Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0G009305.528ON60860824260.0
KAFR0C054005.528ON481602801e-25
NDAI0C010605.528ON637662751e-24
NCAS0H025605.528ON587662704e-24
TPHA0K005205.528ON560672661e-23
SAKL0G04950g5.528ON567552661e-23
CAGL0H04631g5.528ON588672652e-23
Kwal_47.186315.528ON584552642e-23
KLTH0G03784g5.528ON569552562e-22
Skud_13.1475.528ON665592562e-22
KNAG0B036805.528ON482822542e-22
Kpol_1023.975.528ON591552553e-22
Suva_13.1555.528ON6451952563e-22
Smik_13.1445.528ON639592553e-22
YML007W (YAP1)5.528ON650592553e-22
KLLA0A01760g5.528ON5831812544e-22
TDEL0A039205.528ON466542498e-22
ZYRO0D12584g5.528ON579542473e-21
Kpol_1004.225.528ON475552356e-20
TPHA0D023405.528ON506542321e-19
TBLA0D016405.528ON599501832e-13
NCAS0F011005.528ON475881618e-11
NDAI0H016105.528ON519671582e-10
YDR423C (CAD1)5.528ON409531411e-08
Ecym_40645.528ON426721331e-07
CAGL0F03069g5.528ON486701287e-07
Smik_4.6985.528ON393531261e-06
Suva_2.600singletonOFF382531251e-06
ADR195C5.528ON288761098e-05
KNAG0C032105.528ON384921101e-04
KAFR0E032905.528ON26581790.44
YPR199C (ARR1)na 1ON29458732.6
NOTE: 1 genes in the same pillar as TBLA0G00930 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0G00930
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   939   0.0  
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   112   1e-25
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   110   1e-24
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   108   4e-24
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....   107   1e-23
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   107   1e-23
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   106   2e-23
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   106   2e-23
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   103   2e-22
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   103   2e-22
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   102   2e-22
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   102   3e-22
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   103   3e-22
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   102   3e-22
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   102   3e-22
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   102   4e-22
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   100   8e-22
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   100   3e-21
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    95   6e-20
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    94   1e-19
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    75   2e-13
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    67   8e-11
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    65   2e-10
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    59   1e-08
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    56   1e-07
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    54   7e-07
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    53   1e-06
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    53   1e-06
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    47   8e-05
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    47   1e-04
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    35   0.44 
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    33   2.6  

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/608 (78%), Positives = 480/608 (78%)

Query: 1   MSDTAVMPTNSSTIKRHLDASDXXXXXXXXXXXXXXXXXVGRKLSDQEAKSKXXXXXXXX 60
           MSDTAVMPTNSSTIKRHLDASD                 VGRKLSDQEAKSK        
Sbjct: 1   MSDTAVMPTNSSTIKRHLDASDANETASATKETKKKSNKVGRKLSDQEAKSKRTAQNRAA 60

Query: 61  XXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKV 120
                     KMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKV
Sbjct: 61  QRAFRERRERKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKV 120

Query: 121 KEYLSTHKFDPSVVSASNKNSPNDISNNTQIPSPNSSRFDDQVHXXXXXXXXXXXXNILN 180
           KEYLSTHKFDPSVVSASNKNSPNDISNNTQIPSPNSSRFDDQVH            NILN
Sbjct: 121 KEYLSTHKFDPSVVSASNKNSPNDISNNTQIPSPNSSRFDDQVHSPSSETSSKISSNILN 180

Query: 181 NQDDSNTPKXXXXXXXXXXXXXXXNTWVENVLYKEDNEELPQFKMSNRTPSVXXXXXXXX 240
           NQDDSNTPK               NTWVENVLYKEDNEELPQFKMSNRTPSV        
Sbjct: 181 NQDDSNTPKSLYSMPTSIPSSSSTNTWVENVLYKEDNEELPQFKMSNRTPSVSNSNNNNN 240

Query: 241 XXXXXXXXXXPSAFQYTTDFFSNQLNFDNSPSDVNNILPSTLKQTNSDSLNSDSPHIKNV 300
                     PSAFQYTTDFFSNQLNFDNSPSDVNNILPSTLKQTNSDSLNSDSPHIKNV
Sbjct: 241 NNNNNNNNKNPSAFQYTTDFFSNQLNFDNSPSDVNNILPSTLKQTNSDSLNSDSPHIKNV 300

Query: 301 KDNDMNDASILEPSKFFGSSSFDFTNSINLGNSPQQNFGRIGFGDFDMSMSLDSSKFWGT 360
           KDNDMNDASILEPSKFFGSSSFDFTNSINLGNSPQQNFGRIGFGDFDMSMSLDSSKFWGT
Sbjct: 301 KDNDMNDASILEPSKFFGSSSFDFTNSINLGNSPQQNFGRIGFGDFDMSMSLDSSKFWGT 360

Query: 361 XXXXXXXXXXXTHTPTDFNKMSSVKSAVKGCNELLKNEQXXXXXXXXXXXXXXKLRNSNI 420
                      THTPTDFNKMSSVKSAVKGCNELLKNEQ              KLRNSNI
Sbjct: 361 NSISNNNSNNSTHTPTDFNKMSSVKSAVKGCNELLKNEQNIANNAASKSTNNSKLRNSNI 420

Query: 421 TITPLADDNNIPFIDTSLAFNDIPTNLSNDNEFNMQLFKTNRKSSDDDFFKFLMDEDNDI 480
           TITPLADDNNIPFIDTSLAFNDIPTNLSNDNEFNMQLFKTNRKSSDDDFFKFLMDEDNDI
Sbjct: 421 TITPLADDNNIPFIDTSLAFNDIPTNLSNDNEFNMQLFKTNRKSSDDDFFKFLMDEDNDI 480

Query: 481 LXXXXXXXXXXXXXXXXXXXXXXXTPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSISV 540
           L                       TPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSISV
Sbjct: 481 LNGNNNSTENNEDNNSILNNLINETPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSISV 540

Query: 541 MSIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQ 600
           MSIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQ
Sbjct: 541 MSIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQ 600

Query: 601 KALTKHLS 608
           KALTKHLS
Sbjct: 601 KALTKHLS 608

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%)

Query: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608
           K KN ++CSEVWDRIT+HPKYSD+DIDGLC ELM KAKCSEKGVVV A+DVQ AL+KHLS
Sbjct: 422 KDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHLS 481

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 49/83 (59%)

Query: 46  DQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105
           DQEAK K                  KM+ELE KV  L  + K++EIES+FLR QL  L+ 
Sbjct: 43  DQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIESEFLRSQLITLVK 102

Query: 106 ELQRYRPERQNDAKVKEYLSTHK 128
           EL++YRPE  ND++V  YL+ H+
Sbjct: 103 ELKKYRPETANDSQVLNYLAKHE 125

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 56/66 (84%), Gaps = 2/66 (3%)

Query: 543 IIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKA 602
           I+   D G   ++CSE+WDRIT+HPKYS+LDIDGLC+ELM KAKCSE+GVVV A+DVQ A
Sbjct: 574 IVPSRDGG--LLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMA 631

Query: 603 LTKHLS 608
           LTKH+S
Sbjct: 632 LTKHMS 637

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%)

Query: 42  RKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLK 101
           ++L D EA++K                  KM+ELE+KV +L ++ K++EIES+FLR QL 
Sbjct: 69  KQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFLRSQLI 128

Query: 102 VLLGELQRYRPERQNDAKVKEYL 124
            L+ EL++Y+P  +N +KV  Y+
Sbjct: 129 TLVNELKKYKPNNENASKVLNYI 151

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  108 bits (270), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 56/66 (84%), Gaps = 2/66 (3%)

Query: 543 IIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKA 602
           I+   D G   ++CSE+WDRI++HPKYSDLDIDGLC+ELM KAKCSE+GVVV A+DVQ A
Sbjct: 524 IVPSRDGG--LLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLA 581

Query: 603 LTKHLS 608
           LTKH+S
Sbjct: 582 LTKHMS 587

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%)

Query: 40  VGRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQ 99
           + +K  D EAK+K                  KM+ELE+KV +L ++ K++EIES+FLR Q
Sbjct: 58  MTKKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQ 117

Query: 100 LKVLLGELQRYRPERQNDAKVKEYLSTH 127
           L  L+ EL++YR    N++KV EYLS H
Sbjct: 118 LITLVNELKKYRDPNPNESKVLEYLSQH 145

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 58/67 (86%), Gaps = 2/67 (2%)

Query: 542 SIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQK 601
           ++IR ED    Y++CS+VW R+T HPKYS+LDIDGLCTELM +AKCSEKGVVV++ DVQK
Sbjct: 495 TVIRAEDGS--YLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQK 552

Query: 602 ALTKHLS 608
           AL+K+LS
Sbjct: 553 ALSKYLS 559

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 40  VGRKL-SDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRD 98
           VGRKL +D + KSK                  K++ELEDKV +LE+V++  E+E+ FLR 
Sbjct: 30  VGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRS 89

Query: 99  QLKVLLGELQRYRPERQNDAKVKEYLS 125
           +LK +  EL++YRP + +D +V EYL+
Sbjct: 90  RLKSMADELKKYRPAQSSDLEVLEYLA 116

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 57/146 (39%), Gaps = 37/146 (25%)

Query: 206 TWVENVLYKEDNEELPQFKMSNRTPSVXXXXXXXXXXXXXXXXXXPSA--------FQYT 257
           TW+  V Y+++ ++LPQF+     P+                   P +        F Y 
Sbjct: 233 TWIHPVFYEDNAKQLPQFEQPKAVPTNMDVSPANSDINQSTSDIVPGSAKSFDAIPFGYD 292

Query: 258 TDFFSNQLNFDNSPSDV----------------NNILPSTLKQTNSDSLNSDSPHIKNVK 301
           +  FSN  NFD+  SD                 NN LPS +    S++ N++S +     
Sbjct: 293 SSLFSNDFNFDDKFSDQVSSFCDKVNNPNYSPENNSLPSLV----SENYNAESHN----- 343

Query: 302 DNDMNDASILEPSKFFGSSSFDFTNS 327
               N  ++ + +  FG   F+F NS
Sbjct: 344 ----NTIALPDTTTEFGKKGFEFANS 365

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 49/55 (89%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608
           ++C E+WDRITSHPKYSDLDIDGLC EL  KAKCSEKGVVV ADDVQKAL KH+S
Sbjct: 513 LKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALAKHMS 567

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 51/85 (60%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK    EAK+K                  KM+ELEDKV  LE V +++E+E++FLR QL
Sbjct: 50  GRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRSQL 109

Query: 101 KVLLGELQRYRPERQNDAKVKEYLS 125
             L+ EL++YRPE+  D +V EYL+
Sbjct: 110 MTLISELKKYRPEQSMDTQVLEYLA 134

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 56/67 (83%), Gaps = 2/67 (2%)

Query: 542 SIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQK 601
           +++   D G   ++CSE+WDRIT+HPKYSD+DIDGLC+ELM KAKCSE+GVV+ ADDVQ 
Sbjct: 524 TVVPSRDDG--LLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQV 581

Query: 602 ALTKHLS 608
           AL KH+S
Sbjct: 582 ALNKHMS 588

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%)

Query: 71  KMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHK 128
           KM+ELE KV  LE + K +E+E+ FLRDQL +L+ EL++YRPE + D KV +YL  HK
Sbjct: 49  KMKELERKVVDLENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKHK 106

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 50/55 (90%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608
           ++CSEVWDRITSHPKYSD+DIDGLC EL  KAKCSEKGVVV  DDVQ+ALTKH+S
Sbjct: 530 LKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALTKHMS 584

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (63%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D EAK+K                  KM+ELE++V+ LE V ++SE+ES+FLR QL
Sbjct: 26  GRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELESEFLRSQL 85

Query: 101 KVLLGELQRYRPERQNDAKVKEYLS 125
           + LL E+Q+YRP + +D++V  +L+
Sbjct: 86  QKLLAEIQKYRPRQSSDSQVLNFLA 110

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608
           ++CSE+WDRIT+HPKYSD+DIDGLC EL  KAKCSEKGVVV +DDVQ AL KH+S
Sbjct: 515 LKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALAKHMS 569

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 67/114 (58%), Gaps = 5/114 (4%)

Query: 12  STIKRHLDASDXXXXXXXXXXXXXXXXXVGRKLSDQEAKSKXXXXXXXXXXXXXXXXXXK 71
           ST+KR L+AS                   GRK  D EAK+K                  K
Sbjct: 2   STVKRQLEAS-----TPPADLPKRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERK 56

Query: 72  MQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLS 125
           M+ELE++V+ LE+V ++SE+ES+FLR QL++L+ E+Q+YRP++ +D++V +YL+
Sbjct: 57  MRELEEQVERLEKVREQSEMESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLA 110

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 40/59 (67%), Positives = 52/59 (88%)

Query: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           K  + ++CSE+WDRIT+HPKYSD+D+DGLC+ELM KAKCSE+GVV+ A+DVQ AL KH+
Sbjct: 606 KEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)

Query: 46  DQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105
           D E K K                  KM ELE KV+ LE + +++E+E+ FLRDQL  L+ 
Sbjct: 63  DPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLVN 122

Query: 106 ELQRYRPERQNDAKVKEYLSTHKFDPSV 133
           EL++YRPE +ND+KV EYL++   DP++
Sbjct: 123 ELKKYRPETRNDSKVLEYLASR--DPNL 148

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  102 bits (254), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 58/82 (70%), Gaps = 5/82 (6%)

Query: 527 PIVQTPNKDPSISVMSIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAK 586
           P    PN+D    V+       K    ++CSE+WDRIT+HPKYSDLDIDGLC ELM KAK
Sbjct: 406 PFSIEPNEDGDPQVVP-----SKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAK 460

Query: 587 CSEKGVVVKADDVQKALTKHLS 608
           CSE+GVVV ADDV+ AL +H++
Sbjct: 461 CSERGVVVNADDVKDALNRHIA 482

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 49/82 (59%)

Query: 46  DQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105
           D+EA+ K                  KM+ELE KV  L  + K++E+ES+FLR QL  L+ 
Sbjct: 46  DKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLVH 105

Query: 106 ELQRYRPERQNDAKVKEYLSTH 127
           EL++YRPE  ND+KV EYL+ H
Sbjct: 106 ELKKYRPETSNDSKVLEYLAKH 127

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 41/55 (74%), Positives = 50/55 (90%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608
           ++CSEVWDRIT+HP+YSD+DIDGLC ELMH AKCS+KGVVV + DVQKAL+ H+S
Sbjct: 537 LKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALSNHMS 591

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 40  VGRKL-SDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRD 98
           VGRKL  D E K+K                  KM+ELEDKV  LE+V +++++ES+FLR+
Sbjct: 46  VGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLRN 105

Query: 99  QLKVLLGELQRYRPERQNDAKVKEYLSTHK 128
           QL +++ EL++YRPE+ +D KV EYL+ H+
Sbjct: 106 QLTLMIDELKKYRPEKSSDIKVLEYLAKHE 135

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 76/182 (41%), Gaps = 35/182 (19%)

Query: 207 WVENVLYKEDNEELPQFKMSNRT--------PSVXXXXXXXXXXXXXXXXXXPSAFQYTT 258
           W++NV YK+D + LP F  S+ +        P                         Y +
Sbjct: 227 WMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYDS 286

Query: 259 DFFSNQLNFDN---------------SPSDVNNILPSTLKQTN-------SDSLNSDSPH 296
           D FSN  NFD+               +     N +P T+ ++N       S+   S +P+
Sbjct: 287 DLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTPN 346

Query: 297 IKNVKDNDMNDASILEPSKFFGSSSFDFTNSINL----GNSPQQNFGRIGFGDFDMSMSL 352
            ++  D+ ++ A   +P+  F S S DFTN++++     ++   NFG++GF      ++ 
Sbjct: 347 -ESSNDSSLSIAKFDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITF 405

Query: 353 DS 354
           +S
Sbjct: 406 NS 407

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  103 bits (256), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 103/195 (52%), Gaps = 21/195 (10%)

Query: 431 IPFIDTSLAF-NDIPTNLS--------NDNEFNMQLF-KTNRKSSDDDFFKFLMDEDNDI 480
           IPFI+TSLAF +D PTN+         + N+F+  +F + + K  ++ F +FL ++    
Sbjct: 453 IPFINTSLAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKEGNNLFEEFLEED---D 509

Query: 481 LXXXXXXXXXXXXXXXXXXXXXXXTPAVESTQLAQTPRASDSAH------TSPIVQTPNK 534
                                   +  +++  + + P+     H       S ++Q  N 
Sbjct: 510 DDDDDDGNDGNDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNS 569

Query: 535 DPSISVMSIIRE--EDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGV 592
             S  V     E    K  + ++CSE+WDRIT+HPKYSD+D+DGLC+ELM KAKCSE+GV
Sbjct: 570 SNSEDVNDNDNEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGV 629

Query: 593 VVKADDVQKALTKHL 607
           V+ A+DVQ AL KH+
Sbjct: 630 VINAEDVQLALNKHM 644

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 50/63 (79%), Gaps = 2/63 (3%)

Query: 71  KMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHKFD 130
           KM+ELE KV SLE + +++E+E+ FLRDQL  L+ EL++YRPE +ND+KV EYL+  + D
Sbjct: 88  KMKELEKKVHSLESIQQENEVEATFLRDQLVTLVSELKKYRPETRNDSKVLEYLA--RRD 145

Query: 131 PSV 133
           P++
Sbjct: 146 PNL 148

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/59 (67%), Positives = 52/59 (88%)

Query: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           K  + ++CSE+WDRIT+HPKYSD+D+DGLC+ELM KAKCSE+GVV+ A+DVQ AL KH+
Sbjct: 580 KEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 638

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 67/110 (60%), Gaps = 5/110 (4%)

Query: 46  DQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105
           D E K K                  KM+ELE KV+SLE + +++E+E+ FLRDQL  L+ 
Sbjct: 63  DPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLVTLVN 122

Query: 106 ELQRYRPERQNDAKVKEYLSTHKFDPSVVSASNKNSPNDISNNTQIPSPN 155
           EL++YRPE +ND+KV EYL+  K DP++ S+S K + N   N+  I +PN
Sbjct: 123 ELKKYRPETRNDSKVLEYLA--KRDPNLHSSSIKANHN---NSRPIITPN 167

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/59 (67%), Positives = 52/59 (88%)

Query: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           K  + ++CSE+WDRIT+HPKYSD+D+DGLC+ELM KAKCSE+GVV+ A+DVQ AL KH+
Sbjct: 591 KEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 649

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 7/111 (6%)

Query: 46  DQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105
           D E K K                  KM+ELE KV+SLE + +++E+E+ FLRDQL  L+ 
Sbjct: 63  DPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVN 122

Query: 106 ELQRYRPERQNDAKVKEYLSTHKFDPSV-VSASNKNSPNDISNNTQIPSPN 155
           EL++YRPE +ND+KV EYL+  + DP++  S +N N     SN+  I +PN
Sbjct: 123 ELKKYRPETRNDSKVLEYLA--RRDPNLHFSKNNVNH----SNSEPIDTPN 167

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 90/181 (49%), Gaps = 46/181 (25%)

Query: 431 IPFIDTSLAFNDIPTNLSNDNEFNMQLFKTNRKS----SDDDFFKFLMDEDNDILXXXXX 486
           IPFIDT LAF D    L       + + K  +++     D D  + L++E+         
Sbjct: 444 IPFIDTGLAFPDYDDPL-------LDILKEEQENEQVEGDSDPIQALINEE--------- 487

Query: 487 XXXXXXXXXXXXXXXXXXTPAVESTQLAQTPRASDSAHTSPIVQTPNKDPSISVMSIIRE 546
                                  S  L   P A+  A  S   +  N++    V  II  
Sbjct: 488 ----------------------PSMPLCHDPAANAGASVSETDKLSNQEEI--VQDIIPS 523

Query: 547 EDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKH 606
            D GK  ++CSEVWDRIT+HP+YSDLDIDGLC EL  KAKCSEKGVVV A+DVQKAL  H
Sbjct: 524 ND-GK-LLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALISH 581

Query: 607 L 607
           +
Sbjct: 582 M 582

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 2/90 (2%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  + EAK K                  KM+ELEDKV  LE ++K+SE+E++FLR+Q+
Sbjct: 45  GRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQV 104

Query: 101 KVLLGELQRYRPE--RQNDAKVKEYLSTHK 128
             LL EL+RY PE  ++ D+ + +YL+  +
Sbjct: 105 TNLLSELKRYNPELPKKRDSILLDYLAKQR 134

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  100 bits (249), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 41/54 (75%), Positives = 49/54 (90%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           ++CSEVWDRIT+HPKYS +DIDGLC ELM KAKCSEKGVVV+A+DVQ+ L KH+
Sbjct: 411 LKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLDKHM 464

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 55/88 (62%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D+E K+K                  KM+ELEDKV+SLE+ ++ + +ES+FLR QL
Sbjct: 50  GRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQL 109

Query: 101 KVLLGELQRYRPERQNDAKVKEYLSTHK 128
             L+ EL++YRP + ND +V +YL+ H+
Sbjct: 110 LTLVNELKKYRPAKANDLQVLDYLAKHE 137

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/54 (75%), Positives = 48/54 (88%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           ++CSEVWDRITSHPKYSD+DIDGLC ELM KAKCSE+GVVV+A+DVQ AL   +
Sbjct: 525 LKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (61%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D EAKSK                  KM+ELEDKV +LEE++++S +E++FLR QL
Sbjct: 40  GRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQL 99

Query: 101 KVLLGELQRYRPERQNDAKVKEYLSTHKFDPSVVSASNK 139
             L+ EL+RYRPE  ND++V +YL+  +   S  S+ NK
Sbjct: 100 VTLVTELKRYRPENPNDSQVLQYLAKTENSKSDDSSQNK 138

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 95.1 bits (235), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHLS 608
           M+CSE+WDRIT++P+Y+DLDIDGLC ELM  AKCS+KGVVV + DV K L KH++
Sbjct: 421 MRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLAKHMA 475

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 7/108 (6%)

Query: 46  DQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105
           D EA+ +                  KM+ELE+KV SLE +H+K+E+E++FLR Q+  L+ 
Sbjct: 40  DAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLVN 99

Query: 106 ELQRYRPERQNDAKVKEYLSTHKFDP------SVVSASNKNSP-NDIS 146
           EL++YR E  +D+K+ + +S  + +       S+ S  +  SP NDIS
Sbjct: 100 ELKKYRSETTSDSKILKLVSNSRENTRDLRHDSITSLDSDQSPLNDIS 147

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 47/54 (87%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           ++C E+WDRIT++P+YSD+DIDGLC ELM  AKCS+KGV+V +DDVQK L++ L
Sbjct: 452 LECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLSRRL 505

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%)

Query: 71  KMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHKFD 130
           KM+EL++KV+ LE +++K+EIE+ FLR QL  L+ EL++YR ++ +D ++K+  S  K +
Sbjct: 40  KMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYRIDKNDDFRLKKIGSQLKHE 99

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%)

Query: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKAL 603
           + C+++WDRIT+ PKY+  DI+ LC ELM KAKCS+KGVVV + DV K L
Sbjct: 537 LPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 42  RKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQLK 101
           +K S+ E KSK                  KM+ LE+KV  LE+V +  E E+ FLR QL 
Sbjct: 25  QKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRSQLI 84

Query: 102 VLLGELQRYRPER---QNDAKVKEYLSTHK 128
           +   EL++         N+  +  Y + HK
Sbjct: 85  LFGTELRKQHNTGNTPSNNNSISNYRNRHK 114

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 48/88 (54%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D  AK++                  KM+ELEDK+  LE +   +E+ES FLRD +
Sbjct: 25  GRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRDYM 84

Query: 101 KVLLGELQRYRPERQNDAKVKEYLSTHK 128
             L+ ++Q+YRP    D+KV +YLS  K
Sbjct: 85  MDLICDMQKYRPNNSTDSKVLKYLSLKK 112

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 50/77 (64%), Gaps = 8/77 (10%)

Query: 539 SVMSIIREE---DKG---KNYMQCSEVWDRI-TSHPKYSDLDIDGLCTELMHKAKCSEKG 591
           S+ SI+R++   D G     Y +CS +W R  T  PK+SD DID LC EL+ KAKCS++G
Sbjct: 399 SIPSILRDKTSIDGGMACNKYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEG 458

Query: 592 -VVVKADDVQKALTKHL 607
            +V+++ DV+  L KH 
Sbjct: 459 TIVIRSRDVKNTLRKHF 475

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 9/67 (13%)

Query: 550 GKNYMQCSEVWDRIT--------SHPKYSDLDIDGLCTELMHKAKCSEKG-VVVKADDVQ 600
           G  + +CS++W+RI         S P++ D DID LC ELM KA+CS  G +V+K  D++
Sbjct: 453 GNRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIK 512

Query: 601 KALTKHL 607
           ++L KH 
Sbjct: 513 QSLMKHF 519

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 39/54 (72%)

Query: 72  MQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLS 125
           M+ELEDK+ SLE++  ++ IE+ FLR  +  L+ E+ ++RP+   D+K+ +YLS
Sbjct: 1   MKELEDKISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLS 54

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 1/53 (1%)

Query: 556 CSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKG-VVVKADDVQKALTKHL 607
           C  + + I+S PKYS LDID LC+EL+ KAKC++   +VVKA D+Q AL + L
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 19/125 (15%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D EAKS+                  KM+ L+++V+ LE+   +++  + FL   L
Sbjct: 37  GRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTTDFLLCSL 96

Query: 101 KVLLGELQRYRPERQNDAKVKEYL---------STHKFDPSVVSASNKNSPNDISNNTQI 151
           K LL E+ +YR +  +D ++  +L            K   + VS + K          ++
Sbjct: 97  KSLLSEITKYRAKNSDDERILAFLDDLQEQQKRENEKGTSTAVSKAAK----------EL 146

Query: 152 PSPNS 156
           PSPNS
Sbjct: 147 PSPNS 151

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D EAK++                  KM++LEDKV+ LEE   +SE E Q LR+Q+
Sbjct: 46  GRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSLRNQV 105

Query: 101 KVLLGELQRYRP 112
             LL EL++YRP
Sbjct: 106 VSLLRELKKYRP 117

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 10/70 (14%)

Query: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKG----------VVVKADD 598
           +GK  ++C ++   +     Y  LD + LC ELM+KAK S+ G          VV+KA D
Sbjct: 416 EGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKAGD 475

Query: 599 VQKALTKHLS 608
           +Q+ L KH+S
Sbjct: 476 LQRTLAKHIS 485

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 9/116 (7%)

Query: 40  VGRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQ 99
            GRK+ D EAK+K                  K++ LE+ +  L+ ++ K   E+++L++ 
Sbjct: 12  AGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKEC 71

Query: 100 LKVLLGELQRYRPERQNDAKVKEYLSTHKFD--------PSVVSASN-KNSPNDIS 146
           L  LL E+ +YRP  + D  + + L   K D        P   SA+N  NSP +I+
Sbjct: 72  LSELLTEVTKYRPANEKDQGILKRLKEIKADDLKSVEVVPEQPSATNFMNSPTNIT 127

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 556 CSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKG-VVVKADDVQKALTKHL 607
           C  +   I+S PKYS LDID LC ELM KA+ ++   +VV+A D+Q  L K L
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 556 CSEVWDRITSHPKYSDLDIDGLCTELMHKAKCS-EKGVVVKADDVQKALTKHL 607
           CS +   I+S PK+S LDID LC ELM KAKCS +  ++V+A  +Q  L + L
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GRK  D EAK++                  KM++LED+V+ LEE    +E E Q LR  +
Sbjct: 30  GRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEVQSLRGHV 89

Query: 101 KVLLGELQRYRPERQN 116
             L+ EL+R+R  +Q 
Sbjct: 90  IALVRELRRWRARQQG 105

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLEEVHKKSEIESQFLRDQL 100
           GR+  D EAK+K                  K++ LE K+ +LE ++  +E  ++ +   L
Sbjct: 19  GRRKLDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRAELMAAHL 78

Query: 101 KVLLGELQRYRPERQNDAKVKEYLSTHKFDPS 132
           + LLGE  ++R E+  D  V+E L+    DP+
Sbjct: 79  RDLLGEANKFRGEKPRDKTVRELLTAR--DPT 108

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 539 SVMSIIREEDKGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAK--CSEKGVVVKA 596
           S+ SII E+  G N   C+ V   +T  P Y + D++ LC ELM K K    +  + V  
Sbjct: 313 SLRSIIAEKRCGSNDT-CAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGR 371

Query: 597 DDVQKALTKHLS 608
           +DV+ AL +H++
Sbjct: 372 EDVRSALERHIA 383

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 41  GRKLSDQEAKSKXXXXXXXXXXXXXXXXXXKMQELEDKVKSLE-EVHKKSEIESQFLRDQ 99
           GRK  D +AK+K                  K++ LE++V  L+ E   K+EI  +FL+  
Sbjct: 13  GRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEI-IEFLKQN 71

Query: 100 LKVLLGELQRYRPERQNDAKV 120
           +  LLGE++ YR +   D K+
Sbjct: 72  VMTLLGEIKNYRKQTNKDKKL 92

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 26/58 (44%)

Query: 550 GKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607
           G   +   ++W  +  HPK +  D++ L TEL   A CS   +++      K  +  L
Sbjct: 237 GDVLLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,212,404
Number of extensions: 2617644
Number of successful extensions: 10821
Number of sequences better than 10.0: 73
Number of HSP's gapped: 11219
Number of HSP's successfully gapped: 104
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)