Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G009405.526ON78278227330.0
TPHA0K005405.526ON675571074e-04
ZYRO0D12540g5.526ON5481021056e-04
NDAI0C010705.526ON757671020.002
NCAS0H025505.526ON743731010.002
YML006C (GIS4)5.526ON774561010.002
Skud_13.1485.526ON779561000.002
Smik_13.1455.526ON774561000.002
TDEL0A039005.526ON67165970.006
Suva_13.1565.526ON77270970.007
Kpol_1023.995.526ON55170960.007
SAKL0G04906g5.526ON60870920.021
Kwal_47.186465.526ON63585870.087
CAGL0K07271g5.526ON77667870.11
KLTH0G03740g5.526ON63155850.15
Ecym_40615.526ON66371820.33
KNAG0B037105.526ON71173800.72
TBLA0D016605.526ON86673771.5
KLLA0A01782g5.526ON52870752.7
NDAI0A015007.413ON104745743.4
NOTE: 5 genes in the same pillar as TBLA0G00940 were not hit in these BLAST results
LIST: NCAS0F01080 KAFR0C05390 KNAG0C03240 ADR198C NDAI0H01590

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G00940
         (782 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...  1057   0.0  
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    46   4e-04
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...    45   6e-04
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...    44   0.002
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...    44   0.002
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...    44   0.002
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...    43   0.002
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...    43   0.002
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...    42   0.006
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...    42   0.007
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    42   0.007
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...    40   0.021
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...    38   0.087
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...    38   0.11 
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...    37   0.15 
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    36   0.33 
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...    35   0.72 
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...    34   1.5  
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...    33   2.7  
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    33   3.4  

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 1057 bits (2733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/782 (71%), Positives = 563/782 (71%)

Query: 1   MPIPATQTYSIVDDNDIEYNLWTWYLNNIEEKTFHEFNEIENXXXXXXXXXXXXXXXFTV 60
           MPIPATQTYSIVDDNDIEYNLWTWYLNNIEEKTFHEFNEIEN               FTV
Sbjct: 1   MPIPATQTYSIVDDNDIEYNLWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFTV 60

Query: 61  TNINTKKVKNIIFLTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSCN 120
           TNINTKKVKNIIFLTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSCN
Sbjct: 61  TNINTKKVKNIIFLTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSCN 120

Query: 121 YCLIMDPILNFQNTTFKESYDSILSHIKSQKNKIKRNRELSTKNSNSSLLIRSLKNKSHY 180
           YCLIMDPILNFQNTTFKESYDSILSHIKSQKNKIKRNRELSTKNSNSSLLIRSLKNKSHY
Sbjct: 121 YCLIMDPILNFQNTTFKESYDSILSHIKSQKNKIKRNRELSTKNSNSSLLIRSLKNKSHY 180

Query: 181 NSMTNCHSATMLXXXXXXXXXXXXXXXXXXXXXXXXXXXIVYQPXXXXXXXXXXSLDEEL 240
           NSMTNCHSATML                           IVYQP          SLDEEL
Sbjct: 181 NSMTNCHSATMLNYSFYSNSNSRTTNYTNNNSSSKKSFSIVYQPNANANANINASLDEEL 240

Query: 241 NKIAISTPSSQSIRSENLKRHGYXXXXXXXXXXXXXXXXXIVIDFPRRFXXXXXXXXXXX 300
           NKIAISTPSSQSIRSENLKRHGY                 IVIDFPRRF           
Sbjct: 241 NKIAISTPSSQSIRSENLKRHGYSNDDDDDDNESEGDVDSIVIDFPRRFTRSTLLSSTSS 300

Query: 301 XXXXXXXXXXXXXLLNVNSPPLSEINSINSFEYFDSENDSMSPLTRTDLKDRTISEVPLI 360
                        LLNVNSPPLSEINSINSFEYFDSENDSMSPLTRTDLKDRTISEVPLI
Sbjct: 301 NNQNNYTNTSSKSLLNVNSPPLSEINSINSFEYFDSENDSMSPLTRTDLKDRTISEVPLI 360

Query: 361 GKKDNQLKVNEELIKTTFKAFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHYQPIIR 420
           GKKDNQLKVNEELIKTTFKAF                                HYQPIIR
Sbjct: 361 GKKDNQLKVNEELIKTTFKAFSKESISITTSSSSASSSSLNSGSISTSQSSITHYQPIIR 420

Query: 421 EFTADTGXXXXXXXXXXXXXXATNDNETFLTNTFVXXXXXXXXXXXXXXXXXXXXXXXXX 480
           EFTADTG              ATNDNETFLTNTFV                         
Sbjct: 421 EFTADTGSRRNSHSSTSSFVRATNDNETFLTNTFVSSHNNSGSSIINNKFNNNMNSSRNS 480

Query: 481 XXXXXXXXXXXXXRQHATTSFEGNIIRYGSRSTEEVSLDGNIYNQTYXXXXXXXXXXXXX 540
                        RQHATTSFEGNIIRYGSRSTEEVSLDGNIYNQTY             
Sbjct: 481 STTTSSSQLLNISRQHATTSFEGNIIRYGSRSTEEVSLDGNIYNQTYYSDSNVDSVSSSS 540

Query: 541 XXXXXKFKTAASNTSSNFDQENRRMNLNCIILKKIGNTNGDFFTAIKEYNELYSKWLIFD 600
                KFKTAASNTSSNFDQENRRMNLNCIILKKIGNTNGDFFTAIKEYNELYSKWLIFD
Sbjct: 541 SLYLSKFKTAASNTSSNFDQENRRMNLNCIILKKIGNTNGDFFTAIKEYNELYSKWLIFD 600

Query: 601 STFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNTVVKNETSFQNRKTEILDINLTPSTSK 660
           STFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNTVVKNETSFQNRKTEILDINLTPSTSK
Sbjct: 601 STFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNTVVKNETSFQNRKTEILDINLTPSTSK 660

Query: 661 DNNTKADDFIFFDDLKEKELSLEIHGNEIDEDEIYHEEKNYALEEEHQQRELENQGVAIN 720
           DNNTKADDFIFFDDLKEKELSLEIHGNEIDEDEIYHEEKNYALEEEHQQRELENQGVAIN
Sbjct: 661 DNNTKADDFIFFDDLKEKELSLEIHGNEIDEDEIYHEEKNYALEEEHQQRELENQGVAIN 720

Query: 721 QETYXXXXXXXXXXXXXXXXXXXXXXXXKTNELGTSVESNNDEANKDFSKDFNHFENASI 780
           QETY                        KTNELGTSVESNNDEANKDFSKDFNHFENASI
Sbjct: 721 QETYSCSTSISSNSSSSNSSSYLSDHNNKTNELGTSVESNNDEANKDFSKDFNHFENASI 780

Query: 781 TS 782
           TS
Sbjct: 781 TS 782

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 6/57 (10%)

Query: 580 GDFFTAIKEYNELY------SKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYS 630
           G+ FTA+++ N L        +WL++DS F  +  ++V+ + L++I   F KIFFYS
Sbjct: 354 GESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYS 410

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 10/102 (9%)

Query: 564 RMNLNCIILKKIGNTNGDFFTAIKEYNELYSK------WLIFDSTFQTEKSQLVSFDKLL 617
           R+ L  ++   I  T+ + FTAI++ N   +K      WL++DS F     Q+++   L 
Sbjct: 312 RLVLQSVLF--INPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLS 369

Query: 618 EIAKSFSKIFFYSYNNTVVKNETSFQNRKTEILDINLTPSTS 659
           E+ K   K+ FYS    V  +  S ++  TE   I+ T STS
Sbjct: 370 ELNKGCPKVLFYSLVEVV--DTPSLEDADTECATISNTASTS 409

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 19/127 (14%)

Query: 13  DDNDIEYNLWTWYLNNIEEKTFHEF--NEIENXXXXXXXXXXXXXXXFTVTNINTKKVKN 70
           DDN     LW+WYL NI    F E   N++++               +    +N +K   
Sbjct: 14  DDN----GLWSWYLTNIRNGDFEELTRNQLKH------SLFKRFLRTYLEPTLNERKDTK 63

Query: 71  IIFLTLPKTKNFQTRDSYFYLQKYLELI-FSVQQLYITKLQNNTSTTPSCNYCLIMDPIL 129
           ++ +++P+          ++L  YL L    + +L  +++ N+       N+ ++MD   
Sbjct: 64  VLIVSIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHE------NHYVVMDKEN 117

Query: 130 NFQNTTF 136
           NF+N+ F
Sbjct: 118 NFKNSNF 124

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNT 634
           + FTAI++ N       +   WL++DS F  +  Q+++   LL+  ++F KI FYS    
Sbjct: 491 EIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDLLDSNRTFPKILFYS---M 547

Query: 635 VVKNETS 641
           V+ NE+S
Sbjct: 548 VIVNESS 554

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 564 RMNLNCIILKKIGNTNGDFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLL 617
           R+ L  I+++       + +TAI++ N      ++   WL++DS F  +  Q+++   LL
Sbjct: 437 RLVLQSILIQHP--VTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDLL 494

Query: 618 EIAKSFSKIFFYS 630
           +  +SF KI FYS
Sbjct: 495 DTNRSFPKILFYS 507

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYS 630
           + FTAI++ N       +   WL++DS F     Q+++   LL+I +SF KI FY+
Sbjct: 465 EIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYT 520

 Score = 38.9 bits (89), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 13/129 (10%)

Query: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENXXXXXXXXXXXXXXXFTVTNINTKKVKNIIF 73
           DND +  LW+WYL N+    F E   I N               +   NI+ +  K I+ 
Sbjct: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDNNISARPNKKILL 68

Query: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDNLN 122

Query: 130 NFQNTTFKE 138
           NFQ+ TF E
Sbjct: 123 NFQDPTFLE 131

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYS 630
           + FTAI++ N       +   WL++DS F     Q+++   LL+I +SF KI FY+
Sbjct: 472 EIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYT 527

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENXXXXXXXXXXXXXXXFTVTNINTKKVKNIIF 73
           DND +  LW+WYL N+    F E   I N               +   N + +  K I+ 
Sbjct: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILL 68

Query: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDNLN 122

Query: 130 NFQNTTFKE 138
           NFQ+ TF E
Sbjct: 123 NFQDPTFLE 131

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYS 630
           + FTAI++ N       +   WL++DS F     Q+++   LL+I +SF KI FY+
Sbjct: 468 EIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYT 523

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 13/129 (10%)

Query: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENXXXXXXXXXXXXXXXFTVTNINTKKVKNIIF 73
           DND +  LW+WYL N+    F E   I N               +   +I+ +  K I+ 
Sbjct: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILL 68

Query: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDNLN 122

Query: 130 NFQNTTFKE 138
           NFQ+ TF E
Sbjct: 123 NFQDPTFLE 131

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNT 634
           + +TAI++ N      ++   WL++DS F     Q+++  +LL++ +SF KI FYS    
Sbjct: 415 EIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQELLDMNRSFPKIIFYSM--I 472

Query: 635 VVKNE 639
           VV +E
Sbjct: 473 VVSDE 477

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 570 IILKKIGNTNGD---FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIA 620
           ++L+ I   N D    FTAI++ N       +   WL++DS F     Q+++   LL+I 
Sbjct: 450 LVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDLLDIK 509

Query: 621 KSFSKIFFYS 630
           +SF KI  Y+
Sbjct: 510 RSFPKILLYT 519

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENXXXXXXXXXXXXXXXFTVTNINTKKVKNIIF 73
           DND +  LW+WYL N+    F E   I N               +   N + +  K I+ 
Sbjct: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILL 68

Query: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDYLN 122

Query: 130 NFQNTTFKE 138
           NFQ+ +F E
Sbjct: 123 NFQDPSFLE 131

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 570 IILKKIGNTNGD---FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIA 620
           ++L+ I   N D     TAI++ N      ++   WL++DS F     Q++S ++LL I 
Sbjct: 262 LVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSLNELLHIN 321

Query: 621 KSFSKIFFYS 630
           K + KI FYS
Sbjct: 322 KDYPKILFYS 331

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 570 IILKKIGNTNGD---FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIA 620
           ++L+ I   N D    FTA+++ N       +   WL++D  F     Q++S   +LEI 
Sbjct: 314 LVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEIN 373

Query: 621 KSFSKIFFYS 630
           + F KI FY+
Sbjct: 374 RFFPKILFYT 383

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 10/85 (11%)

Query: 564 RMNLNCIILKKIGNTNGDFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLL 617
           R+ L  I++++        +TA+++ N       +   WL++D  F     Q+++   +L
Sbjct: 334 RLVLQSILIQQTDTRQ--LYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVL 391

Query: 618 EIAKSFSKIFFYSYNNTVVKNETSF 642
           EI K F K+ FYS    VV +E + 
Sbjct: 392 EINKFFPKVLFYSL--IVVTDEVAI 414

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 9/67 (13%)

Query: 581 DFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYSYNNT 634
           + FTA+++ N      ++   WL++D+ F     Q+++   ++ I K + KI FY+    
Sbjct: 483 EVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDIMTIKKDYPKILFYTM--- 539

Query: 635 VVKNETS 641
           VV N+ S
Sbjct: 540 VVINDRS 546

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 582 FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYS 630
            FTA+++ N       +   WL++D  F     Q+++   +LE+ K F KI FYS
Sbjct: 350 LFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYS 404

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 11/71 (15%)

Query: 582 FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIAKSFSKIFFYSY---- 631
             TA+++ N      ++   WL++D  F     Q+VS   + E+   F KI FYS     
Sbjct: 358 LLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIP 417

Query: 632 -NNTVVKNETS 641
            NNT  K   S
Sbjct: 418 CNNTASKEANS 428

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 9/73 (12%)

Query: 564 RMNLNCIILKKIGNTNGDFFTAIKEYNE------LYSKWLIFDSTFQTEKSQLVSFDKLL 617
           R+ L  ++L++    +   FTAI++ N       +   W+++DS F      +++   L 
Sbjct: 475 RLVLQSVLLQR---EDKAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNNLMMMTLRGLF 531

Query: 618 EIAKSFSKIFFYS 630
             +++ SKI FYS
Sbjct: 532 NFSENMSKILFYS 544

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 17/127 (13%)

Query: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENXXXXXXXXXXXXXXXFTVTNINTKKVKNIIF 73
           DND +  LW+WYL NI    F E     N                ++  IN+K    I+F
Sbjct: 12  DND-DNGLWSWYLQNIRSGDFEEL--THNELKYTLLKRFLKNHFTSLEGINSK----ILF 64

Query: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129
           +++P     +       L+ +L+  F ++ L   K+Q    TT +C    N+ L+ D + 
Sbjct: 65  ISIPD----KVHSDISVLETFLKDYFHLEDLQNIKIQK--LTTSNCYNHENHYLLTDTLN 118

Query: 130 NFQNTTF 136
           NF +  F
Sbjct: 119 NFNDRKF 125

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 564 RMNLNCIILKKIGNTNGDFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLL 617
           R+ L CI++          +TAI++ +      ++   WL++D  F  +  ++++  +LL
Sbjct: 513 RLVLQCILIYHPHAEKT--YTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQELL 570

Query: 618 EIAKSFSKIFFYS 630
           +  + + KI FY+
Sbjct: 571 DFNRDYPKILFYT 583

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 1  MPIPATQTYSIVD--DNDIEYNLWTWYLNNIEEKTFHEFNE 39
          MP+   +   + D  DND    LW+WYL+NI    F E  E
Sbjct: 1  MPVTKPKPVQVNDYYDND-NNGLWSWYLSNIRNGMFEELTE 40

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 570 IILKKIGNTNGD---FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLLEIA 620
           ++L+ I  TN +    FT I++        ++   WL++D+ F     Q++S   +L+ +
Sbjct: 291 LVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLYDILDFS 350

Query: 621 KSFSKIFFYS 630
           K   KI FYS
Sbjct: 351 KFLPKILFYS 360

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 337 ENDSMSPLTRTDLKDRTISEVPLIGKKDNQLKVNEELIKTTFKAF 381
           E+ S + L   D+K R++SE  + GKK +Q+KV   + K    AF
Sbjct: 703 ESSSKAALLEEDMKKRSVSEAVVKGKKTHQVKVRPGMKKQQTSAF 747

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,890,811
Number of extensions: 2778852
Number of successful extensions: 12949
Number of sequences better than 10.0: 91
Number of HSP's gapped: 13484
Number of HSP's successfully gapped: 104
Length of query: 782
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 664
Effective length of database: 39,950,811
Effective search space: 26527338504
Effective search space used: 26527338504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)