ++ Y   A+ +  S+CFK + LY +P +F +
Sbjct: 179 PGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVF 238

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCI 309
           LL   ++    N++ F   +    + F++ +  ++  GS       I  +   + + Q +
Sbjct: 239 LLRAYVL----NVNNFKFKSYKDFL-FLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVL 293

Query: 310 RRIFPFARGIFEDKVA-NFWC--------VTNVVIK--YRELFTQEQLQ----------- 347
            R+FPF+RG+     A NFW         +T +++K  Y  +F  + ++           
Sbjct: 294 SRLFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPKDIKEI 353

Query: 348 -----------------FYSLVATLIGFLPSMITIFLYPRKFLIPY-----------ALA 379
                            F+ ++  +   L  ++TIF Y    ++P            +L 
Sbjct: 354 NERLLANNGSKGLVQDVFFVILPQIPPRLTFILTIF-YQILAVLPILFDPSFKRFIGSLT 412

Query: 380 ACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
            C ++ +LF + VHEK+I+L ++P T L    D  +L     + +    +L+PLL K
Sbjct: 413 LCGLASYLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLIPFMLVASAGYVSLYPLLFK 468

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  122 bits (306), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 112/424 (26%), Positives = 188/424 (44%), Gaps = 79/424 (18%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LPIS+WY+     W LDYPPF AY  +F  +         F   S 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQ---------FVPKSV 116

Query: 132 RG------YESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAA 183
           R        E    GL T  + R TVI SE + ++   +Y        R+QS    F+ A
Sbjct: 117 RDDGCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVA 172

Query: 184 AAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYS 243
           ++I+  P  ++IDH HFQYN  +  + + +I    ++ Y   A+ +  ++CFK + LY +
Sbjct: 173 SSIVLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLA 232

Query: 244 PIFFGYLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLN 303
           P +F +LL   ++    N++ F   +    + F++ +  +    +       I  +   +
Sbjct: 233 PCYFVFLLRAYVL----NVNNFKFKSYKDFL-FLIRWANLLKLATVVVGIFTICFLPFAH 287

Query: 304 NLIQCIRRIFPFARGIFEDKVA-NFWC--------VTNVVIK--YRELFTQE-------- 344
            + Q + R+FPF+RG+     A NFW         +T V++K  Y   F  +        
Sbjct: 288 QMPQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIP 347

Query: 345 ---------------------QLQFYSLVATLIGFLPSMITIFLYPRKFLIPY------- 376
                                Q  F+ ++  +   L  ++TIF Y    ++P        
Sbjct: 348 QNIKEINERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIF-YQVLAVLPLLFDPSFK 406

Query: 377 ----ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWP 432
               +L  C ++ FLF + VHEK+I+L ++P T L    D  +L     + +    +L+P
Sbjct: 407 RFVGSLTLCGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYVSLYP 465

Query: 433 LLRK 436
           LL K
Sbjct: 466 LLYK 469

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 112/418 (26%), Positives = 184/418 (44%), Gaps = 67/418 (16%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ KWY+     W LDYPPF AY    F  L S F P     +  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAY----FEWLLSQFVPQRVQDDGC 99

Query: 132 RGYESDDN-GLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILF 188
               +    GL T  + R TVI+SE + ++   VY  K     R+      F+ A++I+ 
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVL 155

Query: 189 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFG 248
            P  ++IDH HFQYN  +  + + +I     + Y      F  +LCFK + LY +P FF 
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 249 YLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQC 308
           +LL   ++    + S F     + ++S +V +  ++  G+       +     +  L Q 
Sbjct: 216 FLLRVYIL----DFSNFRFRTYNDLIS-MVRWKNLFKLGTVVLSVFAVCFAPFIYQLPQL 270

Query: 309 IRRIFPFARGIFEDKVA-NFWCVTNVVIKYRELF-------------------------- 341
           + R+FPF+RG+     A NFW + + + K   LF                          
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 342 TQEQLQFYSL-----------------------VATLIGFLPSMITIFLYPRKFLIPYAL 378
            + +LQ Y++                       + TL   + ++I +   P       +L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 379 AACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
             C  + FLF + VHEK++LL ++P + L T TD  +L+    + +    +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLHE 447

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  119 bits (299), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 109/422 (25%), Positives = 190/422 (45%), Gaps = 72/422 (17%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALN-- 129
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  +F  +       D   L+  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 130 --SSRGYESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAIL 187
                G+ +       + R +VI+SE + ++    +  K     R QS    FI A +I+
Sbjct: 114 PVGQFGWAT-----VVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSII 164

Query: 188 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFF 247
             P  ++IDH HFQYN  +  + + +I     E Y    + + ++LCFK + LY +P +F
Sbjct: 165 LSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYF 224

Query: 248 GYLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQ 307
            +LL   ++    N+  F   +   ++  ++ +  ++  G        I  +  + +L Q
Sbjct: 225 VFLLRAYVL----NVKNFKFKSYKDLI-LLIQWNNLFKLGGIVLSIFGICFLPFIYHLPQ 279

Query: 308 CIRRIFPFARGIFEDKVA-NFWCV--------TNVVIKY------------RELF--TQE 344
              R+FPF RG+     A NFW +        T +++K               LF  T+E
Sbjct: 280 VFTRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTRE 339

Query: 345 QLQ------------------FYSLVATLIGFLPSMITIFLYPRKFLIPY---------- 376
           ++Q                  ++ ++  +I  L  ++T F Y    ++P           
Sbjct: 340 EIQSRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGF-YQLLAVVPLLFDPSFKRFI 398

Query: 377 -ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
            +L  C M+ FLF + VHEK+ILL ++P + L    D  +L+    +++    +L+PLL 
Sbjct: 399 GSLTLCGMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLY 457

Query: 436 KD 437
           K+
Sbjct: 458 KN 459

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  117 bits (294), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 130/262 (49%), Gaps = 15/262 (5%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LPISKWY+     W LDYPPF AY  +F  +       D   L+  
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
              E    GL T  + R TVI S+ + ++   VY        R+QS    F+ A++I+  
Sbjct: 126 ---EVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLS 178

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P   +IDH HFQYN  +  + + +I     + Y   AI +  ++CFK + LY +P +F +
Sbjct: 179 PGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVF 238

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCI 309
           LL   ++    N++ F   +    + F++ +  ++  GS       I  +   + + Q +
Sbjct: 239 LLRAYVL----NVNNFKFKSYKDFL-FLIRWANLFKLGSIVIGIFTICFLPFAHQMPQVL 293

Query: 310 RRIFPFARGIFEDKVA-NFWCV 330
            R+FPF+RG+     A NFW +
Sbjct: 294 SRLFPFSRGLTHAYWAPNFWAL 315

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           +L  C ++ FLF + VHEK+I+L ++P T L    D  +L     I +    +L+PLL K
Sbjct: 411 SLTLCGLASFLFGWHVHEKAIMLVIVPFTFL-VGFDRRLLVPFMLIASAGYVSLYPLLYK 469

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  117 bits (292), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 110/422 (26%), Positives = 188/422 (44%), Gaps = 73/422 (17%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT +LP+ +WY+     W LDYPPF AY  +F  +    F P    +   
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQ----FVPG--TVKQD 98

Query: 132 RGYESDDNG-----LKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAI 186
              E  D G        + R TVILSE + ++   V+        R QS    F+ A++I
Sbjct: 99  GCLEIVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSI 154

Query: 187 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIF 246
           +  P+ +++DH HFQYN  +  + + +I       Y   A  + ++LCFK + LY +P +
Sbjct: 155 VLSPAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCY 214

Query: 247 FGYLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLI 306
           F +LL    +    N   F   +   ++ F+V +  ++  GS       +     + +L 
Sbjct: 215 FVFLLRAYCL----NFQDFKFKSYKDLI-FIVKWRHLFQLGSIVIGVFALCFGPFVKDLP 269

Query: 307 QCIRRIFPFARGIFEDKVA-NFWC--------VTNVVIK--YRELFTQEQLQ-------- 347
           Q + R+FPF+RG+     A NFW         +T V++K  Y   FT + +Q        
Sbjct: 270 QVLTRLFPFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTI 329

Query: 348 ---------------------FYSLVATLIGFLPSMITIFLYPRKFLIPY---------- 376
                                F+ ++  +   L   +T F Y    +IP           
Sbjct: 330 DEIKQRIAQNNNGTKGLVQDVFFVILPQITPKLTFALTAF-YQVLAVIPVLFDPSYKRFI 388

Query: 377 -ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
            +L  C ++ +LF + VHEK+I+L ++P + L  + D  +L+    +      +L+PLL 
Sbjct: 389 GSLTLCGLASYLFGWHVHEKAIMLAIVPFSFL-VACDRRLLTSYMLLAASGYVSLFPLLY 447

Query: 436 KD 437
           ++
Sbjct: 448 EN 449

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 187/418 (44%), Gaps = 67/418 (16%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPPF AY  +   +L     P+    +  
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLV----PNIVRQDGC 99

Query: 132 RG-YESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILF 188
               +    G+ T  + R TVI SE + ++   VY  K     R+      F+ A++I+ 
Sbjct: 100 LDIVKVGQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVL 155

Query: 189 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFG 248
            P  ++IDH HFQYN  +  + + +I    ++ Y    + F +++CFK + LY +P FF 
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFV 215

Query: 249 YLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQC 308
           +LL   ++    + S F   + + ++S +V +  ++  GS       +     ++   Q 
Sbjct: 216 FLLRVYVL----DFSNFHFKSYNDLIS-IVQWRNLFKLGSVVLCVFGVCFAPFISQWPQL 270

Query: 309 IRRIFPFARGIFEDKVA-NFWCVTNVVIKYREL--------------------------- 340
           + R+FPF+RG+     A NFW + +++ K   L                           
Sbjct: 271 LSRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGE 330

Query: 341 FTQEQLQF----------------------YSLVATLIGFLPSMITIFLYPRKFLIPYAL 378
             Q+ LQ+                       + + TL   + ++I +   P       +L
Sbjct: 331 IKQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSL 390

Query: 379 AACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
             C  + FLF + VHEK+I+L ++P + L TS D  +L+    + +    +L+PLL +
Sbjct: 391 TLCGFASFLFGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHE 447

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 116/434 (26%), Positives = 192/434 (44%), Gaps = 75/434 (17%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP++KWY      W LDYPPF AY  +F  +    F P   A +  
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQ----FVPKSVAEDGC 107

Query: 132 RG-YESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQ----FIAAA 184
               +    GL T  + R TVILSE V Y    V+         N S I +    F+ A+
Sbjct: 108 LDIVKVGSFGLPTIIFQRITVILSELVLYAALQVFI--------NTSDISEKSANFVVAS 159

Query: 185 AILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSP 244
           +I+  P L+++DH HFQYN  + G+ + +I    ++ Y   A  F ++LCFK + LY +P
Sbjct: 160 SIVLSPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAP 219

Query: 245 IFFGYLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNN 304
            +F +LL   ++    + S F   +   ++S +V +  +    S       +A +  +  
Sbjct: 220 AYFVFLLRAYVL----DFSSFKFRSYKDLIS-IVQWSNLLKLASVVMGIFSLAFLPFITT 274

Query: 305 LIQCIRRIFPFARGI--------------FEDKVANFWCVT------------------- 331
             Q + R+FPF+RG+              F DKV     +                    
Sbjct: 275 WQQLLARLFPFSRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQKILSIVLTSMPKTA 334

Query: 332 ---NVVIKYRELFTQEQLQ--FYSLVATLIGFLPSMITIFLYPRKFLIPY---------- 376
              +V I+     T+  +Q  F+ ++  +   L  ++T+F Y    ++P           
Sbjct: 335 ADIHVRIESNNSGTRGLVQDVFFVVLPQITPKLTFLLTLF-YQILAVVPVLFDPSFKRFV 393

Query: 377 -ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435
            +L  C    FLF + VHEK+I+L + P + L    D  +L+    + +    +L+PLL 
Sbjct: 394 GSLTLCGFVSFLFGWHVHEKAIMLVIFPFSFL-VPFDRRLLTPFTLLASAGYVSLFPLLY 452

Query: 436 KDGLVLQYFVCYFL 449
           +    L  F+  F+
Sbjct: 453 ESQDFLLKFLYTFI 466

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  114 bits (286), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 183/417 (43%), Gaps = 69/417 (16%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  +   +    F P     + +
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQ----FVPKIVKEDGA 110

Query: 132 RG-YESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILF 188
               E    G  T  + R TVI SE + ++   V+        + +S    F+ A++I+ 
Sbjct: 111 LDIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVL 166

Query: 189 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFG 248
            P  ++IDH HFQYN  +    + +I     + Y   A  + ++LCFK + LY +P +F 
Sbjct: 167 SPGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFV 226

Query: 249 YLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQC 308
           +LL   ++    N   F   +   ++ F+V +  ++   S       I     L +L Q 
Sbjct: 227 FLLRAYVL----NFKNFEFKSYKDLI-FIVQWKHLFKMASVVLGIFFICFGPFLYDLPQV 281

Query: 309 IRRIFPFARGIFEDKVA-NFWCV--------TNVVIK----------------------- 336
           + R+FPF+RG+     A NFW +        T V++K                       
Sbjct: 282 MTRLFPFSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDD 341

Query: 337 YRELFTQE--------QLQFYSLVATLIGFLPSMITIFLYPRKFLIPY-----------A 377
            +E   Q         Q  F++++  +   L  ++T+F Y    +IP            +
Sbjct: 342 LKERLVQNNSGTKGLVQDVFFAILPQISPKLTFILTMF-YQALAVIPLLFDPSFKRFIGS 400

Query: 378 LAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434
           L  C +S +LF + VHEK+I+L ++P + L    D  +LS    +      +L+PLL
Sbjct: 401 LTLCGLSSYLFGWHVHEKAIMLVIVPFSFL-VVCDRRLLSSFMLVAAAGYVSLFPLL 456

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  114 bits (284), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 127/262 (48%), Gaps = 15/262 (5%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+WM IT  LPISKWY+ +   W LDYPPF AY  +F  +       D   L+  
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDI- 167

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
              E    G  T  + R TVI+SE   +     Y        R QS    F+ A++I+  
Sbjct: 168 --VEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLS 221

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P  +++DH HFQYN+ +  + + +I     + Y   A+ + ++LCFK + LY +P +F +
Sbjct: 222 PGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVF 281

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCI 309
           LL   ++    N   F   +   ++ F+V +  +   GS       I     +  + Q +
Sbjct: 282 LLRAYVL----NFKDFKFKSYKDLI-FIVQWRRLLKLGSIVLGIFGICFAPFIFQMPQVL 336

Query: 310 RRIFPFARGIFEDKVA-NFWCV 330
            R+FPF+RG+     A NFW +
Sbjct: 337 SRLFPFSRGLTHAYWAPNFWAI 358

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           +L  C ++ +LF + VHEK+ILL ++P + L    D  +LS    + +    +L+PLL +
Sbjct: 454 SLTLCGLASYLFGWHVHEKAILLVIIPFSFLVV-CDRRLLSSFMLVASAGYVSLFPLLYE 512

Query: 437 D 437
           +
Sbjct: 513 N 513

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 110/427 (25%), Positives = 186/427 (43%), Gaps = 81/427 (18%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLG-SFFNPDWFALNS 130
           DF+  R+W+ IT  + +  WY+     W LDYPPF AY  +F   L  SF   D      
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRD----GC 119

Query: 131 SRGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILF 188
               E    G  T  + R TVI SE++ ++   +Y      + R QS    FI A++I+ 
Sbjct: 120 LDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVL 175

Query: 189 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFG 248
            P  +++DH HFQYN  +  + V +I    ++ Y   A+ + ++LCFK + LY +P +F 
Sbjct: 176 SPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFV 235

Query: 249 YLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLN----- 303
           +LL   ++    N   F   +   ++ F++ +  +   G       I+  V  L      
Sbjct: 236 FLLRVYVL----NFENFKFRSYKDLI-FLIRWKNLCQLGM------IVVGVFSLCFGPFI 284

Query: 304 -NLIQCIRRIFPFARGIFEDKVA-NFWCVTNVVIKYRELFTQEQLQFYSLVATLIG--FL 359
            ++ Q + R+FPF+RG+     A NFW + + + K   +F       ++  A  I    L
Sbjct: 285 FDMPQLLSRLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLL 344

Query: 360 PS-------------------------------------MITIFLYPRKFLIPY------ 376
           PS                                     ++T+F Y    +IP       
Sbjct: 345 PSSIEEIRQRIAEHNNGTKGLVQDVFFVILPQISPKLTFLLTLF-YQILAVIPLLFDPSF 403

Query: 377 -----ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLW 431
                +L  C M+ +LF + VHEK+I+L ++P + L    D  +L     +++    +L+
Sbjct: 404 KRFMGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFL-VVFDRRLLISFTLVSSAGYVSLF 462

Query: 432 PLLRKDG 438
           PLL ++ 
Sbjct: 463 PLLYENA 469

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 108/421 (25%), Positives = 187/421 (44%), Gaps = 71/421 (16%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ +T  LP+ +WY+     W LDYPPF AY  +   +       D   L+  
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
              E    G  T  + R +VI SE + ++    +      K R QS    FI A +I+  
Sbjct: 116 ---EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILS 168

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P  +++DH HFQYN  +  + + +I     + Y   A+ +  +LCFK + LY +P +F +
Sbjct: 169 PGFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVF 228

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSG--LNNLIQ 307
           LL   ++    N+  F   +   +V  V       L G   S   I+    G  + ++ Q
Sbjct: 229 LLRAYVL----NVKGFQFKSYKDLVRLVQWTNLFRLAGVVLS---IVGVCFGPFIFDMPQ 281

Query: 308 CIRRIFPFARGIFEDKVA-NFWCV--------TNVVIKYRELFT---------------- 342
            + R+FPF+RG+     A NFW +        T +++K   + T                
Sbjct: 282 LLTRLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATIK 341

Query: 343 --QEQLQ-------------FYSLVATLIGFLPSMITIFLYPRKFLIPY----------- 376
             Q++L              ++ ++  ++  L  ++T+F Y    +IP            
Sbjct: 342 EIQKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLF-YQLLAVIPLLFDPSFKRFIG 400

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           +L  C M+ +LF + VHEK+I+L ++P + L    D  +LS     ++    +L+PLL +
Sbjct: 401 SLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVC-DRRLLSSFMLASSAGYVSLFPLLYE 459

Query: 437 D 437
           +
Sbjct: 460 N 460

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 105/415 (25%), Positives = 176/415 (42%), Gaps = 65/415 (15%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ +WY      W LDYPPF AY  +F  +       D   L+  
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDI- 106

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
              E  + G+ T  + R TVI+SE + ++   ++    + K         FI A++I+  
Sbjct: 107 --VEVGNFGMPTIIFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLS 160

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P  +++DH HFQYN  +  + + AI       Y      F  +LCFK + LY +P FF +
Sbjct: 161 PGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVF 220

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCI 309
           LL   ++    + + F   +   +VS +V +      G        +     ++ + Q +
Sbjct: 221 LLRAYIL----DFTNFKFKSYKDLVS-IVKWQRALKLGLVVLGIFAVCFAPFISEMPQLL 275

Query: 310 RRIFPFARGIFEDKVA-NFWC------------------VTNVVIKY------------- 337
            R+FPF+RG+     A NFW                   V   +IK+             
Sbjct: 276 ERLFPFSRGLTHAYWAPNFWALYSLLDKVLTFVMLRLPYVHRFIIKFVAPPLIPATIDEI 335

Query: 338 RELFTQEQLQFYSLVA------------------TLIGFLPSMITIFLYPRKFLIPYALA 379
           ++  +Q  +    LV                   TL   + ++I +   P       +L 
Sbjct: 336 KQRLSQNNVGTRGLVQDVYFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFAGSLT 395

Query: 380 ACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434
            C  S FLF + VHEK+I+L ++P + L T  D  +++    + +    +L+PLL
Sbjct: 396 LCGFSSFLFGWHVHEKAIMLVIIPFSFLVT-LDRRLVTPFRLLVSAGYVSLFPLL 449

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  104 bits (259), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 128/290 (44%), Gaps = 19/290 (6%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKL--GSFFNPDWFALN 129
           DFE  R+W+ +T  LP+ KWY      W +DYPP  A+  +   ++  G+        L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 130 SSRGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAIL 187
           +   Y     G  T  + R TVI SE + Y+   VY +    + R  +    F+   ++ 
Sbjct: 119 AEGRY-----GWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVA 169

Query: 188 FQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFF 247
             P+ +L+DH HFQYN  +  + V +I    +  Y      F ++LC K + LY +P +F
Sbjct: 170 LSPAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYF 229

Query: 248 GYLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQ 307
            +LL   ++    ++  F   +   +V F V +G +   G        +        + Q
Sbjct: 230 VFLLRAYVL----DLGEFRFRSYRDLV-FAVRWGNLCRLGGVVLAIMAVTFAPFAGVMPQ 284

Query: 308 CIRRIFPFARGIFEDKVA-NFWCVTNVVIKYRELFTQEQLQFYSLVATLI 356
            + R+FPF+RG+     A NFW + + V K            Y L  +L+
Sbjct: 285 LMARLFPFSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLV 334

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 109/415 (26%), Positives = 170/415 (40%), Gaps = 65/415 (15%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           D E  R+W+ +T  LP+  WY      W LDYPPF AY  +   +       D   L+  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 132 RGYESDDNGLKT--YMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQ 189
           +       G  T  ++R TVI +E + ++   V+        R  +    FI A++I   
Sbjct: 153 K---EGKFGWPTVVFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIALS 205

Query: 190 PSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGY 249
           P  +++DH HFQYN  +  + + +I     E Y      F   LCFK + LY +P +F +
Sbjct: 206 PGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTF 265

Query: 250 LLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCI 309
           LL   ++    N S F       ++ FVV +  +   G        +  V  +  L Q I
Sbjct: 266 LLRAYVL----NFSNFSFRTYRDLI-FVVRWFNLLKLGVIIVSILAVCFVPFIPVLPQLI 320

Query: 310 RRIFPFARGI--------------FEDKVANF---------WCVTNVV-----------I 335
            R+FPF+RG+              F D++  F          C T +V           I
Sbjct: 321 SRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNSIEEI 380

Query: 336 KYR--------ELFTQE-------QLQ-FYSLVATLIGFLPSMITIFLYPRKFLIPYALA 379
           K R            Q+       Q+Q   +   TL   + ++I +   P        L 
Sbjct: 381 KNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFIGCLT 440

Query: 380 ACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLL 434
            C  S FLF + VHEK+I+L ++P + L  S D  +L+    +      +L+PLL
Sbjct: 441 LCGFSSFLFGWHVHEKAIMLVIVPFSFL-VSMDRRLLTPFMLLTASGYVSLFPLL 494

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 97.8 bits (242), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 127/271 (46%), Gaps = 21/271 (7%)

Query: 72  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSS 131
           DF+  R+W+ IT  LP+ +WY+     W LDYPPF AY  +   +    F P   A+ + 
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQ----FVPA--AVRAD 106

Query: 132 RGYESDDNGL-----KTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAI 186
              +    G+       + R TVI SE + ++   VY        + QS    F+ A++I
Sbjct: 107 GCLDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSI 162

Query: 187 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIF 246
           +  P L+++DH HFQYN  +  + + +I       +   A  +  +LCFK + LY +P +
Sbjct: 163 VLSPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCY 222

Query: 247 FGYLLSKSLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLI 306
           F +LL   ++        F   +   +   ++ +G ++  G       ++       ++ 
Sbjct: 223 FMFLLRTYVL----QFEGFRFKSYKDLFR-IIHWGRLFKLGGVVLGVAVVCFAPFARDMP 277

Query: 307 QCIRRIFPFARGIFEDKVA-NFWCVTNVVIK 336
           Q + R+FPF+RG+     A NFW + ++  K
Sbjct: 278 QLLSRLFPFSRGLTHAYWAPNFWALYSLCDK 308

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436
           +L  C  + FLF + VHEK+I+L ++P + L    D  +L+    +      +L+PLL K
Sbjct: 399 SLTLCGFASFLFGWHVHEKAIMLVIIPFSFL-VVYDRRLLTSFKLVTTAGYVSLFPLLYK 457

Query: 437 D 437
           +
Sbjct: 458 N 458

>YBR184W Chr2 (597363..598934) [1572 bp, 523 aa] {ON} Putative
           protein of unknown function; YBR184W is not an essential
           gene
          Length = 523

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 3/80 (3%)

Query: 324 VANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPYALAACSM 383
           V N W  T   I   +L   E  QF  L     GF   +     +P+ F   Y  +A  +
Sbjct: 322 VDNIWECTRYAI---QLLKSEAAQFTLLRDIYSGFTIILSNHRYHPKGFSADYCYSANEL 378

Query: 384 SFFLFSFQVHEKSILLPLMP 403
           + FLF  +  +K +L   +P
Sbjct: 379 TLFLFVIRTGQKKVLYRSIP 398

>KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa]
           {ON} Anc_2.571 YKL047W
          Length = 489

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 7/83 (8%)

Query: 94  FDLQY---WGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYESDDNGLKTYMR---F 147
            D++Y    G    PFT Y  Y+  KL S  N  WF  N  +  +S  +  +++ R    
Sbjct: 102 LDVEYDSERGTKQGPFTEYGHYYINKLESLLNA-WFTANDVKNTDSFKDFYESHARDKDI 160

Query: 148 TVILSEAVFYIPAVVYFTKWLGK 170
           T +       IP + Y   W+ +
Sbjct: 161 TTLELGVESQIPMIHYLYHWIKR 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.144    0.478 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,996,622
Number of extensions: 2554733
Number of successful extensions: 6731
Number of sequences better than 10.0: 53
Number of HSP's gapped: 6781
Number of HSP's successfully gapped: 73
Length of query: 559
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 444
Effective length of database: 40,294,809
Effective search space: 17890895196
Effective search space used: 17890895196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)